A0A087YBX7_POEFO Loading...

Mitochondrial import inner membrane translocase subunit

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.

AlphaFold DB , UniProt , Accession A0A087YBX7, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 82 aa.

						>A0A087YBX7_POEFO|A0A087YBX7
MDPMKAQQLAAELEVEMMADMYNRMTNACHRKCVPPHYKEAELTKGESVCLDRCVAKYLDLHERLGRKLTELSVQDEEMMRK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60	Low	83.1	Confident	226 Å²	226	107 Å²	107	100%	1.113	58%	0.578	S	S	*	*				0	128.5	0	-66.6	-56.8	-171.6	0	0	107.3
2	D	78	Confident	83.8	Confident	85 Å²	85	108.8 Å²	108.8	46%	0.455	58%	0.58	S	S	.	*			trans	-65.1	123.1	174.5	-176.3	-22.8	0	0	0	108.6	M4 K5 A6	D2-M4 PolarHBondContact O-N 3.26Å; D2-M4 VanDerWaalsContact O-N 3.16Å; D2-M4 PolarHBondContact OD1-N 3.44Å; D2-K5 HydrophobicContact CB-CB 4.37Å; D2-K5 HydrophobicContact CB-CD 4.35Å; D2-K5 HydrophobicContact CB-CG 4.34Å; D2-K5 PolarHBondContact O-N 3.47Å; D2-A6 PolarHBondContact O-N 2.81Å
3	P	77.3	Confident	84.6	Confident	97 Å²	97	106.8 Å²	106.8	63%	0.63	57%	0.569	S	S	*	*	H	α-helix	trans	-57.1	-28.5	-177.4	20.8	-31.8	0	0	0	113.4	A6 Q7	P3-A6 PolarHBondContact O-N 3.02Å; P3-Q7 PolarHBondContact O-N 3.24Å
4	M	81.9	Confident	85.1	Confident	123 Å²	123	107.8 Å²	107.8	61%	0.606	57%	0.569	S	S	*	*	H	α-helix	trans	-68.1	-38.2	175.3	-72.9	-173.7	58.4	0	0	112.6	D2 A6 Q7 Q8	D2-M4 PolarHBondContact O-N 3.26Å; D2-M4 VanDerWaalsContact O-N 3.16Å; D2-M4 PolarHBondContact OD1-N 3.44Å; M4-A6 VanDerWaalsContact C-N 3.34Å; M4-Q7 PolarHBondContact O-N 3.38Å; M4-Q8 WeakPolarHBondContact O-CG 3.38Å; M4-Q8 PolarHBondContact O-N 3.49Å; M4-Q8 VanDerWaalsContact O-N 3.1Å
5	K	85.1	Confident	85.7	Confident	142 Å²	142	107.4 Å²	107.4	62%	0.617	57%	0.572	S	S	*	*	H	α-helix	trans	-69.5	-33.4	176.9	-76.2	-178.3	176.4	178.2	0	112.2	D2 L9	D2-K5 HydrophobicContact CB-CB 4.37Å; D2-K5 HydrophobicContact CB-CD 4.35Å; D2-K5 HydrophobicContact CB-CG 4.34Å; D2-K5 PolarHBondContact O-N 3.47Å; K5-L9 WeakPolarHBondContact O-CB 3.44Å; K5-L9 PolarHBondContact O-N 3.06Å
6	A	85.4	Confident	86.3	Confident	54 Å²	54	109.1 Å²	109.1	45%	0.446	58%	0.576	S	S	.	*	H	α-helix	trans	-66.9	-41.1	176.8	0	0	0	0	0	112	D2 P3 M4 A10	D2-A6 PolarHBondContact O-N 2.81Å; P3-A6 PolarHBondContact O-N 3.02Å; M4-A6 VanDerWaalsContact C-N 3.34Å; A6-A10 PolarHBondContact O-N 3.33Å
7	Q	86.2	Confident	86.7	Confident	148 Å²	148	109.8 Å²	109.8	69%	0.692	58%	0.577	S	S	*	*	H	α-helix	trans	-67.1	-40.6	175	-75.4	178.3	-34.5	0	0	112.5	P3 M4 A10 A11	P3-Q7 PolarHBondContact O-N 3.24Å; M4-Q7 PolarHBondContact O-N 3.38Å; Q7-A10 PolarHBondContact O-N 3.24Å; Q7-A11 PolarHBondContact O-N 2.97Å; Q7-A11 VanDerWaalsContact O-N 3.07Å
8	Q	88.8	Confident	87.1	Confident	110 Å²	110	111.3 Å²	111.3	51%	0.514	58%	0.582	S	S	.	*	H	α-helix	trans	-60.7	-46.6	175.1	-76.4	174.2	-26.4	0	0	111.7	M4 A10 A11 E12	M4-Q8 WeakPolarHBondContact O-CG 3.38Å; M4-Q8 PolarHBondContact O-N 3.49Å; M4-Q8 VanDerWaalsContact O-N 3.1Å; Q8-A10 VanDerWaalsContact C-N 3.33Å; Q8-A10 PolarHBondContact O-N 3.12Å; Q8-A11 PolarHBondContact O-N 3.22Å; Q8-E12 WeakPolarHBondContact O-CG 3.45Å; Q8-E12 PolarHBondContact O-N 3.38Å
9	L	90.1	Very high	87.6	Confident	98 Å²	98	108 Å²	108	51%	0.513	57%	0.572	S	S	.	*	H	α-helix	trans	-62.2	-40.5	177.9	-178.4	62.6	0	0	0	112.2	K5 E12 L13	K5-L9 WeakPolarHBondContact O-CB 3.44Å; K5-L9 PolarHBondContact O-N 3.06Å; L9-E12 PolarHBondContact O-N 2.93Å; L9-L13 HydrophobicContact CD1-CD1 4.48Å; L9-L13 HydrophobicContact CD1-CG 4.47Å; L9-L13 HydrophobicContact CG-CD1 4.19Å; L9-L13 VanDerWaalsContact O-CG 3.29Å; L9-L13 WeakPolarHBondContact O-CG 3.49Å; L9-L13 PolarHBondContact O-N 3.1Å
10	A	89.9	Confident	88.1	Confident	46 Å²	46	106.4 Å²	106.4	38%	0.38	56%	0.564	S	S	.	*	H	α-helix	trans	-61.5	-44.2	176.3	0	0	0	0	0	111.7	A6 Q7 Q8 L13 E14	A6-A10 PolarHBondContact O-N 3.33Å; Q7-A10 PolarHBondContact O-N 3.24Å; Q8-A10 VanDerWaalsContact C-N 3.33Å; Q8-A10 PolarHBondContact O-N 3.12Å; A10-L13 PolarHBondContact O-N 3.45Å; A10-E14 WeakPolarHBondContact O-CG 3.49Å; A10-E14 PolarHBondContact O-N 3.47Å
11	A	91	Very high	88.5	Confident	48 Å²	48	103 Å²	103	40%	0.397	55%	0.546	S	S	.	.	H	α-helix	trans	-65.1	-39.6	177.5	0	0	0	0	0	112.6	Q7 Q8 E14 V15	Q7-A11 PolarHBondContact O-N 2.97Å; Q7-A11 VanDerWaalsContact O-N 3.07Å; Q8-A11 PolarHBondContact O-N 3.22Å; A11-E14 PolarHBondContact O-N 3.02Å; A11-V15 WeakPolarHBondContact O-CG2 3.23Å; A11-V15 PolarHBondContact O-N 2.89Å; A11-V15 VanDerWaalsContact O-N 3.14Å
12	E	92.1	Very high	90.3	Very high	129 Å²	129	98.9 Å²	98.9	60%	0.603	52%	0.519	S	S	*	.	H	α-helix	trans	-61.9	-44.1	175.1	-74.3	172.9	-175.1	0	0	111.6	Q8 L9 V15 E16	Q8-E12 WeakPolarHBondContact O-CG 3.45Å; Q8-E12 PolarHBondContact O-N 3.38Å; L9-E12 PolarHBondContact O-N 2.93Å; E12-V15 PolarHBondContact O-N 3.23Å; E12-E16 PolarHBondContact O-N 3.45Å
13	L	93.5	Very high	91.2	Very high	82 Å²	82	99.1 Å²	99.1	43%	0.429	52%	0.52	S	S	.	.	H	α-helix	trans	-63.5	-40.7	176.6	-71.8	169.7	0	0	0	112	L9 A10 V15 E16 M17	L9-L13 HydrophobicContact CD1-CD1 4.48Å; L9-L13 HydrophobicContact CD1-CG 4.47Å; L9-L13 HydrophobicContact CG-CD1 4.19Å; L9-L13 VanDerWaalsContact O-CG 3.29Å; L9-L13 WeakPolarHBondContact O-CG 3.49Å; L9-L13 PolarHBondContact O-N 3.1Å; A10-L13 PolarHBondContact O-N 3.45Å; L13-V15 VanDerWaalsContact C-N 3.33Å; L13-V15 PolarHBondContact O-N 3.34Å; L13-E16 PolarHBondContact O-N 3.06Å; L13-M17 WeakPolarHBondContact O-CB 3.41Å; L13-M17 VanDerWaalsContact O-CG 3.27Å; L13-M17 WeakPolarHBondContact O-CG 3.22Å; L13-M17 PolarHBondContact O-N 2.94Å
14	E	92	Very high	92.2	Very high	121 Å²	121	101.7 Å²	101.7	57%	0.565	52%	0.517	S	S	*	.	H	α-helix	trans	-57.9	-45.5	174.8	-76.2	176.5	-179.6	0	0	111.7	A10 A11 M17 M18	A10-E14 WeakPolarHBondContact O-CG 3.49Å; A10-E14 PolarHBondContact O-N 3.47Å; A11-E14 PolarHBondContact O-N 3.02Å; E14-M17 HydrophobicContact CG-CE 4.37Å; E14-M17 PolarHBondContact O-N 3.45Å; E14-M18 VanDerWaalsContact O-CG 3.31Å; E14-M18 WeakPolarHBondContact O-CG 3.41Å; E14-M18 PolarHBondContact O-N 3.4Å
15	V	94.3	Very high	93	Very high	102 Å²	102	96.7 Å²	96.7	62%	0.618	49%	0.492	S	S	*	.	H	α-helix	trans	-63.8	-44.5	178.1	173.8	0	0	0	0	111.5	A11 E12 L13 M17 M18 A19	A11-V15 WeakPolarHBondContact O-CG2 3.23Å; A11-V15 PolarHBondContact O-N 2.89Å; A11-V15 VanDerWaalsContact O-N 3.14Å; E12-V15 PolarHBondContact O-N 3.23Å; L13-V15 VanDerWaalsContact C-N 3.33Å; L13-V15 PolarHBondContact O-N 3.34Å; V15-M17 PolarHBondContact O-N 3.27Å; V15-M18 PolarHBondContact O-N 2.97Å; V15-A19 PolarHBondContact O-N 3.05Å
16	E	94.9	Very high	93.6	Very high	135 Å²	135	92.8 Å²	92.8	63%	0.631	48%	0.48	S	S	*	.	H	α-helix	trans	-61.6	-44.6	178.6	-172.9	177.9	-178.6	0	0	111.7	E12 L13 M18 A19 D20	E12-E16 PolarHBondContact O-N 3.45Å; L13-E16 PolarHBondContact O-N 3.06Å; E16-M18 PolarHBondContact O-N 3.18Å; E16-A19 WeakPolarHBondContact O-CB 3.44Å; E16-A19 PolarHBondContact O-N 3.07Å; E16-D20 PolarHBondContact O-N 3.06Å
17	M	93.6	Very high	94.2	Very high	120 Å²	120	95 Å²	95	59%	0.591	49%	0.485	S	S	*	.	H	α-helix	trans	-62.6	-42.5	176.5	-70.8	-172.5	-61.2	0	0	112.1	L13 E14 V15 A19 D20 M21	L13-M17 WeakPolarHBondContact O-CB 3.41Å; L13-M17 VanDerWaalsContact O-CG 3.27Å; L13-M17 WeakPolarHBondContact O-CG 3.22Å; L13-M17 PolarHBondContact O-N 2.94Å; E14-M17 HydrophobicContact CG-CE 4.37Å; E14-M17 PolarHBondContact O-N 3.45Å; V15-M17 PolarHBondContact O-N 3.27Å; M17-A19 VanDerWaalsContact C-N 3.29Å; M17-A19 PolarHBondContact O-N 3.2Å; M17-D20 PolarHBondContact O-N 2.64Å; M17-M21 PolarHBondContact O-N 3.3Å
18	M	94.4	Very high	94.8	Very high	138 Å²	138	89.3 Å²	89.3	68%	0.68	46%	0.463	S	S	*	.	H	α-helix	trans	-63.8	-36.5	176.4	-72.4	-172.2	71.4	0	0	111.9	E14 V15 E16 M21 Y22	E14-M18 VanDerWaalsContact O-CG 3.31Å; E14-M18 WeakPolarHBondContact O-CG 3.41Å; E14-M18 PolarHBondContact O-N 3.4Å; V15-M18 PolarHBondContact O-N 2.97Å; E16-M18 PolarHBondContact O-N 3.18Å; M18-M21 PolarHBondContact O-N 3.48Å; M18-Y22 WeakPolarHBondContact O-CB 3.48Å; M18-Y22 PolarHBondContact O-N 3.01Å
19	A	96.1	Very high	95.3	Very high	48 Å²	48	84.2 Å²	84.2	40%	0.397	44%	0.44	S	S	.	.	H	α-helix	trans	-65.6	-44.3	175.9	0	0	0	0	0	112.2	V15 E16 M17 Y22 N23	V15-A19 PolarHBondContact O-N 3.05Å; E16-A19 WeakPolarHBondContact O-CB 3.44Å; E16-A19 PolarHBondContact O-N 3.07Å; M17-A19 VanDerWaalsContact C-N 3.29Å; M17-A19 PolarHBondContact O-N 3.2Å; A19-Y22 PolarHBondContact O-N 3.24Å; A19-N23 PolarHBondContact O-N 3.16Å; A19-N23 PolarHBondContact O-ND2 3.1Å; A19-N23 VanDerWaalsContact O-ND2 3.16Å
20	D	96.7	Very high	95.7	Very high	75 Å²	75	83.5 Å²	83.5	40%	0.401	43%	0.433	S	S	.	.	H	α-helix	trans	-61.9	-43.5	174.4	-176.3	52.2	0	0	0	111.4	E16 M17 Y22 N23 R24	E16-D20 PolarHBondContact O-N 3.06Å; M17-D20 PolarHBondContact O-N 2.64Å; D20-Y22 VanDerWaalsContact C-N 3.34Å; D20-Y22 PolarHBondContact O-N 3.02Å; D20-N23 PolarHBondContact O-N 2.81Å; D20-R24 VanDerWaalsContact CG-NE 3.33Å; D20-R24 WeakPolarHBondContact O-CG 3.25Å; D20-R24 PolarHBondContact O-N 3.36Å; D20-R24 IonicContact OD1-CZ 3.91Å; D20-R24 IonicContact OD1-NE 3.2Å; D20-R24 PolarHBondContact OD1-NE 3.24Å; D20-R24 IonicContact OD1-NH2 3.69Å; D20-R24 IonicContact OD2-CZ 3.37Å; D20-R24 IonicContact OD2-NE 2.73Å; D20-R24 PolarHBondContact OD2-NE 2.9Å; D20-R24 IonicContact OD2-NH2 3.2Å; D20-R24 PolarHBondContact OD2-NH2 3.43Å
21	M	96.6	Very high	96.1	Very high	37 Å²	37	91.5 Å²	91.5	18%	0.182	45%	0.454	C	S	.	.	H	α-helix	trans	-57.6	-46.9	175.6	-169.2	-138.5	81	0	0	111.5	M17 M18 N23 R24 M25 Y58 L59	M17-M21 PolarHBondContact O-N 3.3Å; M18-M21 PolarHBondContact O-N 3.48Å; M21-N23 PolarHBondContact O-N 2.96Å; M21-R24 PolarHBondContact O-N 2.79Å; M21-M25 HydrophobicContact CE-CE 4.22Å; M21-M25 HydrophobicContact CE-SD 4.09Å; M21-M25 VanDerWaalsContact O-CB 3.28Å; M21-M25 WeakPolarHBondContact O-CB 3.31Å; M21-M25 PolarHBondContact O-N 3.35Å; M21-Y58 HydrophobicContact CG-CE1 4.17Å; M21-L59 HydrophobicContact CE-CD2 3.78Å; M21-L59 HydrophobicContact SD-CD2 4.05Å
22	Y	97.7	Very high	96.4	Very high	139 Å²	139	96.7 Å²	96.7	55%	0.545	47%	0.467	S	S	.	.	H	α-helix	trans	-60	-44.8	178.7	178.5	-95.3	0	0	0	112.1	M18 A19 D20 M25 T26	M18-Y22 WeakPolarHBondContact O-CB 3.48Å; M18-Y22 PolarHBondContact O-N 3.01Å; A19-Y22 PolarHBondContact O-N 3.24Å; D20-Y22 VanDerWaalsContact C-N 3.34Å; D20-Y22 PolarHBondContact O-N 3.02Å; Y22-M25 HydrophobicContact CD2-CE 4.16Å; Y22-M25 PolarHBondContact O-N 3.23Å; Y22-T26 VanDerWaalsContact O-CB 3.32Å; Y22-T26 WeakPolarHBondContact O-CB 3.38Å; Y22-T26 PolarHBondContact O-N 3.12Å; Y22-T26 PolarHBondContact O-OG1 3.46Å
23	N	98.1	Very high	96.7	Very high	89 Å²	89	91.1 Å²	91.1	48%	0.476	44%	0.443	S	S	.	.	H	α-helix	trans	-64.2	-43.6	178.7	-72.3	-34.5	0	0	0	111.9	A19 D20 M21 N27	A19-N23 PolarHBondContact O-N 3.16Å; A19-N23 PolarHBondContact O-ND2 3.1Å; A19-N23 VanDerWaalsContact O-ND2 3.16Å; D20-N23 PolarHBondContact O-N 2.81Å; M21-N23 PolarHBondContact O-N 2.96Å; N23-N27 WeakPolarHBondContact O-CB 3.32Å; N23-N27 PolarHBondContact O-N 3.38Å; N23-N27 PolarHBondContact O-ND2 3.36Å
24	R	98.1	Very high	96.9	Very high	152 Å²	152	88 Å²	88	57%	0.574	43%	0.426	S	S	*	.	H	α-helix	trans	-65.3	-43.9	177.1	-70	177.2	-171.6	-112.6	3.1	112	D20 M21 N27 A28 Y58	D20-R24 VanDerWaalsContact CG-NE 3.33Å; D20-R24 WeakPolarHBondContact O-CG 3.25Å; D20-R24 PolarHBondContact O-N 3.36Å; D20-R24 IonicContact OD1-CZ 3.91Å; D20-R24 IonicContact OD1-NE 3.2Å; D20-R24 PolarHBondContact OD1-NE 3.24Å; D20-R24 IonicContact OD1-NH2 3.69Å; D20-R24 IonicContact OD2-CZ 3.37Å; D20-R24 IonicContact OD2-NE 2.73Å; D20-R24 PolarHBondContact OD2-NE 2.9Å; D20-R24 IonicContact OD2-NH2 3.2Å; D20-R24 PolarHBondContact OD2-NH2 3.43Å; M21-R24 PolarHBondContact O-N 2.79Å; R24-N27 PolarHBondContact O-N 3.04Å; R24-A28 VanDerWaalsContact O-CB 3.3Å; R24-A28 WeakPolarHBondContact O-CB 3.31Å; R24-A28 PolarHBondContact O-N 3.29Å; R24-Y58 WeakPolarHBondContact CB-OH 3.09Å
25	M	98.4	Very high	97.1	Very high	17 Å²	17	85.2 Å²	85.2	8%	0.084	42%	0.419	C	S	.	.	H	α-helix	trans	-60.6	-49.3	177	-178.6	178.1	70.7	0	0	111.3	M21 Y22 N27 A28 C29 V55 Y58 L59	M21-M25 HydrophobicContact CE-CE 4.22Å; M21-M25 HydrophobicContact CE-SD 4.09Å; M21-M25 VanDerWaalsContact O-CB 3.28Å; M21-M25 WeakPolarHBondContact O-CB 3.31Å; M21-M25 PolarHBondContact O-N 3.35Å; Y22-M25 HydrophobicContact CD2-CE 4.16Å; Y22-M25 PolarHBondContact O-N 3.23Å; M25-N27 PolarHBondContact O-N 2.96Å; M25-A28 PolarHBondContact O-N 3.42Å; M25-C29 WeakPolarHBondContact O-CB 3.41Å; M25-C29 PolarHBondContact O-N 3.41Å; M25-V55 HydrophobicContact CE-CG1 4.28Å; M25-V55 HydrophobicContact SD-CB 4.44Å; M25-V55 HydrophobicContact SD-CG1 3.91Å; M25-V55 HydrophobicContact SD-CG2 4.33Å; M25-Y58 HydrophobicContact CB-CD1 3.73Å; M25-Y58 HydrophobicContact CB-CD2 4.31Å; M25-Y58 HydrophobicContact CB-CE1 3.62Å; M25-Y58 HydrophobicContact CB-CE2 4.2Å; M25-Y58 HydrophobicContact CB-CG 4.09Å; M25-Y58 HydrophobicContact CG-CD1 3.6Å; M25-Y58 HydrophobicContact CG-CD2 4.17Å; M25-Y58 HydrophobicContact CG-CE1 4.06Å; M25-Y58 HydrophobicContact CG-CG 3.68Å; M25-Y58 HydrophobicContact SD-CD1 3.88Å; M25-Y58 HydrophobicContact SD-CG 4.3Å; M25-L59 HydrophobicContact SD-CD2 4.22Å; M25-L59 HydrophobicContact SD-CG 4.31Å
26	T	98.3	Very high	97.1	Very high	60 Å²	60	86.4 Å²	86.4	37%	0.368	43%	0.429	S	S	.	.	H	α-helix	trans	-58.6	-48.6	180	-60.1	0	0	0	0	110.8	Y22 A28 C29 H30	Y22-T26 VanDerWaalsContact O-CB 3.32Å; Y22-T26 WeakPolarHBondContact O-CB 3.38Å; Y22-T26 PolarHBondContact O-N 3.12Å; Y22-T26 PolarHBondContact O-OG1 3.46Å; T26-A28 PolarHBondContact O-N 3.47Å; T26-C29 PolarHBondContact O-N 2.88Å; T26-H30 VanDerWaalsContact O-CB 3.24Å; T26-H30 WeakPolarHBondContact O-CB 3.29Å; T26-H30 PolarHBondContact O-N 3.13Å
27	N	98.4	Very high	97.1	Very high	102 Å²	102	86.5 Å²	86.5	55%	0.545	43%	0.429	S	S	.	.	H	α-helix	trans	-62	-41	177	-77.2	-44.4	0	0	0	112.8	N23 R24 M25 R31	N23-N27 WeakPolarHBondContact O-CB 3.32Å; N23-N27 PolarHBondContact O-N 3.38Å; N23-N27 PolarHBondContact O-ND2 3.36Å; R24-N27 PolarHBondContact O-N 3.04Å; M25-N27 PolarHBondContact O-N 2.96Å; N27-R31 WeakPolarHBondContact O-CB 3.43Å; N27-R31 WeakPolarHBondContact O-CG 3.49Å; N27-R31 PolarHBondContact O-N 2.89Å; N27-R31 VanDerWaalsContact O-N 3.1Å
28	A	98.5	Very high	97.2	Very high	28 Å²	28	87.2 Å²	87.2	23%	0.231	43%	0.426	C	S	.	.	H	α-helix	trans	-66	-45.9	178.6	0	0	0	0	0	111.8	R24 M25 T26 R31 K32 Y58	R24-A28 VanDerWaalsContact O-CB 3.3Å; R24-A28 WeakPolarHBondContact O-CB 3.31Å; R24-A28 PolarHBondContact O-N 3.29Å; M25-A28 PolarHBondContact O-N 3.42Å; T26-A28 PolarHBondContact O-N 3.47Å; A28-R31 PolarHBondContact O-N 2.93Å; A28-K32 WeakPolarHBondContact O-CB 3.42Å; A28-K32 VanDerWaalsContact O-CG 3.24Å; A28-K32 WeakPolarHBondContact O-CG 3.43Å; A28-K32 PolarHBondContact O-N 3.14Å; A28-Y58 HydrophobicContact CB-CD2 4.38Å; A28-Y58 HydrophobicContact CB-CE2 4.19Å
29	C	98.7	Very high	97.1	Very high	3 Å²	3	90 Å²	90	2%	0.02	43%	0.434	C	S	.	.	H	α-helix	trans	-72	-38.1	-179	-70.2	0	0	0	0	112.5	M25 T26 R31 K32 C33 L51 C54	M25-C29 WeakPolarHBondContact O-CB 3.41Å; M25-C29 PolarHBondContact O-N 3.41Å; T26-C29 PolarHBondContact O-N 2.88Å; C29-R31 PolarHBondContact O-N 3.08Å; C29-K32 PolarHBondContact O-N 2.99Å; C29-C33 VanDerWaalsContact O-CB 3.3Å; C29-C33 WeakPolarHBondContact O-CB 3.26Å; C29-C33 PolarHBondContact O-N 2.97Å; C29-L51 HydrophobicContact CB-CD2 4.08Å; C29-C54 WeakPolarHBondContact CA-SG 3.02Å; C29-C54 HydrophobicContact CB-CB 3.81Å; C29-C54 WeakPolarHBondContact CB-SG 3.46Å; C29-C54 VanDerWaalsContact SG-C 3.5Å; C29-C54 WeakPolarHBondContact SG-CB 3.37Å; C29-C54 CovalentContact SG-SG 2.05Å; C29-C54 PolarHBondContact SG-SG 3.49Å
30	H	98.1	Very high	97	Very high	82 Å²	82	93.4 Å²	93.4	38%	0.38	44%	0.442	S	S	.	.	H	α-helix	trans	-56.4	-52.2	170.9	-177.5	-85.4	0	0	0	111	T26 K32 C33 V34 Y38	T26-H30 VanDerWaalsContact O-CB 3.24Å; T26-H30 WeakPolarHBondContact O-CB 3.29Å; T26-H30 PolarHBondContact O-N 3.13Å; H30-K32 VanDerWaalsContact C-N 3.27Å; H30-K32 PolarHBondContact O-N 3.43Å; H30-C33 PolarHBondContact O-N 3.37Å; H30-V34 WeakPolarHBondContact O-CB 3.39Å; H30-V34 PolarHBondContact O-N 3.35Å; H30-Y38 PolarHBondContact CE1-OH 3.44Å; H30-Y38 VanDerWaalsContact CE1-OH 3.29Å; H30-Y38 PolarHBondContact NE2-OH 3.28Å
31	R	98.2	Very high	96.9	Very high	214 Å²	214	95.1 Å²	95.1	81%	0.808	47%	0.467	S	S	*	.	H	α-helix	trans	-61.9	-31.2	178.4	-74.8	-178.3	-179.1	-148.3	1.6	114.1	N27 A28 C29	N27-R31 WeakPolarHBondContact O-CB 3.43Å; N27-R31 WeakPolarHBondContact O-CG 3.49Å; N27-R31 PolarHBondContact O-N 2.89Å; N27-R31 VanDerWaalsContact O-N 3.1Å; A28-R31 PolarHBondContact O-N 2.93Å; C29-R31 PolarHBondContact O-N 3.08Å
32	K	98.3	Very high	97	Very high	158 Å²	158	101 Å²	101	69%	0.687	49%	0.494	S	S	*	.	H	α-helix	trans	-82.9	-33.8	-178.1	-76	175.1	-173.5	-66.7	0	113.1	A28 C29 H30	A28-K32 WeakPolarHBondContact O-CB 3.42Å; A28-K32 VanDerWaalsContact O-CG 3.24Å; A28-K32 WeakPolarHBondContact O-CG 3.43Å; A28-K32 PolarHBondContact O-N 3.14Å; C29-K32 PolarHBondContact O-N 2.99Å; H30-K32 VanDerWaalsContact C-N 3.27Å; H30-K32 PolarHBondContact O-N 3.43Å
33	C	98.4	Very high	96.9	Very high	12 Å²	12	98.7 Å²	98.7	8%	0.081	49%	0.49	C	S	.	.	H	α-helix	trans	-112	-24.5	-167.5	-68.3	0	0	0	0	114.1	C29 H30 E47 C50 L51	C29-C33 VanDerWaalsContact O-CB 3.3Å; C29-C33 WeakPolarHBondContact O-CB 3.26Å; C29-C33 PolarHBondContact O-N 2.97Å; H30-C33 PolarHBondContact O-N 3.37Å; C33-E47 WeakPolarHBondContact O-CG 3.24Å; C33-C50 WeakPolarHBondContact CA-SG 3.26Å; C33-C50 HydrophobicContact CB-CB 3.61Å; C33-C50 WeakPolarHBondContact CB-SG 3.49Å; C33-C50 WeakPolarHBondContact SG-CB 3.47Å; C33-C50 PolarHBondContact SG-O 3.46Å; C33-C50 CovalentContact SG-SG 2.05Å; C33-C50 PolarHBondContact SG-SG 3.49Å; C33-L51 HydrophobicContact CB-CD2 3.87Å; C33-L51 HydrophobicContact CB-CG 4.03Å
34	V	97.5	Very high	96.9	Very high	15 Å²	15	97 Å²	97	9%	0.091	48%	0.483	C	S	.	.	S	Bend	trans	-109.8	110.1	-177.7	-173.8	0	0	0	0	109	H30 Y38 L43	H30-V34 WeakPolarHBondContact O-CB 3.39Å; H30-V34 PolarHBondContact O-N 3.35Å; V34-Y38 HydrophobicContact CG1-CD1 4.26Å; V34-Y38 HydrophobicContact CG1-CE1 3.45Å; V34-Y38 VanDerWaalsContact CG1-CE1 3.45Å; V34-L43 HydrophobicContact CG2-CD2 4.33Å
35	P	95.6	Very high	96.9	Very high	64 Å²	64	98.4 Å²	98.4	42%	0.416	49%	0.494	S	S	.	.			trans	-62.8	150.4	179.2	-20.2	32.8	0	0	0	111.8	H37 E47	P35-H37 PolarHBondContact O-N 3.02Å; P35-E47 VanDerWaalsContact CD-OE1 3.25Å; P35-E47 WeakPolarHBondContact CD-OE1 3.47Å
36	P	94.9	Very high	96.8	Very high	127 Å²	127	100.1 Å²	100.1	83%	0.825	52%	0.516	S	S	*	.	S	Bend	trans	-66.5	-18.8	177.9	27.8	-35.1	0	0	0	113.2	Y38	P36-Y38 WeakPolarHBondContact O-CD2 3.3Å
37	H	95.1	Very high	96.8	Very high	137 Å²	137	98.7 Å²	98.7	63%	0.634	51%	0.505	S	S	*	.	S	Bend	trans	-94.5	99.3	174.2	-176.7	-58.8	0	0	0	110.2	P35 K39	P35-H37 PolarHBondContact O-N 3.02Å; H37-K39 PolarHBondContact O-N 3.07Å
38	Y	94.5	Very high	96.8	Very high	135 Å²	135	95.9 Å²	95.9	53%	0.529	49%	0.493	S	S	.	.			trans	-77.1	110.6	175	-56.9	-84.6	0	0	0	110.3	H30 V34 P36	H30-Y38 PolarHBondContact CE1-OH 3.44Å; H30-Y38 VanDerWaalsContact CE1-OH 3.29Å; H30-Y38 PolarHBondContact NE2-OH 3.28Å; V34-Y38 HydrophobicContact CG1-CD1 4.26Å; V34-Y38 HydrophobicContact CG1-CE1 3.45Å; V34-Y38 VanDerWaalsContact CG1-CE1 3.45Å; P36-Y38 WeakPolarHBondContact O-CD2 3.3Å
39	K	92.9	Very high	96.8	Very high	195 Å²	195	97 Å²	97	85%	0.848	50%	0.497	S	S	*	.	S	Bend	trans	-80.2	-31.7	174.4	-68.6	-176.7	179.3	180	0	111.9	H37	H37-K39 PolarHBondContact O-N 3.07Å
40	E	94.8	Very high	96.8	Very high	120 Å²	120	99 Å²	99	56%	0.561	51%	0.51	S	S	*	.	S	Bend	trans	-148.3	165.6	179.4	60.7	-164.4	173.6	0	0	109.6	T44	E40-T44 VanDerWaalsContact OE1-CG2 3.3Å; E40-T44 WeakPolarHBondContact OE1-CG2 3.45Å
41	A	94.8	Very high	96.8	Very high	111 Å²	111	97.1 Å²	97.1	92%	0.917	50%	0.503	S	S	*	.	S	Bend	trans	-83.8	-23.6	-176.5	0	0	0	0	0	113.2
42	E	97.1	Very high	96.9	Very high	161 Å²	161	92.5 Å²	92.5	75%	0.752	49%	0.494	S	S	*	.	S	Bend	trans	-83.7	147.9	178.5	-66	-175	-175.9	0	0	110.7	T44	E42-T44 PolarHBondContact O-N 3.42Å
43	L	97.1	Very high	96.9	Very high	90 Å²	90	92.9 Å²	92.9	47%	0.471	49%	0.491	S	S	.	.	P	Polyproline II helix	trans	-69.5	124.3	171.6	-65.9	175.2	0	0	0	109.2	V34 E47 S48 L51	V34-L43 HydrophobicContact CG2-CD2 4.33Å; L43-E47 HydrophobicContact CB-CB 4.37Å; L43-E47 HydrophobicContact CD2-CB 4.06Å; L43-S48 WeakPolarHBondContact CB-OG 3.48Å; L43-L51 HydrophobicContact CD1-CD1 3.76Å; L43-L51 HydrophobicContact CD2-CD1 4.38Å
44	T	97.1	Very high	96.9	Very high	53 Å²	53	93 Å²	93	33%	0.325	49%	0.492	S	S	.	.	P	Polyproline II helix	trans	-61	155	168	63.5	0	0	0	0	109.7	E40 E42 G46 E47 S48	E40-T44 VanDerWaalsContact OE1-CG2 3.3Å; E40-T44 WeakPolarHBondContact OE1-CG2 3.45Å; E42-T44 PolarHBondContact O-N 3.42Å; T44-G46 PolarHBondContact O-N 2.97Å; T44-E47 WeakPolarHBondContact CB-OE2 3.27Å; T44-E47 WeakPolarHBondContact CG2-OE2 3.43Å; T44-E47 PolarHBondContact N-OE2 3.36Å; T44-E47 PolarHBondContact O-N 3.24Å; T44-E47 VanDerWaalsContact OG1-CD 3.28Å; T44-E47 VanDerWaalsContact OG1-CG 3.26Å; T44-E47 WeakPolarHBondContact OG1-CG 3.45Å; T44-E47 PolarHBondContact OG1-N 3.06Å; T44-E47 PolarHBondContact OG1-OE2 3.38Å; T44-S48 PolarHBondContact O-N 3.36Å; T44-S48 PolarHBondContact O-OG 3.27Å
45	K	97.5	Very high	96.9	Very high	182 Å²	182	94.8 Å²	94.8	79%	0.791	50%	0.503	S	S	*	.	H	α-helix	trans	-52	-34.6	173.1	-175.4	179.1	-179.9	179.7	0	112.4	V49	K45-V49 WeakPolarHBondContact O-CB 3.48Å; K45-V49 VanDerWaalsContact O-CG2 3.28Å; K45-V49 WeakPolarHBondContact O-CG2 3.28Å; K45-V49 PolarHBondContact O-N 2.83Å; K45-V49 VanDerWaalsContact O-N 3.12Å
46	G	97.2	Very high	97.1	Very high	53 Å²	53	94.7 Å²	94.7	55%	0.546	51%	0.508	S	S	.	.	H	α-helix	trans	-67	-44.9	177.6	0	0	0	0	0	112.8	T44 C50	T44-G46 PolarHBondContact O-N 2.97Å; G46-C50 VanDerWaalsContact O-CB 3.3Å; G46-C50 WeakPolarHBondContact O-CB 3.35Å; G46-C50 PolarHBondContact O-N 3.27Å
47	E	98.4	Very high	97.3	Very high	31 Å²	31	95.7 Å²	95.7	15%	0.145	50%	0.499	C	S	.	.	H	α-helix	trans	-64	-46	176.9	-71.3	161.4	145.3	0	0	111.2	C33 P35 L43 T44 V49 C50 L51	C33-E47 WeakPolarHBondContact O-CG 3.24Å; P35-E47 VanDerWaalsContact CD-OE1 3.25Å; P35-E47 WeakPolarHBondContact CD-OE1 3.47Å; L43-E47 HydrophobicContact CB-CB 4.37Å; L43-E47 HydrophobicContact CD2-CB 4.06Å; T44-E47 WeakPolarHBondContact CB-OE2 3.27Å; T44-E47 WeakPolarHBondContact CG2-OE2 3.43Å; T44-E47 PolarHBondContact N-OE2 3.36Å; T44-E47 PolarHBondContact O-N 3.24Å; T44-E47 VanDerWaalsContact OG1-CD 3.28Å; T44-E47 VanDerWaalsContact OG1-CG 3.26Å; T44-E47 WeakPolarHBondContact OG1-CG 3.45Å; T44-E47 PolarHBondContact OG1-N 3.06Å; T44-E47 PolarHBondContact OG1-OE2 3.38Å; E47-V49 PolarHBondContact O-N 3.19Å; E47-C50 WeakPolarHBondContact O-CB 3.3Å; E47-C50 PolarHBondContact O-N 3.21Å; E47-C50 VanDerWaalsContact O-N 3.16Å; E47-L51 WeakPolarHBondContact O-CG 3.25Å; E47-L51 PolarHBondContact O-N 3.03Å
48	S	98.1	Very high	97.4	Very high	43 Å²	43	91.8 Å²	91.8	30%	0.301	48%	0.479	S	S	.	.	H	α-helix	trans	-58.8	-49.8	177.5	-57.5	0	0	0	0	112.1	L43 T44 C50 L51 D52	L43-S48 WeakPolarHBondContact CB-OG 3.48Å; T44-S48 PolarHBondContact O-N 3.36Å; T44-S48 PolarHBondContact O-OG 3.27Å; S48-C50 VanDerWaalsContact C-N 3.29Å; S48-C50 PolarHBondContact O-N 3.38Å; S48-L51 PolarHBondContact O-N 3.18Å; S48-D52 PolarHBondContact O-N 2.82Å; S48-D52 VanDerWaalsContact O-N 3.07Å
49	V	98.7	Very high	97.6	Very high	52 Å²	52	89.2 Å²	89.2	32%	0.315	47%	0.474	S	S	.	.	H	α-helix	trans	-64.6	-33.9	177.2	171.4	0	0	0	0	111.8	K45 E47 R53	K45-V49 WeakPolarHBondContact O-CB 3.48Å; K45-V49 VanDerWaalsContact O-CG2 3.28Å; K45-V49 WeakPolarHBondContact O-CG2 3.28Å; K45-V49 PolarHBondContact O-N 2.83Å; K45-V49 VanDerWaalsContact O-N 3.12Å; E47-V49 PolarHBondContact O-N 3.19Å; V49-R53 WeakPolarHBondContact O-CD 3.42Å; V49-R53 VanDerWaalsContact O-CG 3.26Å; V49-R53 WeakPolarHBondContact O-CG 3.49Å; V49-R53 PolarHBondContact O-N 3.44Å
50	C	98.7	Very high	97.9	Very high	44 Å²	44	82.8 Å²	82.8	30%	0.297	45%	0.449	S	S	.	.	H	α-helix	trans	-65.2	-45.9	174.3	-176.4	0	0	0	0	111.2	C33 G46 E47 S48 R53 C54	C33-C50 WeakPolarHBondContact CA-SG 3.26Å; C33-C50 HydrophobicContact CB-CB 3.61Å; C33-C50 WeakPolarHBondContact CB-SG 3.49Å; C33-C50 WeakPolarHBondContact SG-CB 3.47Å; C33-C50 PolarHBondContact SG-O 3.46Å; C33-C50 CovalentContact SG-SG 2.05Å; C33-C50 PolarHBondContact SG-SG 3.49Å; G46-C50 VanDerWaalsContact O-CB 3.3Å; G46-C50 WeakPolarHBondContact O-CB 3.35Å; G46-C50 PolarHBondContact O-N 3.27Å; E47-C50 WeakPolarHBondContact O-CB 3.3Å; E47-C50 PolarHBondContact O-N 3.21Å; E47-C50 VanDerWaalsContact O-N 3.16Å; S48-C50 VanDerWaalsContact C-N 3.29Å; S48-C50 PolarHBondContact O-N 3.38Å; C50-R53 PolarHBondContact O-N 3.23Å; C50-C54 VanDerWaalsContact O-CB 3.3Å; C50-C54 WeakPolarHBondContact O-CB 3.03Å; C50-C54 PolarHBondContact O-N 3.12Å
51	L	98.7	Very high	98	Very high	43 Å²	43	82.5 Å²	82.5	23%	0.225	45%	0.451	C	S	.	.	H	α-helix	trans	-59.3	-47.4	179.4	-73.3	169.3	0	0	0	111.2	C29 C33 L43 E47 S48 R53 C54 V55	C29-L51 HydrophobicContact CB-CD2 4.08Å; C33-L51 HydrophobicContact CB-CD2 3.87Å; C33-L51 HydrophobicContact CB-CG 4.03Å; L43-L51 HydrophobicContact CD1-CD1 3.76Å; L43-L51 HydrophobicContact CD2-CD1 4.38Å; E47-L51 WeakPolarHBondContact O-CG 3.25Å; E47-L51 PolarHBondContact O-N 3.03Å; S48-L51 PolarHBondContact O-N 3.18Å; L51-R53 VanDerWaalsContact C-N 3.34Å; L51-R53 PolarHBondContact O-N 2.96Å; L51-C54 WeakPolarHBondContact O-CB 3.28Å; L51-C54 PolarHBondContact O-N 3.48Å; L51-C54 VanDerWaalsContact O-N 3.1Å; L51-V55 WeakPolarHBondContact O-CG2 3.06Å; L51-V55 PolarHBondContact O-N 2.95Å
52	D	98.7	Very high	98.1	Very high	116 Å²	116	81.7 Å²	81.7	62%	0.62	43%	0.428	S	S	*	.	H	α-helix	trans	-55.8	-48.5	176.1	-66.5	-27.8	0	0	0	111.6	S48 C54 A56	S48-D52 PolarHBondContact O-N 2.82Å; S48-D52 VanDerWaalsContact O-N 3.07Å; D52-C54 VanDerWaalsContact C-N 3.33Å; D52-C54 PolarHBondContact O-N 2.97Å; D52-A56 WeakPolarHBondContact O-CB 3.45Å; D52-A56 PolarHBondContact O-N 3.36Å; D52-A56 VanDerWaalsContact O-N 3.12Å
53	R	98.8	Very high	98.1	Very high	166 Å²	166	79.3 Å²	79.3	63%	0.626	42%	0.417	S	S	*	.	H	α-helix	trans	-65.3	-36.6	177.6	-71.5	171.5	177.2	180	0.3	112.2	V49 C50 L51 K57	V49-R53 WeakPolarHBondContact O-CD 3.42Å; V49-R53 VanDerWaalsContact O-CG 3.26Å; V49-R53 WeakPolarHBondContact O-CG 3.49Å; V49-R53 PolarHBondContact O-N 3.44Å; C50-R53 PolarHBondContact O-N 3.23Å; L51-R53 VanDerWaalsContact C-N 3.34Å; L51-R53 PolarHBondContact O-N 2.96Å; R53-K57 WeakPolarHBondContact O-CB 3.41Å; R53-K57 VanDerWaalsContact O-CG 3.24Å; R53-K57 WeakPolarHBondContact O-CG 3.3Å; R53-K57 PolarHBondContact O-N 3.12Å
54	C	98.8	Very high	98.1	Very high	15 Å²	15	81.7 Å²	81.7	10%	0.101	42%	0.419	C	S	.	.	H	α-helix	trans	-67.3	-48.8	-179	179.8	0	0	0	0	110.9	C29 C50 L51 D52 A56 K57 Y58	C29-C54 WeakPolarHBondContact CA-SG 3.02Å; C29-C54 HydrophobicContact CB-CB 3.81Å; C29-C54 WeakPolarHBondContact CB-SG 3.46Å; C29-C54 VanDerWaalsContact SG-C 3.5Å; C29-C54 WeakPolarHBondContact SG-CB 3.37Å; C29-C54 CovalentContact SG-SG 2.05Å; C29-C54 PolarHBondContact SG-SG 3.49Å; C50-C54 VanDerWaalsContact O-CB 3.3Å; C50-C54 WeakPolarHBondContact O-CB 3.03Å; C50-C54 PolarHBondContact O-N 3.12Å; L51-C54 WeakPolarHBondContact O-CB 3.28Å; L51-C54 PolarHBondContact O-N 3.48Å; L51-C54 VanDerWaalsContact O-N 3.1Å; D52-C54 VanDerWaalsContact C-N 3.33Å; D52-C54 PolarHBondContact O-N 2.97Å; C54-A56 PolarHBondContact O-N 3.02Å; C54-K57 PolarHBondContact O-N 3.48Å; C54-Y58 WeakPolarHBondContact O-CB 3.32Å; C54-Y58 PolarHBondContact O-N 3.32Å
55	V	98.6	Very high	98.1	Very high	52 Å²	52	84.6 Å²	84.6	32%	0.315	43%	0.432	S	S	.	.	H	α-helix	trans	-59.9	-47.9	178.1	171	0	0	0	0	110.4	M25 L51 K57 Y58 L59	M25-V55 HydrophobicContact CE-CG1 4.28Å; M25-V55 HydrophobicContact SD-CB 4.44Å; M25-V55 HydrophobicContact SD-CG1 3.91Å; M25-V55 HydrophobicContact SD-CG2 4.33Å; L51-V55 WeakPolarHBondContact O-CG2 3.06Å; L51-V55 PolarHBondContact O-N 2.95Å; V55-K57 VanDerWaalsContact C-N 3.34Å; V55-K57 PolarHBondContact O-N 3.07Å; V55-Y58 PolarHBondContact O-N 3.03Å; V55-L59 HydrophobicContact CG1-CD1 4.11Å; V55-L59 WeakPolarHBondContact O-CG 3.24Å; V55-L59 PolarHBondContact O-N 3.33Å
56	A	98.6	Very high	98	Very high	62 Å²	62	77.5 Å²	77.5	51%	0.512	41%	0.411	S	S	.	.	H	α-helix	trans	-57	-45.7	177.3	0	0	0	0	0	112.5	D52 C54 D60	D52-A56 WeakPolarHBondContact O-CB 3.45Å; D52-A56 PolarHBondContact O-N 3.36Å; D52-A56 VanDerWaalsContact O-N 3.12Å; C54-A56 PolarHBondContact O-N 3.02Å; A56-D60 PolarHBondContact O-N 2.85Å; A56-D60 VanDerWaalsContact O-N 3.13Å
57	K	98.8	Very high	97.9	Very high	149 Å²	149	80.6 Å²	80.6	65%	0.648	41%	0.406	S	S	*	.	H	α-helix	trans	-68	-37.1	177.3	-74.1	175.5	-179.4	-175.6	0	113	R53 C54 V55 L61	R53-K57 WeakPolarHBondContact O-CB 3.41Å; R53-K57 VanDerWaalsContact O-CG 3.24Å; R53-K57 WeakPolarHBondContact O-CG 3.3Å; R53-K57 PolarHBondContact O-N 3.12Å; C54-K57 PolarHBondContact O-N 3.48Å; V55-K57 VanDerWaalsContact C-N 3.34Å; V55-K57 PolarHBondContact O-N 3.07Å; K57-L61 VanDerWaalsContact O-CB 3.3Å; K57-L61 WeakPolarHBondContact O-CB 3.45Å; K57-L61 PolarHBondContact O-N 3.26Å
58	Y	98.6	Very high	97.9	Very high	55 Å²	55	84.1 Å²	84.1	22%	0.216	42%	0.421	C	S	.	.	H	α-helix	trans	-63.4	-45.8	179.6	-172.1	-80.6	0	0	0	110.4	M21 R24 M25 A28 C54 V55 L61 H62	M21-Y58 HydrophobicContact CG-CE1 4.17Å; R24-Y58 WeakPolarHBondContact CB-OH 3.09Å; M25-Y58 HydrophobicContact CB-CD1 3.73Å; M25-Y58 HydrophobicContact CB-CD2 4.31Å; M25-Y58 HydrophobicContact CB-CE1 3.62Å; M25-Y58 HydrophobicContact CB-CE2 4.2Å; M25-Y58 HydrophobicContact CB-CG 4.09Å; M25-Y58 HydrophobicContact CG-CD1 3.6Å; M25-Y58 HydrophobicContact CG-CD2 4.17Å; M25-Y58 HydrophobicContact CG-CE1 4.06Å; M25-Y58 HydrophobicContact CG-CG 3.68Å; M25-Y58 HydrophobicContact SD-CD1 3.88Å; M25-Y58 HydrophobicContact SD-CG 4.3Å; A28-Y58 HydrophobicContact CB-CD2 4.38Å; A28-Y58 HydrophobicContact CB-CE2 4.19Å; C54-Y58 WeakPolarHBondContact O-CB 3.32Å; C54-Y58 PolarHBondContact O-N 3.32Å; V55-Y58 PolarHBondContact O-N 3.03Å; Y58-L61 PolarHBondContact O-N 2.77Å; Y58-H62 VanDerWaalsContact O-CB 3.25Å; Y58-H62 WeakPolarHBondContact O-CB 3.43Å; Y58-H62 PolarHBondContact O-N 3.35Å
59	L	98	Very high	97.8	Very high	80 Å²	80	87.3 Å²	87.3	42%	0.419	43%	0.434	S	S	.	.	H	α-helix	trans	-66.1	-45.3	178.7	-66.1	174	0	0	0	112	M21 M25 V55 L61 H62 E63	M21-L59 HydrophobicContact CE-CD2 3.78Å; M21-L59 HydrophobicContact SD-CD2 4.05Å; M25-L59 HydrophobicContact SD-CD2 4.22Å; M25-L59 HydrophobicContact SD-CG 4.31Å; V55-L59 HydrophobicContact CG1-CD1 4.11Å; V55-L59 WeakPolarHBondContact O-CG 3.24Å; V55-L59 PolarHBondContact O-N 3.33Å; L59-L61 VanDerWaalsContact C-N 3.32Å; L59-L61 PolarHBondContact O-N 3.16Å; L59-H62 PolarHBondContact O-N 2.93Å; L59-E63 WeakPolarHBondContact O-CB 3.35Å; L59-E63 PolarHBondContact O-N 2.05Å
60	D	98.2	Very high	97.6	Very high	60 Å²	60	89.1 Å²	89.1	32%	0.321	45%	0.445	S	S	.	.	H	α-helix	trans	-59.3	-42.6	175.3	175.5	42.6	0	0	0	111.7	A56 R64	A56-D60 PolarHBondContact O-N 2.85Å; A56-D60 VanDerWaalsContact O-N 3.13Å; D60-R64 VanDerWaalsContact CG-NH2 3.3Å; D60-R64 VanDerWaalsContact O-CG 3.25Å; D60-R64 WeakPolarHBondContact O-CG 3.3Å; D60-R64 PolarHBondContact O-N 3.2Å; D60-R64 VanDerWaalsContact O-N 3.12Å; D60-R64 IonicContact OD1-CZ 3.28Å; D60-R64 VanDerWaalsContact OD1-CZ 3.28Å; D60-R64 IonicContact OD1-NE 2.79Å; D60-R64 PolarHBondContact OD1-NE 3.2Å; D60-R64 IonicContact OD1-NH2 2.96Å; D60-R64 PolarHBondContact OD1-NH2 3.2Å; D60-R64 IonicContact OD2-CZ 3.25Å; D60-R64 VanDerWaalsContact OD2-CZ 3.25Å; D60-R64 IonicContact OD2-NE 3.36Å; D60-R64 PolarHBondContact OD2-NE 2.73Å; D60-R64 IonicContact OD2-NH2 2.81Å; D60-R64 PolarHBondContact OD2-NH2 2.79Å
61	L	97.8	Very high	97.5	Very high	115 Å²	115	91.9 Å²	91.9	60%	0.602	45%	0.454	S	S	*	.	H	α-helix	trans	-66.4	-42.9	175.2	-178.4	64.5	0	0	0	112	K57 Y58 L59 E63 R64 L65	K57-L61 VanDerWaalsContact O-CB 3.3Å; K57-L61 WeakPolarHBondContact O-CB 3.45Å; K57-L61 PolarHBondContact O-N 3.26Å; Y58-L61 PolarHBondContact O-N 2.77Å; L59-L61 VanDerWaalsContact C-N 3.32Å; L59-L61 PolarHBondContact O-N 3.16Å; L61-E63 VanDerWaalsContact C-N 3.33Å; L61-E63 PolarHBondContact O-N 3.1Å; L61-R64 PolarHBondContact O-N 3.2Å; L61-L65 WeakPolarHBondContact O-CB 3.3Å; L61-L65 PolarHBondContact O-N 2.9Å
62	H	96.6	Very high	97.3	Very high	93 Å²	93	93.3 Å²	93.3	43%	0.431	46%	0.461	S	S	.	.	H	α-helix	trans	-60.3	-43.8	179.5	-176.9	61.1	0	0	0	111.3	Y58 L59 L65 G66	Y58-H62 VanDerWaalsContact O-CB 3.25Å; Y58-H62 WeakPolarHBondContact O-CB 3.43Å; Y58-H62 PolarHBondContact O-N 3.35Å; L59-H62 PolarHBondContact O-N 2.93Å; H62-L65 PolarHBondContact O-N 3.44Å; H62-G66 PolarHBondContact O-N 2.93Å
63	E	97	Very high	97.1	Very high	112 Å²	112	90.5 Å²	90.5	52%	0.523	45%	0.451	S	S	.	.	H	α-helix	trans	-63.9	-45.8	177	-166.1	-165.1	161.6	0	0	112.2	L59 L61 L65 G66 R67	L59-E63 WeakPolarHBondContact O-CB 3.35Å; L59-E63 PolarHBondContact O-N 2.05Å; L61-E63 VanDerWaalsContact C-N 3.33Å; L61-E63 PolarHBondContact O-N 3.1Å; E63-L65 VanDerWaalsContact C-N 3.33Å; E63-L65 PolarHBondContact O-N 2.89Å; E63-G66 PolarHBondContact O-N 2.86Å; E63-R67 PolarHBondContact O-N 3.37Å; E63-R67 IonicContact OE1-CZ 3.76Å; E63-R67 IonicContact OE1-NH1 2.64Å; E63-R67 PolarHBondContact OE1-NH1 3.48Å
64	R	97.8	Very high	96.8	Very high	140 Å²	140	85.9 Å²	85.9	53%	0.528	44%	0.441	S	S	.	.	H	α-helix	trans	-61.8	-41.9	176.4	-70.7	171.2	-165.9	-151.2	6	112	D60 L61 R67 K68	D60-R64 VanDerWaalsContact CG-NH2 3.3Å; D60-R64 VanDerWaalsContact O-CG 3.25Å; D60-R64 WeakPolarHBondContact O-CG 3.3Å; D60-R64 PolarHBondContact O-N 3.2Å; D60-R64 VanDerWaalsContact O-N 3.12Å; D60-R64 IonicContact OD1-CZ 3.28Å; D60-R64 VanDerWaalsContact OD1-CZ 3.28Å; D60-R64 IonicContact OD1-NE 2.79Å; D60-R64 PolarHBondContact OD1-NE 3.2Å; D60-R64 IonicContact OD1-NH2 2.96Å; D60-R64 PolarHBondContact OD1-NH2 3.2Å; D60-R64 IonicContact OD2-CZ 3.25Å; D60-R64 VanDerWaalsContact OD2-CZ 3.25Å; D60-R64 IonicContact OD2-NE 3.36Å; D60-R64 PolarHBondContact OD2-NE 2.73Å; D60-R64 IonicContact OD2-NH2 2.81Å; D60-R64 PolarHBondContact OD2-NH2 2.79Å; L61-R64 PolarHBondContact O-N 3.2Å; R64-R67 VanDerWaalsContact CG-NH2 3.35Å; R64-K68 PolarHBondContact O-N 3.44Å
65	L	96.3	Very high	96.4	Very high	113 Å²	113	90 Å²	90	59%	0.592	46%	0.458	S	S	*	.	H	α-helix	trans	-65.4	-42.4	177.3	-174.3	64.6	0	0	0	110.9	L61 H62 E63 K68 L69	L61-L65 WeakPolarHBondContact O-CB 3.3Å; L61-L65 PolarHBondContact O-N 2.9Å; H62-L65 PolarHBondContact O-N 3.44Å; E63-L65 VanDerWaalsContact C-N 3.33Å; E63-L65 PolarHBondContact O-N 2.89Å; L65-K68 PolarHBondContact O-N 3.27Å; L65-L69 WeakPolarHBondContact O-CB 3.34Å; L65-L69 PolarHBondContact O-N 3.32Å
66	G	95.5	Very high	96.1	Very high	33 Å²	33	91.7 Å²	91.7	34%	0.34	47%	0.466	S	S	.	.	H	α-helix	trans	-57	-51.2	174.8	0	0	0	0	0	112	H62 E63 K68 L69 T70	H62-G66 PolarHBondContact O-N 2.93Å; E63-G66 PolarHBondContact O-N 2.86Å; G66-K68 VanDerWaalsContact C-N 3.31Å; G66-K68 PolarHBondContact O-N 3.04Å; G66-L69 PolarHBondContact O-N 2.94Å; G66-T70 PolarHBondContact O-N 2.05Å; G66-T70 PolarHBondContact O-OG1 3.2Å
67	R	96.3	Very high	95.7	Very high	118 Å²	118	95.2 Å²	95.2	45%	0.445	47%	0.472	S	S	.	.	H	α-helix	trans	-54.5	-47.7	174.4	-77.8	-167.6	-71.9	-89.9	-0.7	112.1	E63 R64 L69 T70 E71	E63-R67 PolarHBondContact O-N 3.37Å; E63-R67 IonicContact OE1-CZ 3.76Å; E63-R67 IonicContact OE1-NH1 2.64Å; E63-R67 PolarHBondContact OE1-NH1 3.48Å; R64-R67 VanDerWaalsContact CG-NH2 3.35Å; R67-L69 VanDerWaalsContact C-N 3.31Å; R67-L69 PolarHBondContact O-N 3.43Å; R67-T70 PolarHBondContact O-N 2.97Å; R67-E71 WeakPolarHBondContact O-CG 3.45Å; R67-E71 PolarHBondContact O-N 3.03Å
68	K	96.7	Very high	95.3	Very high	105 Å²	105	93.5 Å²	93.5	46%	0.457	47%	0.466	S	S	.	.	H	α-helix	trans	-66	-37.1	-176.8	-170.2	55	178.8	175.2	0	112.3	R64 L65 G66 E71 L72	R64-K68 PolarHBondContact O-N 3.44Å; L65-K68 PolarHBondContact O-N 3.27Å; G66-K68 VanDerWaalsContact C-N 3.31Å; G66-K68 PolarHBondContact O-N 3.04Å; K68-E71 VanDerWaalsContact CD-OE2 3.23Å; K68-E71 WeakPolarHBondContact CD-OE2 3.48Å; K68-E71 IonicContact NZ-OE2 2.81Å; K68-E71 PolarHBondContact NZ-OE2 3.4Å; K68-E71 PolarHBondContact O-N 3.06Å; K68-L72 HydrophobicContact CG-CD1 4.4Å; K68-L72 VanDerWaalsContact O-CG 3.31Å; K68-L72 WeakPolarHBondContact O-CG 3.24Å; K68-L72 PolarHBondContact O-N 3.23Å; K68-L72 VanDerWaalsContact O-N 3.12Å
69	L	96.1	Very high	94.8	Very high	110 Å²	110	96.3 Å²	96.3	58%	0.576	48%	0.483	S	S	*	.	H	α-helix	trans	-64	-45.3	176.5	-174.3	62.9	0	0	0	111	L65 G66 R67 E71 L72 S73	L65-L69 WeakPolarHBondContact O-CB 3.34Å; L65-L69 PolarHBondContact O-N 3.32Å; G66-L69 PolarHBondContact O-N 2.94Å; R67-L69 VanDerWaalsContact C-N 3.31Å; R67-L69 PolarHBondContact O-N 3.43Å; L69-E71 PolarHBondContact O-N 2.89Å; L69-L72 PolarHBondContact O-N 3.26Å; L69-S73 PolarHBondContact O-N 2.88Å; L69-S73 PolarHBondContact O-OG 3.16Å; L69-S73 VanDerWaalsContact O-OG 3.08Å
70	T	95.2	Very high	94.3	Very high	90 Å²	90	100.2 Å²	100.2	55%	0.552	50%	0.501	S	S	*	.	H	α-helix	trans	-60.7	-43.9	176.1	-55	0	0	0	0	112.1	G66 R67 L72 S73 V74	G66-T70 PolarHBondContact O-N 2.05Å; G66-T70 PolarHBondContact O-OG1 3.2Å; R67-T70 PolarHBondContact O-N 2.97Å; T70-L72 VanDerWaalsContact C-N 3.3Å; T70-L72 PolarHBondContact O-N 3.04Å; T70-S73 PolarHBondContact O-N 3.49Å; T70-V74 WeakPolarHBondContact O-CG2 3.26Å; T70-V74 PolarHBondContact O-N 3.47Å
71	E	95.7	Very high	93.7	Very high	103 Å²	103	108.1 Å²	108.1	48%	0.481	53%	0.526	S	S	.	.	H	α-helix	trans	-55.8	-45	175	-73.6	171.2	-164.3	0	0	111.9	R67 K68 L69 Q75	R67-E71 WeakPolarHBondContact O-CG 3.45Å; R67-E71 PolarHBondContact O-N 3.03Å; K68-E71 VanDerWaalsContact CD-OE2 3.23Å; K68-E71 WeakPolarHBondContact CD-OE2 3.48Å; K68-E71 IonicContact NZ-OE2 2.81Å; K68-E71 PolarHBondContact NZ-OE2 3.4Å; K68-E71 PolarHBondContact O-N 3.06Å; L69-E71 PolarHBondContact O-N 2.89Å; E71-Q75 WeakPolarHBondContact O-CB 3.25Å; E71-Q75 PolarHBondContact O-N 3.41Å; E71-Q75 VanDerWaalsContact O-N 3.1Å
72	L	95.1	Very high	92.2	Very high	72 Å²	72	113.7 Å²	113.7	38%	0.377	55%	0.545	S	S	.	.	H	α-helix	trans	-67.8	-40.8	179.6	-68.6	170.6	0	0	0	111.8	K68 L69 T70 V74 Q75 D76	K68-L72 HydrophobicContact CG-CD1 4.4Å; K68-L72 VanDerWaalsContact O-CG 3.31Å; K68-L72 WeakPolarHBondContact O-CG 3.24Å; K68-L72 PolarHBondContact O-N 3.23Å; K68-L72 VanDerWaalsContact O-N 3.12Å; L69-L72 PolarHBondContact O-N 3.26Å; T70-L72 VanDerWaalsContact C-N 3.3Å; T70-L72 PolarHBondContact O-N 3.04Å; L72-V74 PolarHBondContact O-N 3.44Å; L72-Q75 PolarHBondContact O-N 3.1Å; L72-D76 PolarHBondContact O-N 3.02Å
73	S	94	Very high	92	Very high	57 Å²	57	114.8 Å²	114.8	40%	0.399	55%	0.551	S	S	.	*	H	α-helix	trans	-61.5	-42.2	177.2	-58.2	0	0	0	0	112.4	L69 T70 D76 E77	L69-S73 PolarHBondContact O-N 2.88Å; L69-S73 PolarHBondContact O-OG 3.16Å; L69-S73 VanDerWaalsContact O-OG 3.08Å; T70-S73 PolarHBondContact O-N 3.49Å; S73-D76 PolarHBondContact O-N 2.77Å; S73-E77 WeakPolarHBondContact O-CG 3.41Å; S73-E77 PolarHBondContact O-N 3.41Å
74	V	93.3	Very high	91.8	Very high	69 Å²	69	114.9 Å²	114.9	42%	0.418	55%	0.553	S	S	.	*	H	α-helix	trans	-64.1	-43.4	175.5	173.6	0	0	0	0	110.9	T70 L72 D76 E77 E78	T70-V74 WeakPolarHBondContact O-CG2 3.26Å; T70-V74 PolarHBondContact O-N 3.47Å; L72-V74 PolarHBondContact O-N 3.44Å; V74-D76 VanDerWaalsContact C-N 3.34Å; V74-D76 PolarHBondContact O-N 3.32Å; V74-E77 PolarHBondContact O-N 2.92Å; V74-E78 WeakPolarHBondContact O-CG 3.43Å; V74-E78 PolarHBondContact O-N 2.97Å
75	Q	91.3	Very high	91.4	Very high	101 Å²	101	113.5 Å²	113.5	47%	0.472	55%	0.554	S	S	.	*	H	α-helix	trans	-61.7	-41.2	177.8	-176.4	-179.3	-14.6	0	0	112.2	E71 L72 E78 M79	E71-Q75 WeakPolarHBondContact O-CB 3.25Å; E71-Q75 PolarHBondContact O-N 3.41Å; E71-Q75 VanDerWaalsContact O-N 3.1Å; L72-Q75 PolarHBondContact O-N 3.1Å; Q75-E78 PolarHBondContact O-N 3.48Å; Q75-M79 WeakPolarHBondContact O-CB 3.42Å; Q75-M79 PolarHBondContact O-N 3.34Å
76	D	91.5	Very high	91.1	Very high	89 Å²	89	113.5 Å²	113.5	48%	0.476	55%	0.552	S	S	.	*	H	α-helix	trans	-65.8	-41.7	177.8	-73.6	-12.8	0	0	0	111.3	L72 S73 V74 E78 M79 M80	L72-D76 PolarHBondContact O-N 3.02Å; S73-D76 PolarHBondContact O-N 2.77Å; V74-D76 VanDerWaalsContact C-N 3.34Å; V74-D76 PolarHBondContact O-N 3.32Å; D76-E78 VanDerWaalsContact C-N 3.35Å; D76-E78 PolarHBondContact O-N 2.79Å; D76-M79 PolarHBondContact O-N 2.9Å; D76-M80 WeakPolarHBondContact O-CB 3.3Å; D76-M80 VanDerWaalsContact O-CG 3.22Å; D76-M80 WeakPolarHBondContact O-CG 3.4Å; D76-M80 PolarHBondContact O-N 3.29Å
77	E	90.3	Very high	90.9	Very high	135 Å²	135	118.6 Å²	118.6	63%	0.631	57%	0.565	S	S	*	*	H	α-helix	trans	-61.9	-40.4	174.4	-73.5	-178.4	172	0	0	112.5	S73 V74 M80 R81	S73-E77 WeakPolarHBondContact O-CG 3.41Å; S73-E77 PolarHBondContact O-N 3.41Å; V74-E77 PolarHBondContact O-N 2.92Å; E77-M80 PolarHBondContact O-N 3.33Å; E77-R81 WeakPolarHBondContact O-CG 3.49Å; E77-R81 PolarHBondContact O-N 3.07Å
78	E	90.6	Very high	90.5	Very high	113 Å²	113	118.6 Å²	118.6	53%	0.528	57%	0.573	S	S	.	*	H	α-helix	trans	-66.8	-35.9	175.1	-73.8	-175.3	171.6	0	0	112.7	V74 Q75 D76	V74-E78 WeakPolarHBondContact O-CG 3.43Å; V74-E78 PolarHBondContact O-N 2.97Å; Q75-E78 PolarHBondContact O-N 3.48Å; D76-E78 VanDerWaalsContact C-N 3.35Å; D76-E78 PolarHBondContact O-N 2.79Å
79	M	88.3	Confident	90.1	Very high	115 Å²	115	119.6 Å²	119.6	57%	0.567	58%	0.581	S	S	*	*	H	α-helix	trans	-68.6	-42.4	176.3	-170	-175.6	-56	0	0	111.2	Q75 D76 R81 K82	Q75-M79 WeakPolarHBondContact O-CB 3.42Å; Q75-M79 PolarHBondContact O-N 3.34Å; D76-M79 PolarHBondContact O-N 2.9Å; M79-R81 PolarHBondContact O-N 3.35Å; M79-K82 PolarHBondContact O-N 3.17Å
80	M	86.6	Confident	89.6	Confident	162 Å²	162	120.3 Å²	120.3	80%	0.798	58%	0.582	S	S	*	*	H	α-helix	trans	-68.9	-20.3	179	-69.9	-68.9	-70.9	0	0	113.5	D76 E77	D76-M80 WeakPolarHBondContact O-CB 3.3Å; D76-M80 VanDerWaalsContact O-CG 3.22Å; D76-M80 WeakPolarHBondContact O-CG 3.4Å; D76-M80 PolarHBondContact O-N 3.29Å; E77-M80 PolarHBondContact O-N 3.33Å
81	R	86.4	Confident	89.1	Confident	226 Å²	226	122.8 Å²	122.8	85%	0.853	58%	0.584	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.8	-10.7	176.4	-84.1	176.4	149	-169.6	-4.4	114.1	E77 M79	E77-R81 WeakPolarHBondContact O-CG 3.49Å; E77-R81 PolarHBondContact O-N 3.07Å; M79-R81 PolarHBondContact O-N 3.35Å
82	K	66.5	Low	88.5	Confident	232 Å²	232	124.6 Å²	124.6	100%	1.009	59%	0.593	S	S	*	*			trans	-98.7	0	178	-69.2	176.2	-176.5	171.5	0	110.8	M79	M79-K82 PolarHBondContact O-N 3.17Å

Retrieved 82 of 82 residues in 123.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).