A0A087YC91_POEFO Loading...

Transmembrane protein 242

Scaffold protein that participates in the c-ring assembly of mitochondrial ATP synthase (F(1)F(0) ATP synthase or complex V) by facilitating the membrane insertion and oligomer formation of the subunit c/ATP5MC3. Participates in the incorporation of the c-ring into vestigial complexes. Additionally influences the incorporation of subunits MT-ATP6, MT-ATP8, ATP5MJ, and ATP5MK in the ATP synthase.

AlphaFold DB , UniProt , Accession A0A087YC91, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 121 aa.

						>A0A087YC91_POEFO|A0A087YC91
FLFAGAVFLTTVASAGMIAGFGSTLALAKKKSPEWFSKGVAATAVAPESGASLALRALGWGSLYAWCGVGLLSVAVWKALGIHSLAEFRQKMESFFPAIPRNPEAAAGSEPLDWDAILGSK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	F	58.3	Low	84.4	Confident	238 Å²	238	113 Å²	113	100%	1.044	62%	0.617	S	S	*	*				0	-54.2	0	-107.9	-90.1	0	0	0	113	F3 A4 G5	F1-F3 PolarHBondContact O-N 3.47Å; F1-A4 PolarHBondContact O-N 2.67Å; F1-G5 PolarHBondContact O-N 3.42Å
2	L	67	Low	85.2	Confident	160 Å²	160	110.3 Å²	110.3	84%	0.838	61%	0.606	S	S	*	*	H	α-helix	trans	-59.2	-45.6	-177.4	-109.8	153.6	0	0	0	114.8	G5 A6	L2-G5 PolarHBondContact O-N 3.44Å; L2-A6 WeakPolarHBondContact O-CB 3.39Å; L2-A6 PolarHBondContact O-N 3.08Å
3	F	76.1	Confident	85.9	Confident	181 Å²	181	105.8 Å²	105.8	79%	0.794	59%	0.592	S	S	*	*	H	α-helix	trans	-64.2	-45.8	178.4	-108.2	-86.4	0	0	0	113	F1 G5 A6 V7	F1-F3 PolarHBondContact O-N 3.47Å; F3-G5 PolarHBondContact O-N 2.97Å; F3-A6 PolarHBondContact O-N 2.95Å; F3-V7 WeakPolarHBondContact O-CG2 3.36Å; F3-V7 PolarHBondContact O-N 3.25Å
4	A	79.6	Confident	86.5	Confident	71 Å²	71	102.9 Å²	102.9	59%	0.587	58%	0.582	S	S	*	*	H	α-helix	trans	-63.5	-41	177.2	0	0	0	0	0	111.9	F1 V7 F8	F1-A4 PolarHBondContact O-N 2.67Å; A4-V7 PolarHBondContact O-N 2.82Å; A4-F8 PolarHBondContact O-N 2.8Å; A4-F8 VanDerWaalsContact O-N 3.09Å
5	G	87.6	Confident	87.2	Confident	32 Å²	32	99.6 Å²	99.6	33%	0.33	57%	0.573	S	S	.	*	H	α-helix	trans	-64.5	-40.5	175.1	0	0	0	0	0	113.1	F1 L2 F3 F8 L9	F1-G5 PolarHBondContact O-N 3.42Å; L2-G5 PolarHBondContact O-N 3.44Å; F3-G5 PolarHBondContact O-N 2.97Å; G5-F8 PolarHBondContact O-N 3.29Å; G5-L9 WeakPolarHBondContact O-CB 3.37Å; G5-L9 WeakPolarHBondContact O-CG 3.34Å; G5-L9 PolarHBondContact O-N 2.85Å
6	A	90.8	Very high	87.7	Confident	48 Å²	48	96.3 Å²	96.3	40%	0.397	57%	0.567	S	S	.	*	H	α-helix	trans	-64.6	-42.7	177.3	0	0	0	0	0	112.3	L2 F3 F8 L9 T10	L2-A6 WeakPolarHBondContact O-CB 3.39Å; L2-A6 PolarHBondContact O-N 3.08Å; F3-A6 PolarHBondContact O-N 2.95Å; A6-F8 VanDerWaalsContact C-N 3.35Å; A6-F8 PolarHBondContact O-N 3.46Å; A6-L9 PolarHBondContact O-N 3.18Å; A6-T10 WeakPolarHBondContact O-CB 3.46Å; A6-T10 VanDerWaalsContact O-CG2 3.28Å; A6-T10 WeakPolarHBondContact O-CG2 3.38Å; A6-T10 PolarHBondContact O-N 3.06Å; A6-T10 PolarHBondContact O-OG1 2.92Å
7	V	93.9	Very high	88.1	Confident	88 Å²	88	98.9 Å²	98.9	53%	0.533	58%	0.575	S	S	.	*	H	α-helix	trans	-63.2	-42.3	176.2	173.5	0	0	0	0	111	F3 A4 T10 T11	F3-V7 WeakPolarHBondContact O-CG2 3.36Å; F3-V7 PolarHBondContact O-N 3.25Å; A4-V7 PolarHBondContact O-N 2.82Å; V7-T10 WeakPolarHBondContact CA-OG1 2.91Å; V7-T10 PolarHBondContact O-OG1 3.13Å; V7-T11 WeakPolarHBondContact O-CB 3.48Å; V7-T11 PolarHBondContact O-N 3.48Å; V7-T11 VanDerWaalsContact O-N 3.1Å; V7-T11 PolarHBondContact O-OG1 3.08Å
8	F	93.4	Very high	88.4	Confident	139 Å²	139	100.7 Å²	100.7	61%	0.61	58%	0.58	S	S	*	*	H	α-helix	trans	-63.1	-50.3	177.3	178.2	-101.8	0	0	0	112.1	A4 G5 A6 T10 T11 V12	A4-F8 PolarHBondContact O-N 2.8Å; A4-F8 VanDerWaalsContact O-N 3.09Å; G5-F8 PolarHBondContact O-N 3.29Å; A6-F8 VanDerWaalsContact C-N 3.35Å; A6-F8 PolarHBondContact O-N 3.46Å; F8-T10 PolarHBondContact O-N 3.49Å; F8-T11 PolarHBondContact O-N 3.42Å; F8-V12 HydrophobicContact CE1-CG2 4.35Å; F8-V12 HydrophobicContact CE2-CG2 4.3Å; F8-V12 HydrophobicContact CZ-CG2 4Å; F8-V12 PolarHBondContact O-N 3.1Å
9	L	93.7	Very high	88.8	Confident	114 Å²	114	98.4 Å²	98.4	60%	0.597	57%	0.574	S	S	*	*	H	α-helix	trans	-64.6	-40.4	-177.4	-73.3	170.2	0	0	0	112.6	G5 A6 V12 A13	G5-L9 WeakPolarHBondContact O-CB 3.37Å; G5-L9 WeakPolarHBondContact O-CG 3.34Å; G5-L9 PolarHBondContact O-N 2.85Å; A6-L9 PolarHBondContact O-N 3.18Å; L9-V12 PolarHBondContact O-N 2.83Å; L9-A13 WeakPolarHBondContact O-CB 3.33Å; L9-A13 PolarHBondContact O-N 3.38Å
10	T	93.3	Very high	89	Confident	83 Å²	83	95.4 Å²	95.4	51%	0.509	57%	0.566	S	S	.	*	H	α-helix	trans	-63.2	-44	175.5	48.4	0	0	0	0	111	A6 V7 F8 A13 S14	A6-T10 WeakPolarHBondContact O-CB 3.46Å; A6-T10 VanDerWaalsContact O-CG2 3.28Å; A6-T10 WeakPolarHBondContact O-CG2 3.38Å; A6-T10 PolarHBondContact O-N 3.06Å; A6-T10 PolarHBondContact O-OG1 2.92Å; V7-T10 WeakPolarHBondContact CA-OG1 2.91Å; V7-T10 PolarHBondContact O-OG1 3.13Å; F8-T10 PolarHBondContact O-N 3.49Å; T10-A13 PolarHBondContact O-N 3.32Å; T10-S14 WeakPolarHBondContact O-CB 3.37Å; T10-S14 PolarHBondContact O-N 2.96Å; T10-S14 PolarHBondContact O-OG 3.31Å; T10-S14 VanDerWaalsContact O-OG 3.05Å
11	T	94.8	Very high	89.1	Confident	89 Å²	89	96.7 Å²	96.7	55%	0.546	56%	0.564	S	S	.	*	H	α-helix	trans	-62.7	-47.8	177.7	-53.1	0	0	0	0	111.7	V7 F8 A13 S14 A15	V7-T11 WeakPolarHBondContact O-CB 3.48Å; V7-T11 PolarHBondContact O-N 3.48Å; V7-T11 VanDerWaalsContact O-N 3.1Å; V7-T11 PolarHBondContact O-OG1 3.08Å; F8-T11 PolarHBondContact O-N 3.42Å; T11-A13 PolarHBondContact O-N 3.44Å; T11-S14 PolarHBondContact O-N 3.04Å; T11-A15 VanDerWaalsContact O-CB 3.23Å; T11-A15 WeakPolarHBondContact O-CB 3.45Å; T11-A15 PolarHBondContact O-N 3.45Å
12	V	94.1	Very high	90.7	Very high	80 Å²	80	87 Å²	87	49%	0.485	53%	0.532	S	S	.	.	H	α-helix	trans	-63.3	-41.6	177.6	137.9	0	0	0	0	111.7	F8 L9 A15 G16	F8-V12 HydrophobicContact CE1-CG2 4.35Å; F8-V12 HydrophobicContact CE2-CG2 4.3Å; F8-V12 HydrophobicContact CZ-CG2 4Å; F8-V12 PolarHBondContact O-N 3.1Å; L9-V12 PolarHBondContact O-N 2.83Å; V12-A15 PolarHBondContact O-N 3.35Å; V12-G16 PolarHBondContact O-N 2.88Å
13	A	94.1	Very high	91.8	Very high	52 Å²	52	83 Å²	83	43%	0.43	52%	0.517	S	S	.	.	H	α-helix	trans	-65.3	-45.1	178.4	0	0	0	0	0	111.6	L9 T10 T11 G16 M17	L9-A13 WeakPolarHBondContact O-CB 3.33Å; L9-A13 PolarHBondContact O-N 3.38Å; T10-A13 PolarHBondContact O-N 3.32Å; T11-A13 PolarHBondContact O-N 3.44Å; A13-G16 PolarHBondContact O-N 3.09Å; A13-M17 PolarHBondContact O-N 3.46Å
14	S	94.3	Very high	92.5	Very high	65 Å²	65	79.1 Å²	79.1	46%	0.455	51%	0.508	S	S	.	.	H	α-helix	trans	-63.2	-45	175.4	-64.2	0	0	0	0	111.7	T10 T11 G16 M17 I18	T10-S14 WeakPolarHBondContact O-CB 3.37Å; T10-S14 PolarHBondContact O-N 2.96Å; T10-S14 PolarHBondContact O-OG 3.31Å; T10-S14 VanDerWaalsContact O-OG 3.05Å; T11-S14 PolarHBondContact O-N 3.04Å; S14-G16 VanDerWaalsContact C-N 3.35Å; S14-G16 PolarHBondContact O-N 3.02Å; S14-M17 PolarHBondContact O-N 3.26Å; S14-I18 VanDerWaalsContact O-CG1 3.32Å; S14-I18 WeakPolarHBondContact O-CG1 3.44Å; S14-I18 PolarHBondContact O-N 3.38Å
15	A	96.3	Very high	92.8	Very high	54 Å²	54	79.1 Å²	79.1	45%	0.446	50%	0.498	S	S	.	.	H	α-helix	trans	-61	-43.5	176.8	0	0	0	0	0	111.6	T11 V12 I18 A19	T11-A15 VanDerWaalsContact O-CB 3.23Å; T11-A15 WeakPolarHBondContact O-CB 3.45Å; T11-A15 PolarHBondContact O-N 3.45Å; V12-A15 PolarHBondContact O-N 3.35Å; A15-I18 PolarHBondContact O-N 2.73Å; A15-A19 VanDerWaalsContact O-CB 3.24Å; A15-A19 WeakPolarHBondContact O-CB 3.35Å; A15-A19 PolarHBondContact O-N 3.1Å
16	G	95.5	Very high	92.8	Very high	46 Å²	46	80.5 Å²	80.5	47%	0.474	51%	0.506	S	S	.	.	H	α-helix	trans	-63.2	-40.7	176.5	0	0	0	0	0	113	V12 A13 S14 G20	V12-G16 PolarHBondContact O-N 2.88Å; A13-G16 PolarHBondContact O-N 3.09Å; S14-G16 VanDerWaalsContact C-N 3.35Å; S14-G16 PolarHBondContact O-N 3.02Å; G16-G20 PolarHBondContact O-N 2.81Å
17	M	94.6	Very high	92.6	Very high	141 Å²	141	84.1 Å²	84.1	70%	0.695	52%	0.518	S	S	*	.	H	α-helix	trans	-62.7	-48	174.1	-107.6	-173.5	-100.2	0	0	112	A13 S14 F21	A13-M17 PolarHBondContact O-N 3.46Å; S14-M17 PolarHBondContact O-N 3.26Å; M17-F21 VanDerWaalsContact O-CB 3.28Å; M17-F21 WeakPolarHBondContact O-CB 3.41Å; M17-F21 PolarHBondContact O-N 2.78Å
18	I	94.4	Very high	92.2	Very high	131 Å²	131	82 Å²	82	67%	0.672	51%	0.51	S	S	*	.	H	α-helix	trans	-62.8	-47.5	179.5	-67	166.7	0	0	0	110.2	S14 A15 G22	S14-I18 VanDerWaalsContact O-CG1 3.32Å; S14-I18 WeakPolarHBondContact O-CG1 3.44Å; S14-I18 PolarHBondContact O-N 3.38Å; A15-I18 PolarHBondContact O-N 2.73Å; I18-G22 WeakPolarHBondContact O-CA 3.28Å; I18-G22 PolarHBondContact O-N 3.48Å
19	A	95.1	Very high	91.7	Very high	57 Å²	57	81.2 Å²	81.2	47%	0.471	51%	0.506	S	S	.	.	H	α-helix	trans	-64.9	-45.2	-179.9	0	0	0	0	0	112.1	A15 S23	A15-A19 VanDerWaalsContact O-CB 3.24Å; A15-A19 WeakPolarHBondContact O-CB 3.35Å; A15-A19 PolarHBondContact O-N 3.1Å; A19-S23 WeakPolarHBondContact O-CB 3.48Å; A19-S23 PolarHBondContact O-N 2.9Å; A19-S23 PolarHBondContact O-OG 3.35Å
20	G	93.6	Very high	91.3	Very high	39 Å²	39	84.5 Å²	84.5	40%	0.402	52%	0.516	S	S	.	.	H	α-helix	trans	-64.9	-55.5	179.8	0	0	0	0	0	112.4	G16 G22 S23 T24	G16-G20 PolarHBondContact O-N 2.81Å; G20-G22 PolarHBondContact O-N 3.5Å; G20-S23 PolarHBondContact O-N 3.49Å; G20-T24 PolarHBondContact O-N 3.26Å; G20-T24 VanDerWaalsContact O-N 3.08Å; G20-T24 PolarHBondContact O-OG1 2.95Å
21	F	90.8	Very high	90.7	Very high	123 Å²	123	89.5 Å²	89.5	54%	0.539	53%	0.53	S	S	.	.	H	α-helix	trans	-65.3	-41.1	-179.2	-173.2	-109.9	0	0	0	112.1	M17 S23 T24 L25	M17-F21 VanDerWaalsContact O-CB 3.28Å; M17-F21 WeakPolarHBondContact O-CB 3.41Å; M17-F21 PolarHBondContact O-N 2.78Å; F21-S23 PolarHBondContact O-N 2.99Å; F21-T24 PolarHBondContact O-N 3.46Å; F21-L25 HydrophobicContact CD1-CD1 3.59Å; F21-L25 HydrophobicContact CD1-CG 4.46Å; F21-L25 HydrophobicContact CE1-CD1 3.31Å; F21-L25 HydrophobicContact CE1-CG 4.17Å; F21-L25 HydrophobicContact CG-CD1 4.42Å; F21-L25 HydrophobicContact CZ-CD1 3.93Å; F21-L25 HydrophobicContact CZ-CG 4.35Å; F21-L25 PolarHBondContact O-N 2.77Å
22	G	92.5	Very high	89.7	Confident	35 Å²	35	87.4 Å²	87.4	36%	0.361	52%	0.519	S	S	.	.	H	α-helix	trans	-62.3	-39.8	175.7	0	0	0	0	0	112.8	I18 G20 L25 A26	I18-G22 WeakPolarHBondContact O-CA 3.28Å; I18-G22 PolarHBondContact O-N 3.48Å; G20-G22 PolarHBondContact O-N 3.5Å; G22-L25 PolarHBondContact O-N 3.36Å; G22-A26 WeakPolarHBondContact O-CB 3.42Å; G22-A26 PolarHBondContact O-N 3.45Å
23	S	90.3	Very high	88.8	Confident	76 Å²	76	87.1 Å²	87.1	53%	0.531	52%	0.519	S	S	.	.	H	α-helix	trans	-66.4	-41.9	176.8	-62.7	0	0	0	0	111.8	A19 G20 F21 A26 L27	A19-S23 WeakPolarHBondContact O-CB 3.48Å; A19-S23 PolarHBondContact O-N 2.9Å; A19-S23 PolarHBondContact O-OG 3.35Å; G20-S23 PolarHBondContact O-N 3.49Å; F21-S23 PolarHBondContact O-N 2.99Å; S23-A26 PolarHBondContact O-N 3.34Å; S23-L27 WeakPolarHBondContact O-CB 3.38Å; S23-L27 PolarHBondContact O-N 2.92Å
24	T	89.4	Confident	87.8	Confident	99 Å²	99	90.7 Å²	90.7	61%	0.607	53%	0.527	S	S	*	.	H	α-helix	trans	-62.5	-42.4	174.7	-57.9	0	0	0	0	111.5	G20 F21 L27 A28	G20-T24 PolarHBondContact O-N 3.26Å; G20-T24 VanDerWaalsContact O-N 3.08Å; G20-T24 PolarHBondContact O-OG1 2.95Å; F21-T24 PolarHBondContact O-N 3.46Å; T24-L27 PolarHBondContact O-N 2.91Å; T24-A28 WeakPolarHBondContact O-CB 3.37Å; T24-A28 PolarHBondContact O-N 2.87Å
25	L	86.4	Confident	86.5	Confident	71 Å²	71	96.7 Å²	96.7	37%	0.372	54%	0.54	S	S	.	.	H	α-helix	trans	-62.5	-44.4	174.5	-84	166	0	0	0	112.4	F21 G22 L27 A28 K29 F36	F21-L25 HydrophobicContact CD1-CD1 3.59Å; F21-L25 HydrophobicContact CD1-CG 4.46Å; F21-L25 HydrophobicContact CE1-CD1 3.31Å; F21-L25 HydrophobicContact CE1-CG 4.17Å; F21-L25 HydrophobicContact CG-CD1 4.42Å; F21-L25 HydrophobicContact CZ-CD1 3.93Å; F21-L25 HydrophobicContact CZ-CG 4.35Å; F21-L25 PolarHBondContact O-N 2.77Å; G22-L25 PolarHBondContact O-N 3.36Å; L25-L27 VanDerWaalsContact C-N 3.34Å; L25-L27 PolarHBondContact O-N 2.78Å; L25-A28 PolarHBondContact O-N 3.23Å; L25-K29 WeakPolarHBondContact O-CB 3.41Å; L25-K29 PolarHBondContact O-N 3.07Å; L25-F36 HydrophobicContact CD2-CE2 3.8Å; L25-F36 HydrophobicContact CD2-CZ 4.17Å
26	A	87.4	Confident	85.5	Confident	60 Å²	60	96.9 Å²	96.9	50%	0.496	53%	0.531	S	S	.	.	H	α-helix	trans	-63.9	-40	178.6	0	0	0	0	0	111.8	G22 S23 K29 K30	G22-A26 WeakPolarHBondContact O-CB 3.42Å; G22-A26 PolarHBondContact O-N 3.45Å; S23-A26 PolarHBondContact O-N 3.34Å; A26-K29 PolarHBondContact O-N 3.21Å; A26-K30 WeakPolarHBondContact O-CB 3.34Å; A26-K30 PolarHBondContact O-N 3.3Å
27	L	86.9	Confident	84.4	Confident	124 Å²	124	98 Å²	98	65%	0.649	53%	0.531	S	S	*	.	H	α-helix	trans	-67.5	-42.1	176.6	-167.9	67.6	0	0	0	111.6	S23 T24 L25 K30 K31	S23-L27 WeakPolarHBondContact O-CB 3.38Å; S23-L27 PolarHBondContact O-N 2.92Å; T24-L27 PolarHBondContact O-N 2.91Å; L25-L27 VanDerWaalsContact C-N 3.34Å; L25-L27 PolarHBondContact O-N 2.78Å; L27-K30 PolarHBondContact O-N 2.98Å; L27-K31 WeakPolarHBondContact O-CB 3.43Å; L27-K31 PolarHBondContact O-N 3.45Å
28	A	84.5	Confident	83.3	Confident	43 Å²	43	96.4 Å²	96.4	36%	0.355	52%	0.52	S	S	.	.	H	α-helix	trans	-60.7	-45.6	174	0	0	0	0	0	111.3	T24 L25 K30 K31 S32	T24-A28 WeakPolarHBondContact O-CB 3.37Å; T24-A28 PolarHBondContact O-N 2.87Å; L25-A28 PolarHBondContact O-N 3.23Å; A28-K30 PolarHBondContact O-N 3.48Å; A28-K31 PolarHBondContact O-N 2.97Å; A28-S32 PolarHBondContact O-N 3.27Å; A28-S32 PolarHBondContact O-OG 3.05Å
29	K	82.9	Confident	82.2	Confident	124 Å²	124	91.6 Å²	91.6	54%	0.539	50%	0.503	S	S	.	.	H	α-helix	trans	-61.3	-41.2	176.1	-169.1	-167.7	-179.2	-166.9	0	112.2	L25 A26 P33 F36	L25-K29 WeakPolarHBondContact O-CB 3.41Å; L25-K29 PolarHBondContact O-N 3.07Å; A26-K29 PolarHBondContact O-N 3.21Å; K29-P33 WeakPolarHBondContact O-CA 3.41Å; K29-P33 WeakPolarHBondContact O-CD 3.35Å; K29-F36 HydrophobicContact CB-CD1 4.39Å; K29-F36 HydrophobicContact CB-CG 4.39Å; K29-F36 HydrophobicContact CG-CD1 4.04Å; K29-F36 HydrophobicContact CG-CE1 4.32Å; K29-F36 HydrophobicContact CG-CG 4.41Å
30	K	85.3	Confident	80.9	Confident	182 Å²	182	92.6 Å²	92.6	79%	0.791	50%	0.503	S	S	*	.	H	α-helix	trans	-68.6	-33.5	179.3	-168	177	179.3	-176.6	0	112.3	A26 L27 A28	A26-K30 WeakPolarHBondContact O-CB 3.34Å; A26-K30 PolarHBondContact O-N 3.3Å; L27-K30 PolarHBondContact O-N 2.98Å; A28-K30 PolarHBondContact O-N 3.48Å
31	K	82.1	Confident	79.8	Confident	188 Å²	188	93.1 Å²	93.1	82%	0.817	50%	0.504	S	S	*	.	H	α-helix	trans	-81.7	-33.2	-179.2	-162.2	172.1	-175.6	169.8	0	113	L27 A28	L27-K31 WeakPolarHBondContact O-CB 3.43Å; L27-K31 PolarHBondContact O-N 3.45Å; A28-K31 PolarHBondContact O-N 2.97Å
32	S	73.4	Confident	78.1	Confident	45 Å²	45	90.6 Å²	90.6	32%	0.315	51%	0.505	S	S	.	.			trans	-147.3	71.4	-176.4	49.6	0	0	0	0	113.1	A28 E34 W35 F36	A28-S32 PolarHBondContact O-N 3.27Å; A28-S32 PolarHBondContact O-OG 3.05Å; S32-E34 PolarHBondContact O-N 2.9Å; S32-W35 PolarHBondContact O-N 2.93Å; S32-F36 VanDerWaalsContact O-CB 3.23Å; S32-F36 WeakPolarHBondContact O-CB 3.39Å; S32-F36 PolarHBondContact O-N 3.48Å
33	P	73.9	Confident	76.3	Confident	74 Å²	74	91.9 Å²	91.9	48%	0.481	51%	0.506	S	S	.	.	H	α-helix	trans	-65.5	-36.9	-176	24.5	-33.2	0	0	0	113.8	K29 S37	K29-P33 WeakPolarHBondContact O-CA 3.41Å; K29-P33 WeakPolarHBondContact O-CD 3.35Å; P33-S37 WeakPolarHBondContact O-CB 3.2Å; P33-S37 PolarHBondContact O-N 2.86Å; P33-S37 PolarHBondContact O-OG 2.82Å
34	E	73.1	Confident	74.4	Confident	127 Å²	127	93.8 Å²	93.8	59%	0.593	53%	0.527	S	S	*	.	H	α-helix	trans	-62	-50.7	176.1	-92.2	-88.4	140.5	0	0	111.9	S32 S37 K38	S32-E34 PolarHBondContact O-N 2.9Å; E34-S37 PolarHBondContact O-N 3.44Å; E34-K38 WeakPolarHBondContact O-CG 3.41Å; E34-K38 PolarHBondContact O-N 3.3Å; E34-K38 VanDerWaalsContact O-N 3.15Å; E34-K38 IonicContact OE2-NZ 3.35Å; E34-K38 PolarHBondContact OE2-NZ 3.44Å
35	W	67.9	Low	72.7	Confident	191 Å²	191	96 Å²	96	72%	0.723	54%	0.539	S	S	*	.	H	α-helix	trans	-72.6	-33	-178.9	-65.8	104.3	0	0	0	112.7	S32 K38 G39	S32-W35 PolarHBondContact O-N 2.93Å; W35-K38 HydrophobicContact CE3-CD 4.48Å; W35-K38 PolarHBondContact O-N 2.92Å; W35-G39 PolarHBondContact O-N 3.31Å
36	F	75.1	Confident	71	Confident	59 Å²	59	94.7 Å²	94.7	26%	0.259	54%	0.539	S	S	.	.	H	α-helix	trans	-63.3	-45.7	172.9	-175.9	-93.9	0	0	0	111.4	L25 K29 S32 K38 G39 V40	L25-F36 HydrophobicContact CD2-CE2 3.8Å; L25-F36 HydrophobicContact CD2-CZ 4.17Å; K29-F36 HydrophobicContact CB-CD1 4.39Å; K29-F36 HydrophobicContact CB-CG 4.39Å; K29-F36 HydrophobicContact CG-CD1 4.04Å; K29-F36 HydrophobicContact CG-CE1 4.32Å; K29-F36 HydrophobicContact CG-CG 4.41Å; S32-F36 VanDerWaalsContact O-CB 3.23Å; S32-F36 WeakPolarHBondContact O-CB 3.39Å; S32-F36 PolarHBondContact O-N 3.48Å; F36-K38 VanDerWaalsContact C-N 3.33Å; F36-K38 PolarHBondContact O-N 2.89Å; F36-G39 PolarHBondContact O-N 2.84Å; F36-G39 VanDerWaalsContact O-N 3.12Å; F36-V40 HydrophobicContact CD1-CG2 4.2Å; F36-V40 HydrophobicContact CE1-CG2 3.79Å; F36-V40 HydrophobicContact CE2-CG2 4.32Å; F36-V40 HydrophobicContact CZ-CG2 3.86Å; F36-V40 WeakPolarHBondContact O-CG2 3.38Å; F36-V40 PolarHBondContact O-N 2.76Å
37	S	73.3	Confident	69.3	Low	70 Å²	70	97.6 Å²	97.6	49%	0.49	55%	0.553	S	S	.	*	H	α-helix	trans	-64.7	-37.5	179	-55.4	0	0	0	0	111.9	P33 E34 G39 V40 A41	P33-S37 WeakPolarHBondContact O-CB 3.2Å; P33-S37 PolarHBondContact O-N 2.86Å; P33-S37 PolarHBondContact O-OG 2.82Å; E34-S37 PolarHBondContact O-N 3.44Å; S37-G39 VanDerWaalsContact C-N 3.35Å; S37-V40 PolarHBondContact O-N 3.2Å; S37-A41 WeakPolarHBondContact O-CB 3.17Å; S37-A41 PolarHBondContact O-N 2.99Å
38	K	71.4	Confident	68	Low	107 Å²	107	97.3 Å²	97.3	47%	0.465	55%	0.548	S	S	.	.	H	α-helix	trans	-68	-31	172.5	-70.4	173.5	-177.6	172.1	0	113.4	E34 W35 F36	E34-K38 WeakPolarHBondContact O-CG 3.41Å; E34-K38 PolarHBondContact O-N 3.3Å; E34-K38 VanDerWaalsContact O-N 3.15Å; E34-K38 IonicContact OE2-NZ 3.35Å; E34-K38 PolarHBondContact OE2-NZ 3.44Å; W35-K38 HydrophobicContact CE3-CD 4.48Å; W35-K38 PolarHBondContact O-N 2.92Å; F36-K38 VanDerWaalsContact C-N 3.33Å; F36-K38 PolarHBondContact O-N 2.89Å
39	G	70.3	Confident	67.4	Low	29 Å²	29	96 Å²	96	30%	0.299	54%	0.536	S	S	.	.	H	α-helix	trans	-75.6	-32.3	175.6	0	0	0	0	0	113.4	W35 F36 S37 S49 G50 A51	W35-G39 PolarHBondContact O-N 3.31Å; F36-G39 PolarHBondContact O-N 2.84Å; F36-G39 VanDerWaalsContact O-N 3.12Å; S37-G39 VanDerWaalsContact C-N 3.35Å; G39-S49 PolarHBondContact O-OG 3.43Å; G39-G50 PolarHBondContact O-N 2.86Å; G39-A51 WeakPolarHBondContact O-CB 3.36Å; G39-A51 PolarHBondContact O-N 3.31Å; G39-A51 VanDerWaalsContact O-N 3.1Å
40	V	69.4	Low	67	Low	79 Å²	79	92.4 Å²	92.4	48%	0.479	54%	0.535	S	S	.	.	H	α-helix	trans	-89	-36.6	-179.6	168.7	0	0	0	0	112.9	F36 S37 S49 A51	F36-V40 HydrophobicContact CD1-CG2 4.2Å; F36-V40 HydrophobicContact CE1-CG2 3.79Å; F36-V40 HydrophobicContact CE2-CG2 4.32Å; F36-V40 HydrophobicContact CZ-CG2 3.86Å; F36-V40 WeakPolarHBondContact O-CG2 3.38Å; F36-V40 PolarHBondContact O-N 2.76Å; S37-V40 PolarHBondContact O-N 3.2Å; V40-S49 WeakPolarHBondContact O-CB 3.48Å; V40-S49 PolarHBondContact O-OG 2.89Å; V40-S49 VanDerWaalsContact O-OG 3.12Å; V40-A51 HydrophobicContact CG2-CB 4.37Å
41	A	68.7	Low	66.7	Low	50 Å²	50	85.2 Å²	85.2	41%	0.413	51%	0.51	S	S	.	.	S	Bend	trans	-82.1	133.3	176.6	0	0	0	0	0	110.6	S37 T43	S37-A41 WeakPolarHBondContact O-CB 3.17Å; S37-A41 PolarHBondContact O-N 2.99Å; A41-T43 PolarHBondContact O-N 3.43Å
42	A	56.2	Low	66.4	Low	69 Å²	69	78.7 Å²	78.7	57%	0.57	49%	0.487	S	S	*	.			trans	-65.1	120.7	166.4	0	0	0	0	0	108
43	T	53.8	Low	66.8	Low	63 Å²	63	82.2 Å²	82.2	39%	0.387	50%	0.502	S	S	.	.	B	Isolated β-bridge	trans	-106.6	150.3	179.7	50	0	0	0	0	109.3	A41 V45 A46	A41-T43 PolarHBondContact O-N 3.43Å; T43-V45 PolarHBondContact O-N 2.78Å; T43-A46 CarbonylContact O-C 3.23Å; T43-A46 VanDerWaalsContact O-C 3.23Å; T43-A46 PolarHBondContact O-N 2.85Å
44	A	51.3	Low	67.4	Low	116 Å²	116	81.6 Å²	81.6	96%	0.959	50%	0.503	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.8	-8.6	-172.7	0	0	0	0	0	115.7
45	V	53.3	Low	67.9	Low	144 Å²	144	80.5 Å²	80.5	87%	0.873	50%	0.501	S	S	*	.	T	Hydrogen-bonded Turn	trans	-99	-17.1	178.6	-157.4	0	0	0	0	112.1	T43	T43-V45 PolarHBondContact O-N 2.78Å
46	A	50.2	Low	68.8	Low	45 Å²	45	79.5 Å²	79.5	37%	0.372	50%	0.497	S	S	.	.	B	Isolated β-bridge	trans	-139	100.3	175.8	0	0	0	0	0	108.9	T43 E48	T43-A46 CarbonylContact O-C 3.23Å; T43-A46 VanDerWaalsContact O-C 3.23Å; T43-A46 PolarHBondContact O-N 2.85Å; A46-E48 PolarHBondContact O-N 3.44Å
47	P	52.1	Low	69.6	Low	121 Å²	121	79.9 Å²	79.9	79%	0.786	51%	0.511	S	S	*	.	S	Bend	trans	-62.6	-15.4	-172.8	22.7	-31.9	0	0	0	114
48	E	59	Low	70.3	Confident	117 Å²	117	81 Å²	81	55%	0.547	51%	0.511	S	S	.	.	S	Bend	trans	-113.2	122.7	173	-64.5	-77.6	142.9	0	0	109.2	A46 G50	A46-E48 PolarHBondContact O-N 3.44Å; E48-G50 PolarHBondContact O-N 3.5Å
49	S	71.9	Confident	71.2	Confident	15 Å²	15	77.9 Å²	77.9	11%	0.105	51%	0.509	C	S	.	.			trans	-53.7	134.5	170.2	149.6	0	0	0	0	110	G39 V40 A51 S52 L53	G39-S49 PolarHBondContact O-OG 3.43Å; V40-S49 WeakPolarHBondContact O-CB 3.48Å; V40-S49 PolarHBondContact O-OG 2.89Å; V40-S49 VanDerWaalsContact O-OG 3.12Å; S49-A51 PolarHBondContact O-N 3.05Å; S49-A51 VanDerWaalsContact O-N 3.12Å; S49-A51 WeakPolarHBondContact OG-CB 3.24Å; S49-A51 PolarHBondContact OG-N 3.5Å; S49-S52 WeakPolarHBondContact O-CA 3.24Å; S49-S52 VanDerWaalsContact O-CB 3.24Å; S49-S52 WeakPolarHBondContact O-CB 3.47Å; S49-S52 PolarHBondContact O-N 2.83Å; S49-S52 PolarHBondContact OG-N 3.37Å; S49-L53 PolarHBondContact O-N 2.95Å; S49-L53 VanDerWaalsContact O-N 3.17Å
50	G	75.6	Confident	72.2	Confident	49 Å²	49	85.1 Å²	85.1	51%	0.505	53%	0.528	S	S	.	.	H	α-helix	trans	-57.8	-28	177.8	0	0	0	0	0	113.1	G39 E48 A54	G39-G50 PolarHBondContact O-N 2.86Å; E48-G50 PolarHBondContact O-N 3.5Å; G50-A54 WeakPolarHBondContact O-CB 3.39Å; G50-A54 PolarHBondContact O-N 3.37Å
51	A	78.1	Confident	73.3	Confident	32 Å²	32	83.3 Å²	83.3	26%	0.264	52%	0.524	S	S	.	.	H	α-helix	trans	-67.2	-39.4	170.1	0	0	0	0	0	112.7	G39 V40 S49 A54 L55	G39-A51 WeakPolarHBondContact O-CB 3.36Å; G39-A51 PolarHBondContact O-N 3.31Å; G39-A51 VanDerWaalsContact O-N 3.1Å; V40-A51 HydrophobicContact CG2-CB 4.37Å; S49-A51 PolarHBondContact O-N 3.05Å; S49-A51 VanDerWaalsContact O-N 3.12Å; S49-A51 WeakPolarHBondContact OG-CB 3.24Å; S49-A51 PolarHBondContact OG-N 3.5Å; A51-A54 PolarHBondContact O-N 3.35Å; A51-L55 VanDerWaalsContact O-CB 3.3Å; A51-L55 WeakPolarHBondContact O-CB 3.16Å; A51-L55 WeakPolarHBondContact O-CG 3.37Å; A51-L55 PolarHBondContact O-N 2.86Å
52	S	76.6	Confident	74.4	Confident	50 Å²	50	84.2 Å²	84.2	35%	0.35	53%	0.528	S	S	.	.	H	α-helix	trans	-60.8	-45.2	174.6	-175.9	0	0	0	0	111.4	S49 A54 L55 R56	S49-S52 WeakPolarHBondContact O-CA 3.24Å; S49-S52 VanDerWaalsContact O-CB 3.24Å; S49-S52 WeakPolarHBondContact O-CB 3.47Å; S49-S52 PolarHBondContact O-N 2.83Å; S49-S52 PolarHBondContact OG-N 3.37Å; S52-A54 PolarHBondContact O-N 3.01Å; S52-L55 PolarHBondContact O-N 3.34Å; S52-R56 WeakPolarHBondContact O-CB 3.31Å; S52-R56 PolarHBondContact O-N 3.23Å
53	L	80.9	Confident	76.1	Confident	120 Å²	120	86.3 Å²	86.3	63%	0.628	53%	0.529	S	S	*	.	H	α-helix	trans	-62.1	-45.6	177.2	-159.3	91.8	0	0	0	111.4	S49 R56 A57	S49-L53 PolarHBondContact O-N 2.95Å; S49-L53 VanDerWaalsContact O-N 3.17Å; L53-R56 PolarHBondContact O-N 3.31Å; L53-A57 WeakPolarHBondContact O-CB 3.33Å; L53-A57 PolarHBondContact O-N 3.29Å
54	A	86.6	Confident	77.9	Confident	60 Å²	60	92 Å²	92	50%	0.496	55%	0.545	S	S	.	.	H	α-helix	trans	-65.4	-40.5	177.8	0	0	0	0	0	112.4	G50 A51 S52 R56 A57 L58	G50-A54 WeakPolarHBondContact O-CB 3.39Å; G50-A54 PolarHBondContact O-N 3.37Å; A51-A54 PolarHBondContact O-N 3.35Å; S52-A54 PolarHBondContact O-N 3.01Å; A54-R56 VanDerWaalsContact C-N 3.34Å; A54-A57 PolarHBondContact O-N 2.9Å; A54-L58 WeakPolarHBondContact O-CB 3.23Å; A54-L58 PolarHBondContact O-N 2.75Å
55	L	85.1	Confident	79.9	Confident	105 Å²	105	89 Å²	89	55%	0.55	52%	0.52	S	S	.	.	H	α-helix	trans	-66.3	-37.1	176.3	-75.5	172	0	0	0	111.9	A51 S52 L58 G59	A51-L55 VanDerWaalsContact O-CB 3.3Å; A51-L55 WeakPolarHBondContact O-CB 3.16Å; A51-L55 WeakPolarHBondContact O-CG 3.37Å; A51-L55 PolarHBondContact O-N 2.86Å; S52-L55 PolarHBondContact O-N 3.34Å; L55-L58 HydrophobicContact CD2-CD2 4.43Å; L55-L58 PolarHBondContact O-N 3.43Å; L55-G59 PolarHBondContact O-N 3.32Å
56	R	85.4	Confident	81.8	Confident	169 Å²	169	92.4 Å²	92.4	64%	0.638	52%	0.517	S	S	*	.	H	α-helix	trans	-68.4	-45.4	175	-166.2	169.4	159.1	96.5	-1.5	110.6	S52 L53 A54 L58 G59 W60	S52-R56 WeakPolarHBondContact O-CB 3.31Å; S52-R56 PolarHBondContact O-N 3.23Å; L53-R56 PolarHBondContact O-N 3.31Å; A54-R56 VanDerWaalsContact C-N 3.34Å; R56-L58 VanDerWaalsContact C-N 3.32Å; R56-L58 PolarHBondContact O-N 2.84Å; R56-G59 PolarHBondContact O-N 2.85Å; R56-W60 PolarHBondContact O-N 2.87Å
57	A	93.1	Very high	83.8	Confident	67 Å²	67	93.9 Å²	93.9	55%	0.554	52%	0.523	S	S	*	.	H	α-helix	trans	-59.8	-42.2	173	0	0	0	0	0	112.2	L53 A54 W60 G61	L53-A57 WeakPolarHBondContact O-CB 3.33Å; L53-A57 PolarHBondContact O-N 3.29Å; A54-A57 PolarHBondContact O-N 2.9Å; A57-W60 PolarHBondContact O-N 2.98Å; A57-G61 PolarHBondContact O-N 3.37Å
58	L	87.4	Confident	85.7	Confident	95 Å²	95	89.6 Å²	89.6	50%	0.497	50%	0.501	S	S	.	.	H	α-helix	trans	-62	-42.7	174.6	-177.7	65.9	0	0	0	111.4	A54 L55 R56 G61 S62	A54-L58 WeakPolarHBondContact O-CB 3.23Å; A54-L58 PolarHBondContact O-N 2.75Å; L55-L58 HydrophobicContact CD2-CD2 4.43Å; L55-L58 PolarHBondContact O-N 3.43Å; R56-L58 VanDerWaalsContact C-N 3.32Å; R56-L58 PolarHBondContact O-N 2.84Å; L58-G61 CarbonylContact O-C 3.49Å; L58-G61 PolarHBondContact O-N 3.3Å; L58-S62 PolarHBondContact O-N 3.46Å; L58-S62 PolarHBondContact O-OG 2.84Å; L58-S62 VanDerWaalsContact O-OG 3.09Å
59	G	89.8	Confident	87.2	Confident	41 Å²	41	88.6 Å²	88.6	42%	0.423	50%	0.503	S	S	.	.	H	α-helix	trans	-62	-46.9	177.7	0	0	0	0	0	112.8	L55 R56 G61 S62 L63	L55-G59 PolarHBondContact O-N 3.32Å; R56-G59 PolarHBondContact O-N 2.85Å; G59-G61 VanDerWaalsContact C-N 3.31Å; G59-G61 PolarHBondContact O-N 2.97Å; G59-S62 PolarHBondContact O-N 2.79Å; G59-L63 WeakPolarHBondContact O-CB 3.17Å; G59-L63 PolarHBondContact O-N 3.22Å
60	W	92.2	Very high	88.1	Confident	181 Å²	181	89.5 Å²	89.5	69%	0.686	52%	0.515	S	S	*	.	H	α-helix	trans	-64.5	-37.2	174.3	-78.4	72.3	0	0	0	111.8	R56 A57 L63 Y64	R56-W60 PolarHBondContact O-N 2.87Å; A57-W60 PolarHBondContact O-N 2.98Å; W60-L63 PolarHBondContact O-N 2.99Å; W60-Y64 WeakPolarHBondContact O-CB 3.33Å; W60-Y64 PolarHBondContact O-N 3.48Å
61	G	92.8	Very high	88.9	Confident	40 Å²	40	93 Å²	93	41%	0.412	52%	0.521	S	S	.	.	H	α-helix	trans	-63.4	-44.7	174	0	0	0	0	0	113.1	A57 L58 G59 Y64 A65	A57-G61 PolarHBondContact O-N 3.37Å; L58-G61 CarbonylContact O-C 3.49Å; L58-G61 PolarHBondContact O-N 3.3Å; G59-G61 VanDerWaalsContact C-N 3.31Å; G59-G61 PolarHBondContact O-N 2.97Å; G61-Y64 PolarHBondContact O-N 2.89Å; G61-A65 WeakPolarHBondContact O-CB 3.37Å; G61-A65 PolarHBondContact O-N 3.47Å
62	S	90.6	Very high	89.4	Confident	69 Å²	69	96.8 Å²	96.8	48%	0.483	54%	0.537	S	S	.	.	H	α-helix	trans	-64.4	-40.6	175.6	-61.6	0	0	0	0	111.8	L58 G59 A65 W66	L58-S62 PolarHBondContact O-N 3.46Å; L58-S62 PolarHBondContact O-OG 2.84Å; L58-S62 VanDerWaalsContact O-OG 3.09Å; G59-S62 PolarHBondContact O-N 2.79Å; S62-A65 PolarHBondContact O-N 3.4Å; S62-W66 PolarHBondContact O-N 3.01Å
63	L	92.6	Very high	89.8	Confident	113 Å²	113	98 Å²	98	59%	0.592	55%	0.545	S	S	*	.	H	α-helix	trans	-63.6	-44	176.1	-171.2	67.1	0	0	0	111.4	G59 W60 W66 C67	G59-L63 WeakPolarHBondContact O-CB 3.17Å; G59-L63 PolarHBondContact O-N 3.22Å; W60-L63 PolarHBondContact O-N 2.99Å; L63-W66 PolarHBondContact O-N 3.44Å; L63-C67 WeakPolarHBondContact O-CB 3.43Å; L63-C67 PolarHBondContact O-N 3.37Å
64	Y	91.8	Very high	89.9	Confident	184 Å²	184	95.9 Å²	95.9	72%	0.722	54%	0.537	S	S	*	.	H	α-helix	trans	-64.9	-39.9	175.1	-172.8	-99.6	0	0	0	111.8	W60 G61 W66 C67 G68	W60-Y64 WeakPolarHBondContact O-CB 3.33Å; W60-Y64 PolarHBondContact O-N 3.48Å; G61-Y64 PolarHBondContact O-N 2.89Å; Y64-W66 VanDerWaalsContact C-N 3.35Å; Y64-W66 PolarHBondContact O-N 3.24Å; Y64-C67 PolarHBondContact O-N 3.2Å; Y64-G68 PolarHBondContact O-N 3.37Å
65	A	93.4	Very high	89.7	Confident	52 Å²	52	95.6 Å²	95.6	43%	0.43	53%	0.534	S	S	.	.	H	α-helix	trans	-62.4	-41.9	175.4	0	0	0	0	0	111.6	G61 S62 G68 V69	G61-A65 WeakPolarHBondContact O-CB 3.37Å; G61-A65 PolarHBondContact O-N 3.47Å; S62-A65 PolarHBondContact O-N 3.4Å; A65-G68 PolarHBondContact O-N 3.48Å; A65-V69 WeakPolarHBondContact O-CB 3.3Å; A65-V69 VanDerWaalsContact O-CG2 3.23Å; A65-V69 WeakPolarHBondContact O-CG2 3.4Å; A65-V69 PolarHBondContact O-N 2.79Å
66	W	92.4	Very high	89.5	Confident	216 Å²	216	93.5 Å²	93.5	82%	0.818	53%	0.526	S	S	*	.	H	α-helix	trans	-66.3	-43.2	176.4	-122.3	3.4	0	0	0	112.3	S62 L63 Y64 G70	S62-W66 PolarHBondContact O-N 3.01Å; L63-W66 PolarHBondContact O-N 3.44Å; Y64-W66 VanDerWaalsContact C-N 3.35Å; Y64-W66 PolarHBondContact O-N 3.24Å; W66-G70 PolarHBondContact O-N 3.48Å
67	C	92.5	Very high	88.7	Confident	75 Å²	75	93.1 Å²	93.1	51%	0.507	53%	0.525	S	S	.	.	H	α-helix	trans	-62.6	-44.8	174.9	-169.6	0	0	0	0	111.4	L63 Y64 G70 L71	L63-C67 WeakPolarHBondContact O-CB 3.43Å; L63-C67 PolarHBondContact O-N 3.37Å; Y64-C67 PolarHBondContact O-N 3.2Å; C67-G70 PolarHBondContact O-N 2.82Å; C67-L71 PolarHBondContact O-N 2.93Å
68	G	91.5	Very high	87.7	Confident	31 Å²	31	98.3 Å²	98.3	32%	0.32	54%	0.535	S	S	.	.	H	α-helix	trans	-63.4	-48.3	178.6	0	0	0	0	0	112.3	Y64 A65 G70 L71 L72	Y64-G68 PolarHBondContact O-N 3.37Å; A65-G68 PolarHBondContact O-N 3.48Å; G68-G70 VanDerWaalsContact C-N 3.3Å; G68-G70 PolarHBondContact O-N 2.97Å; G68-L71 PolarHBondContact O-N 2.65Å; G68-L72 VanDerWaalsContact O-CB 3.3Å; G68-L72 WeakPolarHBondContact O-CB 3.37Å; G68-L72 PolarHBondContact O-N 3.09Å
69	V	91.1	Very high	86.7	Confident	96 Å²	96	98 Å²	98	58%	0.582	55%	0.546	S	S	*	.	H	α-helix	trans	-63.5	-37.6	175.8	172.3	0	0	0	0	111.1	A65 L72 S73	A65-V69 WeakPolarHBondContact O-CB 3.3Å; A65-V69 VanDerWaalsContact O-CG2 3.23Å; A65-V69 WeakPolarHBondContact O-CG2 3.4Å; A65-V69 PolarHBondContact O-N 2.79Å; V69-L72 PolarHBondContact O-N 2.83Å; V69-S73 WeakPolarHBondContact O-CB 3.23Å; V69-S73 PolarHBondContact O-N 2.89Å
70	G	91.3	Very high	85.4	Confident	35 Å²	35	99.1 Å²	99.1	36%	0.361	54%	0.542	S	S	.	.	H	α-helix	trans	-61.9	-49.1	172.9	0	0	0	0	0	112.4	W66 C67 G68 S73 V74	W66-G70 PolarHBondContact O-N 3.48Å; C67-G70 PolarHBondContact O-N 2.82Å; G68-G70 VanDerWaalsContact C-N 3.3Å; G68-G70 PolarHBondContact O-N 2.97Å; G70-S73 WeakPolarHBondContact O-CB 3.43Å; G70-S73 PolarHBondContact O-N 3.08Å; G70-V74 WeakPolarHBondContact O-CG2 3.33Å; G70-V74 PolarHBondContact O-N 2.92Å
71	L	91.6	Very high	83.7	Confident	121 Å²	121	93.2 Å²	93.2	63%	0.634	54%	0.538	S	S	*	.	H	α-helix	trans	-62.3	-43.1	175.6	-109.6	78.4	0	0	0	111.9	C67 G68 S73 V74 A75	C67-L71 PolarHBondContact O-N 2.93Å; G68-L71 PolarHBondContact O-N 2.65Å; L71-S73 VanDerWaalsContact C-N 3.32Å; L71-V74 PolarHBondContact O-N 2.92Å; L71-A75 VanDerWaalsContact O-CB 3.24Å; L71-A75 WeakPolarHBondContact O-CB 3.32Å; L71-A75 PolarHBondContact O-N 2.94Å
72	L	88	Confident	81.8	Confident	113 Å²	113	92.2 Å²	92.2	59%	0.592	52%	0.522	S	S	*	.	H	α-helix	trans	-63.7	-41.7	177.9	-138.3	-179.3	0	0	0	110.1	G68 V69 A75 V76	G68-L72 VanDerWaalsContact O-CB 3.3Å; G68-L72 WeakPolarHBondContact O-CB 3.37Å; G68-L72 PolarHBondContact O-N 3.09Å; V69-L72 PolarHBondContact O-N 2.83Å; L72-A75 PolarHBondContact O-N 3.3Å; L72-V76 HydrophobicContact CD2-CG2 3.82Å; L72-V76 WeakPolarHBondContact O-CB 3.24Å; L72-V76 VanDerWaalsContact O-CG2 3.24Å; L72-V76 WeakPolarHBondContact O-CG2 3.49Å; L72-V76 PolarHBondContact O-N 3.21Å
73	S	85.8	Confident	80	Confident	75 Å²	75	98.3 Å²	98.3	52%	0.524	54%	0.543	S	S	.	.	H	α-helix	trans	-61.4	-45.2	175	-177.2	0	0	0	0	111.5	V69 G70 L71 V76 W77	V69-S73 WeakPolarHBondContact O-CB 3.23Å; V69-S73 PolarHBondContact O-N 2.89Å; G70-S73 WeakPolarHBondContact O-CB 3.43Å; G70-S73 PolarHBondContact O-N 3.08Å; L71-S73 VanDerWaalsContact C-N 3.32Å; S73-V76 PolarHBondContact O-N 3.49Å; S73-W77 WeakPolarHBondContact O-CB 3.24Å; S73-W77 PolarHBondContact O-N 3.36Å
74	V	83.7	Confident	78.2	Confident	76 Å²	76	96.1 Å²	96.1	46%	0.461	54%	0.537	S	S	.	.	H	α-helix	trans	-67.6	-38.5	175.9	173.2	0	0	0	0	111.8	G70 L71 W77 K78	G70-V74 WeakPolarHBondContact O-CG2 3.33Å; G70-V74 PolarHBondContact O-N 2.92Å; L71-V74 PolarHBondContact O-N 2.92Å; V74-W77 CarbonylContact O-C 3.59Å; V74-W77 WeakPolarHBondContact O-CB 3.41Å; V74-W77 PolarHBondContact O-N 3.44Å; V74-K78 HydrophobicContact CG1-CG 4.34Å; V74-K78 WeakPolarHBondContact O-CB 3.19Å; V74-K78 WeakPolarHBondContact O-CG 3.3Å; V74-K78 PolarHBondContact O-N 2.79Å
75	A	82.5	Confident	76.5	Confident	53 Å²	53	94.2 Å²	94.2	44%	0.438	54%	0.538	S	S	.	.	H	α-helix	trans	-64.4	-43	176.7	0	0	0	0	0	111.1	L71 L72 W77 K78 A79	L71-A75 VanDerWaalsContact O-CB 3.24Å; L71-A75 WeakPolarHBondContact O-CB 3.32Å; L71-A75 PolarHBondContact O-N 2.94Å; L72-A75 PolarHBondContact O-N 3.3Å; A75-W77 VanDerWaalsContact C-N 3.32Å; A75-K78 PolarHBondContact O-N 3.34Å; A75-A79 WeakPolarHBondContact O-CB 3.38Å; A75-A79 PolarHBondContact O-N 3.41Å
76	V	79.6	Confident	74.7	Confident	62 Å²	62	94.1 Å²	94.1	38%	0.376	54%	0.538	S	S	.	.	H	α-helix	trans	-61.4	-42.5	171.5	169.1	0	0	0	0	110.4	L72 S73 K78 A79 L80	L72-V76 HydrophobicContact CD2-CG2 3.82Å; L72-V76 WeakPolarHBondContact O-CB 3.24Å; L72-V76 VanDerWaalsContact O-CG2 3.24Å; L72-V76 WeakPolarHBondContact O-CG2 3.49Å; L72-V76 PolarHBondContact O-N 3.21Å; S73-V76 PolarHBondContact O-N 3.49Å; V76-K78 PolarHBondContact O-N 2.87Å; V76-A79 PolarHBondContact O-N 3.37Å; V76-L80 HydrophobicContact CG1-CD1 3.49Å; V76-L80 VanDerWaalsContact CG1-CD1 3.49Å; V76-L80 HydrophobicContact CG1-CG 4.4Å; V76-L80 WeakPolarHBondContact O-CB 3.28Å; V76-L80 WeakPolarHBondContact O-CD1 3.37Å; V76-L80 VanDerWaalsContact O-CG 3.31Å; V76-L80 WeakPolarHBondContact O-CG 3.18Å; V76-L80 PolarHBondContact O-N 3.46Å
77	W	69.9	Low	73.2	Confident	161 Å²	161	88.9 Å²	88.9	61%	0.61	52%	0.523	S	S	*	.	H	α-helix	trans	-63.6	-39.2	178	-159.1	6.4	0	0	0	112.6	S73 V74 A75 G81 I82	S73-W77 WeakPolarHBondContact O-CB 3.24Å; S73-W77 PolarHBondContact O-N 3.36Å; V74-W77 CarbonylContact O-C 3.59Å; V74-W77 WeakPolarHBondContact O-CB 3.41Å; V74-W77 PolarHBondContact O-N 3.44Å; A75-W77 VanDerWaalsContact C-N 3.32Å; W77-G81 PolarHBondContact O-N 2.82Å; W77-I82 VanDerWaalsContact CD1-O 3.29Å; W77-I82 PolarHBondContact NE1-O 3.35Å
78	K	71.2	Confident	71.7	Confident	175 Å²	175	89.5 Å²	89.5	76%	0.761	52%	0.517	S	S	*	.	H	α-helix	trans	-73.6	-41.3	175.5	-77.1	-103.2	174.9	164	0	113	V74 A75 V76 L80 G81	V74-K78 HydrophobicContact CG1-CG 4.34Å; V74-K78 WeakPolarHBondContact O-CB 3.19Å; V74-K78 WeakPolarHBondContact O-CG 3.3Å; V74-K78 PolarHBondContact O-N 2.79Å; A75-K78 PolarHBondContact O-N 3.34Å; V76-K78 PolarHBondContact O-N 2.87Å; K78-L80 VanDerWaalsContact C-N 3.33Å; K78-G81 PolarHBondContact O-N 3.37Å
79	A	67.4	Low	70.4	Confident	90 Å²	90	94.9 Å²	94.9	74%	0.744	53%	0.528	S	S	*	.	H	α-helix	trans	-70.6	-30.1	-179.3	0	0	0	0	0	112.5	A75 V76	A75-A79 WeakPolarHBondContact O-CB 3.38Å; A75-A79 PolarHBondContact O-N 3.41Å; V76-A79 PolarHBondContact O-N 3.37Å
80	L	62.5	Low	69.1	Low	63 Å²	63	96.6 Å²	96.6	33%	0.33	53%	0.529	S	S	.	.	T	Hydrogen-bonded Turn	trans	-85.5	-10.6	177	-67.8	164.7	0	0	0	113.4	V76 K78 I82 F88	V76-L80 HydrophobicContact CG1-CD1 3.49Å; V76-L80 VanDerWaalsContact CG1-CD1 3.49Å; V76-L80 HydrophobicContact CG1-CG 4.4Å; V76-L80 WeakPolarHBondContact O-CB 3.28Å; V76-L80 WeakPolarHBondContact O-CD1 3.37Å; V76-L80 VanDerWaalsContact O-CG 3.31Å; V76-L80 WeakPolarHBondContact O-CG 3.18Å; V76-L80 PolarHBondContact O-N 3.46Å; K78-L80 VanDerWaalsContact C-N 3.33Å; L80-I82 HydrophobicContact CB-CB 4.44Å; L80-I82 HydrophobicContact CB-CD1 3.4Å; L80-I82 VanDerWaalsContact CB-CD1 3.4Å; L80-I82 HydrophobicContact CB-CG1 3.54Å; L80-I82 HydrophobicContact CD1-CD1 3.73Å; L80-I82 HydrophobicContact CG-CD1 4.1Å; L80-I82 WeakPolarHBondContact O-CG1 3.19Å; L80-I82 PolarHBondContact O-N 2.96Å; L80-F88 HydrophobicContact CD1-CD2 4.18Å
81	G	55.5	Low	67.8	Low	58 Å²	58	100.8 Å²	100.8	60%	0.598	54%	0.538	S	S	*	.	T	Hydrogen-bonded Turn	trans	66.9	18.3	179	0	0	0	0	0	114.4	W77 K78 H83	W77-G81 PolarHBondContact O-N 2.82Å; K78-G81 PolarHBondContact O-N 3.37Å; G81-H83 PolarHBondContact O-N 3.48Å
82	I	52.3	Low	66.5	Low	18 Å²	18	99 Å²	99	9%	0.092	53%	0.527	C	S	.	.			trans	-81.9	109.4	-164.2	-70	177.1	0	0	0	110.9	W77 L80 S84 E87 F88	W77-I82 VanDerWaalsContact CD1-O 3.29Å; W77-I82 PolarHBondContact NE1-O 3.35Å; L80-I82 HydrophobicContact CB-CB 4.44Å; L80-I82 HydrophobicContact CB-CD1 3.4Å; L80-I82 VanDerWaalsContact CB-CD1 3.4Å; L80-I82 HydrophobicContact CB-CG1 3.54Å; L80-I82 HydrophobicContact CD1-CD1 3.73Å; L80-I82 HydrophobicContact CG-CD1 4.1Å; L80-I82 WeakPolarHBondContact O-CG1 3.19Å; L80-I82 PolarHBondContact O-N 2.96Å; I82-S84 VanDerWaalsContact C-N 3.25Å; I82-S84 WeakPolarHBondContact CG2-O 3.38Å; I82-E87 HydrophobicContact CD1-CB 4.25Å; I82-E87 HydrophobicContact CG1-CB 4.07Å; I82-F88 HydrophobicContact CD1-CB 3.82Å
83	H	52.6	Low	65.3	Low	198 Å²	198	97.6 Å²	97.6	92%	0.917	52%	0.517	S	S	*	.	S	Bend	trans	-78.6	-5.5	162.3	-107.4	-86.4	0	0	0	112.7	G81	G81-H83 PolarHBondContact O-N 3.48Å
84	S	54.8	Low	64.2	Low	66 Å²	66	98.2 Å²	98.2	46%	0.462	52%	0.522	S	S	.	.	S	Bend	trans	-157.8	134.1	-176.3	177.8	0	0	0	0	116.3	I82 A86 E87	I82-S84 VanDerWaalsContact C-N 3.25Å; I82-S84 WeakPolarHBondContact CG2-O 3.38Å; S84-A86 PolarHBondContact O-N 2.94Å; S84-A86 PolarHBondContact OG-N 2.64Å; S84-E87 PolarHBondContact O-N 3.12Å; S84-E87 VanDerWaalsContact O-N 3.1Å
85	L	56.3	Low	63	Low	144 Å²	144	102.5 Å²	102.5	75%	0.754	53%	0.534	S	S	*	.	H	α-helix	trans	-47.7	-19.1	173.3	-80.8	171.9	0	0	0	115.5	R89	L85-R89 WeakPolarHBondContact O-CB 3.42Å; L85-R89 PolarHBondContact O-N 3.36Å; L85-R89 VanDerWaalsContact O-N 3.08Å
86	A	56.4	Low	61.9	Low	51 Å²	51	107.4 Å²	107.4	42%	0.421	55%	0.546	S	S	.	.	H	α-helix	trans	-62	-38.2	176.6	0	0	0	0	0	113.5	S84 R89 Q90	S84-A86 PolarHBondContact O-N 2.94Å; S84-A86 PolarHBondContact OG-N 2.64Å; A86-R89 PolarHBondContact O-N 3.12Å; A86-Q90 PolarHBondContact O-N 3.25Å
87	E	60	Low	60.7	Low	106 Å²	106	109.8 Å²	109.8	50%	0.495	56%	0.563	S	S	.	*	H	α-helix	trans	-74.8	-36.2	179.9	-78.6	-172	154.2	0	0	112.4	I82 S84 R89 Q90 K91	I82-E87 HydrophobicContact CD1-CB 4.25Å; I82-E87 HydrophobicContact CG1-CB 4.07Å; S84-E87 PolarHBondContact O-N 3.12Å; S84-E87 VanDerWaalsContact O-N 3.1Å; E87-R89 VanDerWaalsContact C-N 3.31Å; E87-Q90 PolarHBondContact O-N 3.47Å; E87-K91 WeakPolarHBondContact O-CB 3.44Å; E87-K91 PolarHBondContact O-N 3.17Å
88	F	62.6	Low	59.8	Low	87 Å²	87	105.8 Å²	105.8	38%	0.382	56%	0.564	S	S	.	*	H	α-helix	trans	-61.8	-43.9	172.2	-179.5	-116.3	0	0	0	110.5	L80 I82 K91 M92	L80-F88 HydrophobicContact CD1-CD2 4.18Å; I82-F88 HydrophobicContact CD1-CB 3.82Å; F88-K91 PolarHBondContact O-N 2.83Å; F88-M92 HydrophobicContact CD1-CE 3.4Å; F88-M92 HydrophobicContact CD1-SD 4.32Å; F88-M92 HydrophobicContact CE1-CE 3.02Å; F88-M92 HydrophobicContact CE1-CG 4.5Å; F88-M92 HydrophobicContact CE1-SD 3.6Å; F88-M92 HydrophobicContact CE2-CE 4.3Å; F88-M92 HydrophobicContact CE2-CG 4.18Å; F88-M92 HydrophobicContact CE2-SD 3.98Å; F88-M92 HydrophobicContact CG-CE 4.19Å; F88-M92 HydrophobicContact CZ-CE 3.53Å; F88-M92 HydrophobicContact CZ-CG 4.18Å; F88-M92 HydrophobicContact CZ-SD 3.38Å; F88-M92 WeakPolarHBondContact CZ-SD 3.45Å; F88-M92 WeakPolarHBondContact O-CB 3.47Å; F88-M92 WeakPolarHBondContact O-CG 3.39Å; F88-M92 PolarHBondContact O-N 3.41Å
89	R	63.8	Low	59.1	Low	145 Å²	145	105.1 Å²	105.1	55%	0.547	57%	0.567	S	S	.	*	H	α-helix	trans	-63.5	-45.7	174.7	-178.5	175.8	161	-104.8	-9.6	111.7	L85 A86 E87 K91 M92 E93	L85-R89 WeakPolarHBondContact O-CB 3.42Å; L85-R89 PolarHBondContact O-N 3.36Å; L85-R89 VanDerWaalsContact O-N 3.08Å; A86-R89 PolarHBondContact O-N 3.12Å; E87-R89 VanDerWaalsContact C-N 3.31Å; R89-K91 PolarHBondContact O-N 3.05Å; R89-M92 PolarHBondContact O-N 3.46Å; R89-E93 HydrophobicContact CG-CG 4.32Å; R89-E93 IonicContact CZ-OE1 3.13Å; R89-E93 IonicContact CZ-OE2 3.88Å; R89-E93 IonicContact NE-OE1 3.04Å; R89-E93 PolarHBondContact NE-OE1 3.37Å; R89-E93 IonicContact NH2-OE1 2.67Å; R89-E93 PolarHBondContact NH2-OE1 2.84Å; R89-E93 IonicContact NH2-OE2 3.56Å; R89-E93 WeakPolarHBondContact O-CB 3.16Å; R89-E93 WeakPolarHBondContact O-CG 3.46Å; R89-E93 PolarHBondContact O-N 3.43Å
90	Q	62.7	Low	58.4	Low	132 Å²	132	105.8 Å²	105.8	62%	0.617	56%	0.564	S	S	*	*	H	α-helix	trans	-62.8	-40.1	178.3	-82.4	-169.1	-80	0	0	112.8	A86 E87 E93 S94	A86-Q90 PolarHBondContact O-N 3.25Å; E87-Q90 PolarHBondContact O-N 3.47Å; Q90-E93 PolarHBondContact O-N 3.23Å; Q90-S94 PolarHBondContact O-N 2.97Å
91	K	63.8	Low	57.9	Low	123 Å²	123	114.8 Å²	114.8	54%	0.535	59%	0.594	S	S	.	*	H	α-helix	trans	-74.2	-32.2	178.4	-156.4	162.2	-175	177	0	112.1	E87 F88 R89 S94 F95	E87-K91 WeakPolarHBondContact O-CB 3.44Å; E87-K91 PolarHBondContact O-N 3.17Å; F88-K91 PolarHBondContact O-N 2.83Å; R89-K91 PolarHBondContact O-N 3.05Å; K91-S94 PolarHBondContact O-N 3.29Å; K91-S94 PolarHBondContact O-OG 3.44Å; K91-F95 WeakPolarHBondContact O-CD2 3.38Å; K91-F95 PolarHBondContact O-N 2.94Å
92	M	64.5	Low	57.4	Low	82 Å²	82	115.4 Å²	115.4	40%	0.404	58%	0.583	S	S	.	*	H	α-helix	trans	-70.8	-35.4	168.7	-77.3	-162	-56.1	0	0	112.5	F88 R89 S94 F95 F96	F88-M92 HydrophobicContact CD1-CE 3.4Å; F88-M92 HydrophobicContact CD1-SD 4.32Å; F88-M92 HydrophobicContact CE1-CE 3.02Å; F88-M92 HydrophobicContact CE1-CG 4.5Å; F88-M92 HydrophobicContact CE1-SD 3.6Å; F88-M92 HydrophobicContact CE2-CE 4.3Å; F88-M92 HydrophobicContact CE2-CG 4.18Å; F88-M92 HydrophobicContact CE2-SD 3.98Å; F88-M92 HydrophobicContact CG-CE 4.19Å; F88-M92 HydrophobicContact CZ-CE 3.53Å; F88-M92 HydrophobicContact CZ-CG 4.18Å; F88-M92 HydrophobicContact CZ-SD 3.38Å; F88-M92 WeakPolarHBondContact CZ-SD 3.45Å; F88-M92 WeakPolarHBondContact O-CB 3.47Å; F88-M92 WeakPolarHBondContact O-CG 3.39Å; F88-M92 PolarHBondContact O-N 3.41Å; R89-M92 PolarHBondContact O-N 3.46Å; M92-S94 VanDerWaalsContact C-N 3.28Å; M92-S94 PolarHBondContact O-N 3.1Å; M92-F95 PolarHBondContact O-N 2.75Å; M92-F96 WeakPolarHBondContact O-CB 3.23Å; M92-F96 PolarHBondContact O-N 2.89Å
93	E	63.3	Low	57.4	Low	85 Å²	85	119.8 Å²	119.8	40%	0.397	61%	0.613	S	S	.	*	H	α-helix	trans	-69.8	-22.2	173.5	-78.3	-175.1	171.8	0	0	112.8	R89 Q90 F96	R89-E93 HydrophobicContact CG-CG 4.32Å; R89-E93 IonicContact CZ-OE1 3.13Å; R89-E93 IonicContact CZ-OE2 3.88Å; R89-E93 IonicContact NE-OE1 3.04Å; R89-E93 PolarHBondContact NE-OE1 3.37Å; R89-E93 IonicContact NH2-OE1 2.67Å; R89-E93 PolarHBondContact NH2-OE1 2.84Å; R89-E93 IonicContact NH2-OE2 3.56Å; R89-E93 WeakPolarHBondContact O-CB 3.16Å; R89-E93 WeakPolarHBondContact O-CG 3.46Å; R89-E93 PolarHBondContact O-N 3.43Å; Q90-E93 PolarHBondContact O-N 3.23Å; E93-F96 CarbonylContact C-O 3.59Å
94	S	62.1	Low	57.1	Low	88 Å²	88	117.1 Å²	117.1	62%	0.615	60%	0.601	S	S	*	*	H	α-helix	trans	-79.3	-27.9	170.4	73	0	0	0	0	112.9	Q90 K91 M92	Q90-S94 PolarHBondContact O-N 2.97Å; K91-S94 PolarHBondContact O-N 3.29Å; K91-S94 PolarHBondContact O-OG 3.44Å; M92-S94 VanDerWaalsContact C-N 3.28Å; M92-S94 PolarHBondContact O-N 3.1Å
95	F	59.8	Low	56.7	Low	165 Å²	165	117.3 Å²	117.3	72%	0.724	61%	0.606	S	S	*	*	H	α-helix	trans	-85.7	-33.4	176.3	-94.1	-82.6	0	0	0	112.9	K91 M92	K91-F95 WeakPolarHBondContact O-CD2 3.38Å; K91-F95 PolarHBondContact O-N 2.94Å; M92-F95 PolarHBondContact O-N 2.75Å
96	F	57.9	Low	56.2	Low	156 Å²	156	114.5 Å²	114.5	68%	0.684	60%	0.604	S	S	*	*	S	Bend	trans	-102.4	104.9	172.4	-81.1	-92.6	0	0	0	108.3	M92 E93 A98	M92-F96 WeakPolarHBondContact O-CB 3.23Å; M92-F96 PolarHBondContact O-N 2.89Å; E93-F96 CarbonylContact C-O 3.59Å; F96-A98 PolarHBondContact O-N 3.48Å
97	P	55.3	Low	55.6	Low	113 Å²	113	116.5 Å²	116.5	73%	0.734	62%	0.621	S	S	*	*			trans	-52.8	122.1	177.7	21.5	-31.4	0	0	0	108.9	I99	P97-I99 PolarHBondContact O-N 3.36Å
98	A	52	Low	54.9	Low	77 Å²	77	114.9 Å²	114.9	64%	0.636	63%	0.632	S	S	*	*			trans	-51.6	117.9	-177.8	0	0	0	0	0	109.5	F96 P100	F96-A98 PolarHBondContact O-N 3.48Å; A98-P100 WeakPolarHBondContact O-CD 3.4Å; A98-P100 VanDerWaalsContact O-N 3.13Å
99	I	56.2	Low	54.1	Low	160 Å²	160	115 Å²	115	82%	0.821	64%	0.643	S	S	*	*			trans	-63.5	115.2	169.8	-63.6	164.6	0	0	0	105.7	P97 R101	P97-I99 PolarHBondContact O-N 3.36Å; I99-R101 PolarHBondContact O-N 2.96Å
100	P	51.3	Low	53.7	Low	105 Å²	105	116.5 Å²	116.5	68%	0.682	66%	0.657	S	S	*	*			trans	-63.3	114.3	178.4	24.9	-30.8	0	0	0	107.8	A98 N102	A98-P100 WeakPolarHBondContact O-CD 3.4Å; A98-P100 VanDerWaalsContact O-N 3.13Å; P100-N102 PolarHBondContact O-N 3.43Å
101	R	53.4	Low	53.4	Low	251 Å²	251	116 Å²	116	95%	0.947	67%	0.665	S	S	*	*			trans	-72.6	70.2	162.6	-114.8	-177.6	-177.7	165.9	0.8	107.4	I99 P103	I99-R101 PolarHBondContact O-N 2.96Å; R101-P103 WeakPolarHBondContact O-CD 3.44Å
102	N	43.6	Very low	53.3	Low	72 Å²	72	116.9 Å²	116.9	39%	0.385	68%	0.675	S	S	.	*			trans	-78.4	117.8	164.2	-169.7	-6	0	0	0	107.3	P100 E104 A105	P100-N102 PolarHBondContact O-N 3.43Å; N102-E104 PolarHBondContact ND2-OE2 2.9Å; N102-E104 PolarHBondContact O-N 3.02Å; N102-E104 VanDerWaalsContact O-N 3.08Å; N102-E104 WeakPolarHBondContact OD1-CB 3.42Å; N102-E104 WeakPolarHBondContact OD1-CG 3.4Å; N102-E104 PolarHBondContact OD1-N 3.02Å; N102-E104 PolarHBondContact OD1-OE2 2.84Å; N102-A105 PolarHBondContact O-N 3.32Å
103	P	53.2	Low	53.4	Low	110 Å²	110	117.6 Å²	117.6	71%	0.714	68%	0.681	S	S	*	*	G	3₁₀ helix	trans	-57.7	-14.1	169.8	24.1	-33.3	0	0	0	113.2	R101 A106	R101-P103 WeakPolarHBondContact O-CD 3.44Å; P103-A106 PolarHBondContact O-N 2.94Å
104	E	46.3	Very low	53.9	Low	142 Å²	142	121.6 Å²	121.6	66%	0.664	69%	0.692	S	S	*	*	G	3₁₀ helix	trans	-78.1	-16.3	176.6	-58.3	174.7	108.8	0	0	114.3	N102 A106 A107	N102-E104 PolarHBondContact ND2-OE2 2.9Å; N102-E104 PolarHBondContact O-N 3.02Å; N102-E104 VanDerWaalsContact O-N 3.08Å; N102-E104 WeakPolarHBondContact OD1-CB 3.42Å; N102-E104 WeakPolarHBondContact OD1-CG 3.4Å; N102-E104 PolarHBondContact OD1-N 3.02Å; N102-E104 PolarHBondContact OD1-OE2 2.84Å; E104-A106 PolarHBondContact O-N 3.27Å; E104-A107 PolarHBondContact O-N 2.98Å; E104-A107 VanDerWaalsContact O-N 3.13Å
105	A	45.8	Very low	54.3	Low	69 Å²	69	123.4 Å²	123.4	57%	0.57	70%	0.695	S	S	*	*	G	3₁₀ helix	trans	-73.2	-10.9	172.3	0	0	0	0	0	113	N102 A107	N102-A105 PolarHBondContact O-N 3.32Å; A105-A107 VanDerWaalsContact C-N 3.29Å
106	A	46.3	Very low	54.9	Low	85 Å²	85	118.5 Å²	118.5	70%	0.702	69%	0.685	S	S	*	*	G	3₁₀ helix	trans	-80	-8.9	169.8	0	0	0	0	0	113	P103 E104	P103-A106 PolarHBondContact O-N 2.94Å; E104-A106 PolarHBondContact O-N 3.27Å
107	A	44.4	Very low	55.3	Low	94 Å²	94	116.7 Å²	116.7	78%	0.777	68%	0.681	S	S	*	*	S	Bend	trans	-97.6	-4.5	178.9	0	0	0	0	0	113.8	E104 A105	E104-A107 PolarHBondContact O-N 2.98Å; E104-A107 VanDerWaalsContact O-N 3.13Å; A105-A107 VanDerWaalsContact C-N 3.29Å
108	G	44.6	Very low	56.2	Low	72 Å²	72	117.9 Å²	117.9	74%	0.742	68%	0.68	S	S	*	*	S	Bend	trans	-122.7	3	-172.7	0	0	0	0	0	116.2
109	S	46.2	Very low	56.5	Low	88 Å²	88	117.1 Å²	117.1	62%	0.615	68%	0.68	S	S	*	*	S	Bend	trans	-109.2	107.8	166.3	43.6	0	0	0	0	107.6
110	E	55.8	Low	57	Low	177 Å²	177	114.6 Å²	114.6	83%	0.827	68%	0.677	S	S	*	*			trans	-42.4	134.3	162.3	-70.5	176.8	84.9	0	0	108.3	L112	E110-L112 PolarHBondContact O-N 3.12Å
111	P	56	Low	57	Low	122 Å²	122	122.1 Å²	122.1	79%	0.792	70%	0.699	S	S	*	*			trans	-59.7	112	174.9	25.3	-30.5	0	0	0	106.4	D113	P111-D113 PolarHBondContact O-N 3.49Å
112	L	61.8	Low	57.2	Low	142 Å²	142	115.7 Å²	115.7	74%	0.743	69%	0.686	S	S	*	*			trans	-53.8	107.6	173.9	-72.2	170.3	0	0	0	107.2	E110 W114	E110-L112 PolarHBondContact O-N 3.12Å; L112-W114 PolarHBondContact O-N 3.44Å
113	D	67.4	Low	57.9	Low	97 Å²	97	118 Å²	118	52%	0.519	70%	0.702	S	S	.	*			trans	-75.7	92.3	-172.5	-175.2	15.5	0	0	0	109.5	P111 D115 A116	P111-D113 PolarHBondContact O-N 3.49Å; D113-D115 PolarHBondContact O-N 3.15Å; D113-D115 WeakPolarHBondContact OD1-CB 3.44Å; D113-D115 PolarHBondContact OD1-N 3.44Å; D113-A116 HydrophobicContact CB-CB 4.41Å; D113-A116 PolarHBondContact O-N 3.42Å
114	W	71.9	Confident	58.1	Low	168 Å²	168	118.4 Å²	118.4	64%	0.636	70%	0.702	S	S	*	*	H	α-helix	trans	-64.1	-21.6	177.6	-67	102.2	0	0	0	112.2	L112 A116 I117 L118	L112-W114 PolarHBondContact O-N 3.44Å; W114-A116 VanDerWaalsContact C-N 3.33Å; W114-I117 HydrophobicContact CE3-CD1 4.34Å; W114-I117 HydrophobicContact CZ3-CD1 4.39Å; W114-I117 PolarHBondContact O-N 3.03Å; W114-L118 WeakPolarHBondContact O-CB 3.43Å; W114-L118 WeakPolarHBondContact O-CG 3.41Å; W114-L118 PolarHBondContact O-N 2.95Å
115	D	71.6	Confident	58.8	Low	127 Å²	127	117.1 Å²	117.1	68%	0.679	70%	0.704	S	S	*	*	H	α-helix	trans	-70.9	-30.2	176.9	-72.3	-48.8	0	0	0	111.6	D113 G119	D113-D115 PolarHBondContact O-N 3.15Å; D113-D115 WeakPolarHBondContact OD1-CB 3.44Å; D113-D115 PolarHBondContact OD1-N 3.44Å; D115-G119 WeakPolarHBondContact O-CA 3.41Å; D115-G119 PolarHBondContact O-N 3.44Å
116	A	71.2	Confident	59.6	Low	61 Å²	61	120.1 Å²	120.1	50%	0.504	71%	0.712	S	S	.	*	H	α-helix	trans	-68.4	-33.4	173.6	0	0	0	0	0	112.9	D113 W114	D113-A116 HydrophobicContact CB-CB 4.41Å; D113-A116 PolarHBondContact O-N 3.42Å; W114-A116 VanDerWaalsContact C-N 3.33Å
117	I	66.7	Low	60.5	Low	119 Å²	119	122.4 Å²	122.4	61%	0.61	71%	0.713	S	S	*	*	H	α-helix	trans	-79.8	-37.5	178.8	-63	178.3	0	0	0	111	W114	W114-I117 HydrophobicContact CE3-CD1 4.34Å; W114-I117 HydrophobicContact CZ3-CD1 4.39Å; W114-I117 PolarHBondContact O-N 3.03Å
118	L	75.3	Confident	61.7	Low	137 Å²	137	124.4 Å²	124.4	72%	0.717	71%	0.708	S	S	*	*	H	α-helix	trans	-85.7	-22.7	-178.4	-65.1	173.9	0	0	0	113.2	W114	W114-L118 WeakPolarHBondContact O-CB 3.43Å; W114-L118 WeakPolarHBondContact O-CG 3.41Å; W114-L118 PolarHBondContact O-N 2.95Å
119	G	57.8	Low	63	Low	62 Å²	62	128.5 Å²	128.5	64%	0.639	71%	0.706	S	S	*	*	S	Bend	trans	-85.8	-9.7	180	0	0	0	0	0	115.2	D115 K121	D115-G119 WeakPolarHBondContact O-CA 3.41Å; D115-G119 PolarHBondContact O-N 3.44Å; G119-K121 PolarHBondContact O-N 3.35Å
120	S	66.1	Low	64.4	Low	107 Å²	107	131.8 Å²	131.8	75%	0.748	71%	0.713	S	S	*	*			trans	-89.1	81.3	177.3	-165.5	0	0	0	0	111
121	K	51.4	Low	65.2	Low	263 Å²	263	127.7 Å²	127.7	100%	1.143	70%	0.703	S	S	*	*			trans	-143.2	0	163.9	-168.3	169.5	-175.9	-66.2	0	111.7	G119	G119-K121 PolarHBondContact O-N 3.35Å

Retrieved 121 of 121 residues in 52 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).