A0A087YD55_POEFO Loading...

Neurogenic mastermind-like N-terminal domain-containing protein

AlphaFold DB , UniProt , Accession A0A087YD55, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 122 aa.

						>A0A087YD55_POEFO|A0A087YD55
MGDFASPAVGPNGSICINNSMNPASGSVVPAGAVGIPKHSTVVERLRQRIEGCRRHHTICENRYQQAHSEQLELERRDTVSLYQRSLEQRAKKSVGGGDPDSASSTEQRNNTLIAVRTSACS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.5	Very low	50.3	Low	242 Å²	242	127 Å²	127	100%	1.192	81%	0.805	S	S	*	*				0	106	0	-74.2	83.9	172.6	0	0	107.2
2	G	51.1	Low	50.4	Low	76 Å²	76	129.8 Å²	129.8	78%	0.784	81%	0.809	S	S	*	*			trans	-90.5	127.7	179	0	0	0	0	0	110.3	F4	G2-F4 PolarHBondContact O-N 3.42Å
3	D	51.8	Low	50.3	Low	155 Å²	155	124.1 Å²	124.1	83%	0.829	79%	0.791	S	S	*	*			trans	-65.4	109.1	175.3	52.8	-62	0	0	0	111.2	A5	D3-A5 PolarHBondContact O-N 3.39Å
4	F	50	Low	50.5	Low	205 Å²	205	122.7 Å²	122.7	90%	0.899	79%	0.787	S	S	*	*			trans	-79.2	113.1	167.9	-146.7	-95.5	0	0	0	107.2	G2 S6	G2-F4 PolarHBondContact O-N 3.42Å; F4-S6 PolarHBondContact O-N 3.27Å; F4-S6 VanDerWaalsContact O-N 3.14Å
5	A	52.7	Low	51.2	Low	87 Å²	87	123.5 Å²	123.5	72%	0.719	78%	0.78	S	S	*	*	P	Polyproline II helix	trans	-48.7	119.7	177.9	0	0	0	0	0	111.1	D3	D3-A5 PolarHBondContact O-N 3.39Å
6	S	48.1	Very low	51.7	Low	111 Å²	111	123.4 Å²	123.4	78%	0.776	78%	0.783	S	S	*	*	P	Polyproline II helix	trans	-67.7	132.2	170.6	-72.5	0	0	0	0	109.4	F4 A8	F4-S6 PolarHBondContact O-N 3.27Å; F4-S6 VanDerWaalsContact O-N 3.14Å; S6-A8 PolarHBondContact O-N 3.14Å
7	P	53.9	Low	52.1	Low	122 Å²	122	124.3 Å²	124.3	79%	0.792	78%	0.779	S	S	*	*	P	Polyproline II helix	trans	-70.7	120.1	168.5	27.8	-29.8	0	0	0	108.8	V9	P7-V9 PolarHBondContact O-N 2.85Å; P7-V9 VanDerWaalsContact O-N 3.15Å
8	A	47.2	Very low	52.4	Low	101 Å²	101	125.7 Å²	125.7	84%	0.835	78%	0.78	S	S	*	*			trans	-60.8	112.7	175.3	0	0	0	0	0	110.4	S6 G10	S6-A8 PolarHBondContact O-N 3.14Å; A8-G10 PolarHBondContact O-N 3.09Å
9	V	51.8	Low	52.3	Low	127 Å²	127	126.3 Å²	126.3	77%	0.77	78%	0.777	S	S	*	*			trans	-78.2	102.2	167.6	161.5	0	0	0	0	107.9	P7	P7-V9 PolarHBondContact O-N 2.85Å; P7-V9 VanDerWaalsContact O-N 3.15Å
10	G	48	Very low	52.4	Low	38 Å²	38	126.1 Å²	126.1	39%	0.392	78%	0.781	S	S	.	*			trans	-72.8	159.8	163.9	0	0	0	0	0	111	A8 N12 G13	A8-G10 PolarHBondContact O-N 3.09Å; G10-N12 PolarHBondContact O-N 3.28Å; G10-G13 PolarHBondContact O-N 3.43Å
11	P	51.3	Low	52.5	Low	133 Å²	133	128.4 Å²	128.4	86%	0.864	79%	0.785	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.7	19.4	-172	30.8	-32.6	0	0	0	114.4
12	N	52	Low	52.7	Low	161 Å²	161	122.6 Å²	122.6	86%	0.861	76%	0.759	S	S	*	*	T	Hydrogen-bonded Turn	trans	-133.9	45.9	169.7	-73.2	-76.3	0	0	0	109.4	G10 S14	G10-N12 PolarHBondContact O-N 3.28Å; N12-S14 PolarHBondContact O-N 3.05Å
13	G	48.8	Very low	52.6	Low	55 Å²	55	125.5 Å²	125.5	57%	0.567	76%	0.764	S	S	*	*			trans	-72.6	82.1	-174.1	0	0	0	0	0	113.4	G10 I15	G10-G13 PolarHBondContact O-N 3.43Å; G13-I15 PolarHBondContact O-N 2.89Å
14	S	53.4	Low	52.7	Low	105 Å²	105	121.1 Å²	121.1	73%	0.734	75%	0.749	S	S	*	*			trans	-81.1	100.1	158.6	-175.8	0	0	0	0	108.4	N12 C16	N12-S14 PolarHBondContact O-N 3.05Å; S14-C16 PolarHBondContact O-N 3.43Å
15	I	61.1	Low	52.8	Low	134 Å²	134	117.8 Å²	117.8	69%	0.687	75%	0.752	S	S	*	*			trans	-66.3	97.8	167.3	-66	167.6	0	0	0	106.8	G13 I17	G13-I15 PolarHBondContact O-N 2.89Å; I15-I17 HydrophobicContact CG2-CB 3.9Å; I15-I17 HydrophobicContact CG2-CD1 4.34Å; I15-I17 HydrophobicContact CG2-CG1 3.99Å; I15-I17 PolarHBondContact O-N 3.32Å; I15-I17 VanDerWaalsContact O-N 3.07Å
16	C	59.1	Low	52.3	Low	122 Å²	122	117.2 Å²	117.2	82%	0.824	75%	0.754	S	S	*	*			trans	-83.8	64.6	168.9	50.5	0	0	0	0	110.1	S14	S14-C16 PolarHBondContact O-N 3.43Å
17	I	58.1	Low	52.5	Low	139 Å²	139	117.4 Å²	117.4	71%	0.713	76%	0.755	S	S	*	*			trans	-117.9	104	167.8	-59.8	-177	0	0	0	108.3	I15	I15-I17 HydrophobicContact CG2-CB 3.9Å; I15-I17 HydrophobicContact CG2-CD1 4.34Å; I15-I17 HydrophobicContact CG2-CG1 3.99Å; I15-I17 PolarHBondContact O-N 3.32Å; I15-I17 VanDerWaalsContact O-N 3.07Å
18	N	57.4	Low	52.2	Low	149 Å²	149	118.1 Å²	118.1	80%	0.797	76%	0.757	S	S	*	*			trans	68	95	141.2	-157.2	5.6	0	0	0	119
19	N	51.2	Low	52.3	Low	138 Å²	138	118.9 Å²	118.9	74%	0.738	75%	0.751	S	S	*	*			trans	-166.7	73.7	132.5	-164.7	34.8	0	0	0	111.1	M21	N19-M21 PolarHBondContact O-N 3.32Å
20	S	53.3	Low	51.9	Low	122 Å²	122	118.2 Å²	118.2	85%	0.853	75%	0.749	S	S	*	*			trans	-94	66.2	172.9	-74.8	0	0	0	0	111.7
21	M	54.4	Low	52	Low	174 Å²	174	121.9 Å²	121.9	86%	0.857	78%	0.776	S	S	*	*			trans	-124.4	81.4	145.2	-81	-70.3	-177.8	0	0	107.4	N19	N19-M21 PolarHBondContact O-N 3.32Å
22	N	52.6	Low	51.9	Low	120 Å²	120	118.8 Å²	118.8	64%	0.642	77%	0.768	S	S	*	*			trans	-141	109.7	161.9	-171.3	10.9	0	0	0	108.6	A24	N22-A24 PolarHBondContact O-N 2.78Å; N22-A24 VanDerWaalsContact O-N 3.15Å; N22-A24 WeakPolarHBondContact OD1-CB 3.24Å; N22-A24 PolarHBondContact OD1-N 3.48Å
23	P	49.1	Very low	51.9	Low	137 Å²	137	114.5 Å²	114.5	89%	0.89	76%	0.755	S	S	*	*			trans	-84.1	72.4	164.6	34.9	-30.1	0	0	0	108.3
24	A	52.7	Low	51.9	Low	64 Å²	64	119.1 Å²	119.1	53%	0.529	77%	0.772	S	S	.	*			trans	-131.6	118.8	167.2	0	0	0	0	0	109	N22	N22-A24 PolarHBondContact O-N 2.78Å; N22-A24 VanDerWaalsContact O-N 3.15Å; N22-A24 WeakPolarHBondContact OD1-CB 3.24Å; N22-A24 PolarHBondContact OD1-N 3.48Å
25	S	53.5	Low	51.9	Low	135 Å²	135	117.3 Å²	117.3	94%	0.944	77%	0.77	S	S	*	*	S	Bend	trans	75.7	77.8	176.5	-78.1	0	0	0	0	117.9
26	G	41.3	Very low	51.6	Low	74 Å²	74	115.3 Å²	115.3	76%	0.763	76%	0.76	S	S	*	*			trans	-149	59.4	155.7	0	0	0	0	0	108.8	V28	G26-V28 PolarHBondContact O-N 2.85Å
27	S	53	Low	51.7	Low	115 Å²	115	114 Å²	114	80%	0.804	75%	0.749	S	S	*	*			trans	-67.2	90.7	-179.2	173.2	0	0	0	0	111
28	V	47.4	Very low	52	Low	137 Å²	137	116.3 Å²	116.3	83%	0.83	75%	0.754	S	S	*	*			trans	-138.8	61.9	149.1	-71.6	0	0	0	0	109.1	G26	G26-V28 PolarHBondContact O-N 2.85Å
29	V	48.7	Very low	52.8	Low	118 Å²	118	116.1 Å²	116.1	72%	0.715	75%	0.749	S	S	*	*			trans	-76.8	124.7	161	-174.4	0	0	0	0	106	A31	V29-A31 PolarHBondContact O-N 3.31Å
30	P	44.1	Very low	54.2	Low	112 Å²	112	112 Å²	112	73%	0.727	73%	0.73	S	S	*	*			trans	-58.7	133.9	173.6	24.8	-30.6	0	0	0	108.4	G32	P30-G32 PolarHBondContact O-N 3.17Å
31	A	49.6	Very low	55.9	Low	115 Å²	115	109.1 Å²	109.1	95%	0.95	71%	0.708	S	S	*	*	S	Bend	trans	-51.5	103.6	174.4	0	0	0	0	0	109.7	V29	V29-A31 PolarHBondContact O-N 3.31Å
32	G	48.3	Very low	57.7	Low	69 Å²	69	105.4 Å²	105.4	71%	0.711	70%	0.695	S	S	*	*			trans	-177.2	9.9	-177.7	0	0	0	0	0	116.2	P30	P30-G32 PolarHBondContact O-N 3.17Å
33	A	52.5	Low	59.8	Low	70 Å²	70	101.4 Å²	101.4	58%	0.579	67%	0.674	S	S	*	*			trans	-101.7	44.9	177.5	0	0	0	0	0	112	G35 I36	A33-G35 PolarHBondContact O-N 3.15Å; A33-I36 HydrophobicContact CB-CD1 4.31Å
34	V	49.5	Very low	61.9	Low	153 Å²	153	99.1 Å²	99.1	93%	0.927	65%	0.652	S	S	*	*	S	Bend	trans	-83.4	96.8	163.5	-179.6	0	0	0	0	106.5
35	G	53.3	Low	63.9	Low	67 Å²	67	104.5 Å²	104.5	69%	0.691	66%	0.658	S	S	*	*			trans	101.9	50.4	167.8	0	0	0	0	0	116.7	A33 P37	A33-G35 PolarHBondContact O-N 3.15Å; G35-P37 VanDerWaalsContact O-CD 3.24Å; G35-P37 WeakPolarHBondContact O-CD 3.35Å
36	I	54.5	Low	65.9	Low	91 Å²	91	102.1 Å²	102.1	47%	0.467	64%	0.635	S	S	.	*			trans	-80.2	112.1	163.3	-57.9	-172.5	0	0	0	107.9	A33 K38 S40	A33-I36 HydrophobicContact CB-CD1 4.31Å; I36-K38 PolarHBondContact O-N 3.37Å; I36-S40 WeakPolarHBondContact CG2-OG 3.44Å
37	P	62.1	Low	68.5	Low	94 Å²	94	105 Å²	105	61%	0.61	62%	0.622	S	S	*	*			trans	-56.3	133.2	174.2	-19.3	32	0	0	0	108.2	G35 H39 S40	G35-P37 VanDerWaalsContact O-CD 3.24Å; G35-P37 WeakPolarHBondContact O-CD 3.35Å; P37-H39 CarbonylContact O-C 3.56Å; P37-H39 PolarHBondContact O-N 2.95Å; P37-S40 WeakPolarHBondContact O-CB 3.46Å; P37-S40 PolarHBondContact O-N 2.97Å
38	K	62.8	Low	70.6	Confident	188 Å²	188	105.4 Å²	105.4	82%	0.817	61%	0.612	S	S	*	*	H	α-helix	trans	-43.9	-35.1	-174.1	-65.9	174.5	180	173.7	0	114.1	I36 S40 T41 V42	I36-K38 PolarHBondContact O-N 3.37Å; K38-S40 VanDerWaalsContact C-N 3.35Å; K38-S40 PolarHBondContact O-N 3.48Å; K38-T41 PolarHBondContact O-N 2.93Å; K38-V42 PolarHBondContact O-N 3.46Å
39	H	74.7	Confident	73	Confident	146 Å²	146	107.3 Å²	107.3	68%	0.676	60%	0.604	S	S	*	*	H	α-helix	trans	-55.2	-43.9	173.7	-175.1	-99	0	0	0	113.2	P37 T41 V42 V43	P37-H39 CarbonylContact O-C 3.56Å; P37-H39 PolarHBondContact O-N 2.95Å; H39-T41 PolarHBondContact O-N 3.48Å; H39-V42 PolarHBondContact O-N 2.97Å; H39-V43 VanDerWaalsContact O-CG2 3.26Å; H39-V43 WeakPolarHBondContact O-CG2 3.46Å; H39-V43 PolarHBondContact O-N 3.32Å
40	S	81.4	Confident	75.4	Confident	51 Å²	51	105 Å²	105	36%	0.357	59%	0.587	S	S	.	*	H	α-helix	trans	-64.1	-38.2	179.4	174.4	0	0	0	0	112.6	I36 P37 K38 V42 V43 E44	I36-S40 WeakPolarHBondContact CG2-OG 3.44Å; P37-S40 WeakPolarHBondContact O-CB 3.46Å; P37-S40 PolarHBondContact O-N 2.97Å; K38-S40 VanDerWaalsContact C-N 3.35Å; K38-S40 PolarHBondContact O-N 3.48Å; S40-V42 PolarHBondContact O-N 3.22Å; S40-V43 PolarHBondContact O-N 2.77Å; S40-E44 WeakPolarHBondContact O-CB 3.32Å; S40-E44 PolarHBondContact O-N 2.97Å
41	T	88.5	Confident	78	Confident	62 Å²	62	103.9 Å²	103.9	38%	0.38	57%	0.572	S	S	.	*	H	α-helix	trans	-65.2	-39.2	173.3	-54.5	0	0	0	0	112.7	K38 H39 E44 R45	K38-T41 PolarHBondContact O-N 2.93Å; H39-T41 PolarHBondContact O-N 3.48Å; T41-E44 PolarHBondContact O-N 3.45Å; T41-R45 WeakPolarHBondContact O-CG 3.36Å; T41-R45 PolarHBondContact O-N 2.99Å
42	V	92.6	Very high	80.3	Confident	96 Å²	96	99.6 Å²	99.6	58%	0.582	54%	0.54	S	S	*	.	H	α-helix	trans	-66.2	-44.9	176.7	173.2	0	0	0	0	110.6	K38 H39 S40 E44 R45 L46	K38-V42 PolarHBondContact O-N 3.46Å; H39-V42 PolarHBondContact O-N 2.97Å; S40-V42 PolarHBondContact O-N 3.22Å; V42-E44 VanDerWaalsContact C-N 3.3Å; V42-E44 PolarHBondContact O-N 3.48Å; V42-R45 PolarHBondContact O-N 3.5Å; V42-L46 WeakPolarHBondContact O-CB 3.3Å; V42-L46 PolarHBondContact O-N 2.93Å
43	V	95.4	Very high	82.6	Confident	35 Å²	35	100.4 Å²	100.4	21%	0.212	53%	0.533	C	S	.	.	H	α-helix	trans	-63	-39.5	177.1	179.4	0	0	0	0	110.5	H39 S40 L46 R47	H39-V43 VanDerWaalsContact O-CG2 3.26Å; H39-V43 WeakPolarHBondContact O-CG2 3.46Å; H39-V43 PolarHBondContact O-N 3.32Å; S40-V43 PolarHBondContact O-N 2.77Å; V43-L46 WeakPolarHBondContact O-CB 3.39Å; V43-L46 PolarHBondContact O-N 3.38Å; V43-R47 WeakPolarHBondContact O-CG 3.47Å; V43-R47 PolarHBondContact O-N 3.22Å
44	E	94.2	Very high	84.8	Confident	89 Å²	89	104.4 Å²	104.4	42%	0.416	53%	0.533	S	S	.	.	H	α-helix	trans	-66.2	-42.5	178.1	-164.4	53.8	-145.2	0	0	112.5	S40 T41 V42 L46 R47 Q48	S40-E44 WeakPolarHBondContact O-CB 3.32Å; S40-E44 PolarHBondContact O-N 2.97Å; T41-E44 PolarHBondContact O-N 3.45Å; V42-E44 VanDerWaalsContact C-N 3.3Å; V42-E44 PolarHBondContact O-N 3.48Å; E44-L46 VanDerWaalsContact C-N 3.29Å; E44-L46 PolarHBondContact O-N 2.89Å; E44-R47 PolarHBondContact O-N 2.99Å; E44-R47 IonicContact OE2-CZ 3.34Å; E44-R47 IonicContact OE2-NH1 3.94Å; E44-R47 PolarHBondContact OE2-NH1 3.16Å; E44-Q48 WeakPolarHBondContact O-CG 3.45Å; E44-Q48 PolarHBondContact O-N 3.43Å
45	R	93.8	Very high	87.1	Confident	177 Å²	177	104.8 Å²	104.8	67%	0.668	52%	0.518	S	S	*	.	H	α-helix	trans	-60.6	-39.2	170.7	-73.6	-178.7	-174.1	-117.1	2.6	112	T41 V42 Q48 R49	T41-R45 WeakPolarHBondContact O-CG 3.36Å; T41-R45 PolarHBondContact O-N 2.99Å; V42-R45 PolarHBondContact O-N 3.5Å; R45-Q48 PolarHBondContact O-N 3.47Å; R45-R49 WeakPolarHBondContact O-CG 3.47Å; R45-R49 PolarHBondContact O-N 2.89Å
46	L	96.7	Very high	89.3	Confident	85 Å²	85	107.5 Å²	107.5	45%	0.445	51%	0.512	S	S	.	.	H	α-helix	trans	-64.1	-43.8	176.5	178.6	61.5	0	0	0	111.3	V42 V43 E44 Q48 R49 I50	V42-L46 WeakPolarHBondContact O-CB 3.3Å; V42-L46 PolarHBondContact O-N 2.93Å; V43-L46 WeakPolarHBondContact O-CB 3.39Å; V43-L46 PolarHBondContact O-N 3.38Å; E44-L46 VanDerWaalsContact C-N 3.29Å; E44-L46 PolarHBondContact O-N 2.89Å; L46-Q48 VanDerWaalsContact C-N 3.34Å; L46-Q48 PolarHBondContact O-N 3.05Å; L46-R49 PolarHBondContact O-N 2.96Å; L46-I50 HydrophobicContact CD1-CD1 4.15Å; L46-I50 HydrophobicContact CD1-CG1 4.29Å; L46-I50 HydrophobicContact CG-CD1 3.92Å; L46-I50 HydrophobicContact CG-CG1 4.49Å; L46-I50 WeakPolarHBondContact O-CG1 3.49Å; L46-I50 PolarHBondContact O-N 3.08Å
47	R	96.3	Very high	91.4	Very high	134 Å²	134	108.7 Å²	108.7	51%	0.506	52%	0.516	S	S	.	.	H	α-helix	trans	-57.9	-46.8	174.5	-72.4	-177.3	-172.6	109.8	3.5	111.4	V43 E44 R49 I50 E51	V43-R47 WeakPolarHBondContact O-CG 3.47Å; V43-R47 PolarHBondContact O-N 3.22Å; E44-R47 PolarHBondContact O-N 2.99Å; E44-R47 IonicContact OE2-CZ 3.34Å; E44-R47 IonicContact OE2-NH1 3.94Å; E44-R47 PolarHBondContact OE2-NH1 3.16Å; R47-R49 VanDerWaalsContact C-N 3.29Å; R47-R49 PolarHBondContact O-N 3.4Å; R47-I50 PolarHBondContact O-N 3.03Å; R47-E51 WeakPolarHBondContact O-CB 3.45Å; R47-E51 PolarHBondContact O-N 3.13Å
48	Q	97	Very high	93.1	Very high	124 Å²	124	108.3 Å²	108.3	58%	0.579	51%	0.512	S	S	*	.	H	α-helix	trans	-59.9	-39.5	176.8	-70.4	177.2	5.1	0	0	112.3	E44 R45 L46 G52	E44-Q48 WeakPolarHBondContact O-CG 3.45Å; E44-Q48 PolarHBondContact O-N 3.43Å; R45-Q48 PolarHBondContact O-N 3.47Å; L46-Q48 VanDerWaalsContact C-N 3.34Å; L46-Q48 PolarHBondContact O-N 3.05Å; Q48-G52 PolarHBondContact O-N 3.45Å
49	R	97.6	Very high	94.8	Very high	177 Å²	177	104.2 Å²	104.2	67%	0.668	50%	0.498	S	S	*	.	H	α-helix	trans	-66.5	-46.2	175.4	-71.8	-179	72.2	-119.8	0.1	112.1	R45 L46 R47 E51 G52 C53	R45-R49 WeakPolarHBondContact O-CG 3.47Å; R45-R49 PolarHBondContact O-N 2.89Å; L46-R49 PolarHBondContact O-N 2.96Å; R47-R49 VanDerWaalsContact C-N 3.29Å; R47-R49 PolarHBondContact O-N 3.4Å; R49-E51 VanDerWaalsContact C-N 3.32Å; R49-E51 PolarHBondContact O-N 2.88Å; R49-G52 PolarHBondContact O-N 3.35Å; R49-C53 PolarHBondContact O-N 3.18Å; R49-C53 PolarHBondContact O-SG 3.25Å; R49-C53 VanDerWaalsContact O-SG 3.35Å
50	I	98.1	Very high	95.8	Very high	71 Å²	71	99.6 Å²	99.6	36%	0.364	48%	0.482	S	S	.	.	H	α-helix	trans	-59.3	-46.7	177.5	-69.1	167.4	0	0	0	110.1	L46 R47 G52 C53 R54	L46-I50 HydrophobicContact CD1-CD1 4.15Å; L46-I50 HydrophobicContact CD1-CG1 4.29Å; L46-I50 HydrophobicContact CG-CD1 3.92Å; L46-I50 HydrophobicContact CG-CG1 4.49Å; L46-I50 WeakPolarHBondContact O-CG1 3.49Å; L46-I50 PolarHBondContact O-N 3.08Å; R47-I50 PolarHBondContact O-N 3.03Å; I50-G52 VanDerWaalsContact C-N 3.31Å; I50-G52 PolarHBondContact O-N 3.04Å; I50-C53 WeakPolarHBondContact O-CB 3.46Å; I50-C53 PolarHBondContact O-N 2.86Å; I50-R54 WeakPolarHBondContact O-CG 3.28Å; I50-R54 PolarHBondContact O-N 3.31Å
51	E	98.3	Very high	96.6	Very high	87 Å²	87	101.3 Å²	101.3	41%	0.407	48%	0.484	S	S	.	.	H	α-helix	trans	-69.6	-31.6	179.9	-161.3	53.3	-136.5	0	0	112.2	R47 R49 R54 R55	R47-E51 WeakPolarHBondContact O-CB 3.45Å; R47-E51 PolarHBondContact O-N 3.13Å; R49-E51 VanDerWaalsContact C-N 3.32Å; R49-E51 PolarHBondContact O-N 2.88Å; E51-R54 PolarHBondContact O-N 3.1Å; E51-R54 WeakPolarHBondContact OE2-CD 3.36Å; E51-R54 IonicContact OE2-NH1 3.92Å; E51-R54 PolarHBondContact OE2-NH1 2.92Å; E51-R55 WeakPolarHBondContact O-CG 3.39Å; E51-R55 PolarHBondContact O-N 3.13Å
52	G	98.1	Very high	97	Very high	26 Å²	26	102.1 Å²	102.1	27%	0.268	49%	0.486	S	S	.	.	H	α-helix	trans	-59.8	-48	168.5	0	0	0	0	0	112.2	Q48 R49 I50 R54 R55 H56	Q48-G52 PolarHBondContact O-N 3.45Å; R49-G52 PolarHBondContact O-N 3.35Å; I50-G52 VanDerWaalsContact C-N 3.31Å; I50-G52 PolarHBondContact O-N 3.04Å; G52-R54 VanDerWaalsContact C-N 3.35Å; G52-R54 PolarHBondContact O-N 3.07Å; G52-R55 PolarHBondContact O-N 2.73Å; G52-H56 WeakPolarHBondContact O-CB 3.35Å; G52-H56 PolarHBondContact O-N 3.38Å
53	C	98.3	Very high	97.1	Very high	86 Å²	86	105.8 Å²	105.8	58%	0.581	49%	0.489	S	S	*	.	H	α-helix	trans	-62.3	-40.9	176.4	-66.6	0	0	0	0	112.1	R49 I50 H56 H57	R49-C53 PolarHBondContact O-N 3.18Å; R49-C53 PolarHBondContact O-SG 3.25Å; R49-C53 VanDerWaalsContact O-SG 3.35Å; I50-C53 WeakPolarHBondContact O-CB 3.46Å; I50-C53 PolarHBondContact O-N 2.86Å; C53-H56 PolarHBondContact O-N 3.48Å; C53-H57 WeakPolarHBondContact O-CB 3.44Å; C53-H57 PolarHBondContact O-N 3.44Å
54	R	98.4	Very high	97.2	Very high	153 Å²	153	111.6 Å²	111.6	58%	0.577	51%	0.508	S	S	*	.	H	α-helix	trans	-62.2	-51.8	177.2	-75.2	176.3	173.8	154.5	-2.9	112.1	I50 E51 G52 H56 H57 T58	I50-R54 WeakPolarHBondContact O-CG 3.28Å; I50-R54 PolarHBondContact O-N 3.31Å; E51-R54 PolarHBondContact O-N 3.1Å; E51-R54 WeakPolarHBondContact OE2-CD 3.36Å; E51-R54 IonicContact OE2-NH1 3.92Å; E51-R54 PolarHBondContact OE2-NH1 2.92Å; G52-R54 VanDerWaalsContact C-N 3.35Å; G52-R54 PolarHBondContact O-N 3.07Å; R54-H56 VanDerWaalsContact C-N 3.29Å; R54-H56 PolarHBondContact O-N 3.49Å; R54-H57 PolarHBondContact O-N 2.97Å; R54-T58 PolarHBondContact O-N 3.43Å; R54-T58 VanDerWaalsContact O-N 3.11Å; R54-T58 PolarHBondContact O-OG1 3.42Å
55	R	98.2	Very high	97.2	Very high	162 Å²	162	112.5 Å²	112.5	61%	0.611	51%	0.513	S	S	*	.	H	α-helix	trans	-59.1	-42.6	176.8	-75.1	-171.3	-67	142.1	-3.6	111.8	E51 G52 T58 I59	E51-R55 WeakPolarHBondContact O-CG 3.39Å; E51-R55 PolarHBondContact O-N 3.13Å; G52-R55 PolarHBondContact O-N 2.73Å; R55-T58 PolarHBondContact O-N 3.33Å; R55-I59 WeakPolarHBondContact O-CD1 3.44Å; R55-I59 VanDerWaalsContact O-CG1 3.25Å; R55-I59 WeakPolarHBondContact O-CG1 3.29Å; R55-I59 PolarHBondContact O-N 3.49Å; R55-I59 VanDerWaalsContact O-N 3.1Å
56	H	98.5	Very high	97.2	Very high	123 Å²	123	110 Å²	110	57%	0.569	51%	0.509	S	S	*	.	H	α-helix	trans	-60.7	-46	177.4	-179.9	70	0	0	0	111.9	G52 C53 R54 T58 I59 C60	G52-H56 WeakPolarHBondContact O-CB 3.35Å; G52-H56 PolarHBondContact O-N 3.38Å; C53-H56 PolarHBondContact O-N 3.48Å; R54-H56 VanDerWaalsContact C-N 3.29Å; R54-H56 PolarHBondContact O-N 3.49Å; H56-T58 PolarHBondContact O-N 3.05Å; H56-I59 PolarHBondContact O-N 3.28Å; H56-C60 PolarHBondContact CE1-SG 3.39Å; H56-C60 PolarHBondContact NE2-SG 2.92Å; H56-C60 VanDerWaalsContact NE2-SG 3.36Å; H56-C60 WeakPolarHBondContact O-CB 3.35Å; H56-C60 PolarHBondContact O-N 3.47Å; H56-C60 PolarHBondContact O-SG 2.77Å; H56-C60 VanDerWaalsContact O-SG 3.4Å
57	H	98.3	Very high	97.1	Very high	117 Å²	117	108.2 Å²	108.2	54%	0.542	51%	0.506	S	S	.	.	H	α-helix	trans	-57.3	-51.2	178	177.9	66.4	0	0	0	111.6	C53 R54 I59 C60 E61	C53-H57 WeakPolarHBondContact O-CB 3.44Å; C53-H57 PolarHBondContact O-N 3.44Å; R54-H57 PolarHBondContact O-N 2.97Å; H57-I59 VanDerWaalsContact C-N 3.31Å; H57-I59 PolarHBondContact O-N 3.48Å; H57-C60 PolarHBondContact O-N 3.35Å; H57-E61 IonicContact NE2-OE2 2.92Å; H57-E61 VanDerWaalsContact O-CB 3.31Å; H57-E61 WeakPolarHBondContact O-CB 3.31Å; H57-E61 PolarHBondContact O-N 2.96Å
58	T	97.8	Very high	97	Very high	86 Å²	86	105.9 Å²	105.9	53%	0.528	50%	0.501	S	S	.	.	H	α-helix	trans	-58.8	-41.5	179.1	-56.3	0	0	0	0	112.4	R54 R55 H56 N62	R54-T58 PolarHBondContact O-N 3.43Å; R54-T58 VanDerWaalsContact O-N 3.11Å; R54-T58 PolarHBondContact O-OG1 3.42Å; R55-T58 PolarHBondContact O-N 3.33Å; H56-T58 PolarHBondContact O-N 3.05Å; T58-N62 VanDerWaalsContact O-CB 3.25Å; T58-N62 WeakPolarHBondContact O-CB 3.4Å; T58-N62 PolarHBondContact O-N 2.88Å
59	I	97.8	Very high	96.4	Very high	102 Å²	102	103.3 Å²	103.3	52%	0.523	50%	0.496	S	S	.	.	H	α-helix	trans	-66.8	-45.8	178.5	-66.8	163.8	0	0	0	110.8	R55 H56 H57 N62 R63	R55-I59 WeakPolarHBondContact O-CD1 3.44Å; R55-I59 VanDerWaalsContact O-CG1 3.25Å; R55-I59 WeakPolarHBondContact O-CG1 3.29Å; R55-I59 PolarHBondContact O-N 3.49Å; R55-I59 VanDerWaalsContact O-N 3.1Å; H56-I59 PolarHBondContact O-N 3.28Å; H57-I59 VanDerWaalsContact C-N 3.31Å; H57-I59 PolarHBondContact O-N 3.48Å; I59-N62 PolarHBondContact O-N 3.34Å; I59-R63 WeakPolarHBondContact O-CB 3.38Å; I59-R63 VanDerWaalsContact O-CG 3.32Å; I59-R63 WeakPolarHBondContact O-CG 3.42Å; I59-R63 PolarHBondContact O-N 2.93Å
60	C	97.5	Very high	95.9	Very high	49 Å²	49	101.1 Å²	101.1	33%	0.331	49%	0.494	S	S	.	.	H	α-helix	trans	-64.4	-43.4	179.5	-75	0	0	0	0	111.8	H56 H57 R63 Y64	H56-C60 PolarHBondContact CE1-SG 3.39Å; H56-C60 PolarHBondContact NE2-SG 2.92Å; H56-C60 VanDerWaalsContact NE2-SG 3.36Å; H56-C60 WeakPolarHBondContact O-CB 3.35Å; H56-C60 PolarHBondContact O-N 3.47Å; H56-C60 PolarHBondContact O-SG 2.77Å; H56-C60 VanDerWaalsContact O-SG 3.4Å; H57-C60 PolarHBondContact O-N 3.35Å; C60-R63 PolarHBondContact O-N 3.24Å; C60-Y64 WeakPolarHBondContact O-CB 3.35Å; C60-Y64 PolarHBondContact O-N 2.96Å
61	E	97.1	Very high	95.7	Very high	87 Å²	87	103.8 Å²	103.8	41%	0.407	51%	0.505	S	S	.	.	H	α-helix	trans	-62.1	-46.7	176.2	179.5	176.2	-147.1	0	0	111.3	H57 R63 Y64 Q65	H57-E61 IonicContact NE2-OE2 2.92Å; H57-E61 VanDerWaalsContact O-CB 3.31Å; H57-E61 WeakPolarHBondContact O-CB 3.31Å; H57-E61 PolarHBondContact O-N 2.96Å; E61-R63 VanDerWaalsContact C-N 3.35Å; E61-R63 PolarHBondContact O-N 3.13Å; E61-Y64 WeakPolarHBondContact O-CB 3.39Å; E61-Y64 PolarHBondContact O-N 3.4Å; E61-Q65 HydrophobicContact CG-CG 4.4Å; E61-Q65 VanDerWaalsContact CG-NE2 3.29Å; E61-Q65 WeakPolarHBondContact O-CG 3.27Å; E61-Q65 PolarHBondContact O-N 3.06Å; E61-Q65 PolarHBondContact OE1-NE2 3.14Å
62	N	96.4	Very high	95.5	Very high	78 Å²	78	104.1 Å²	104.1	42%	0.417	51%	0.509	S	S	.	.	H	α-helix	trans	-61.7	-43.1	178.9	-174.8	-102.3	0	0	0	112	T58 I59 Y64 Q65 Q66	T58-N62 VanDerWaalsContact O-CB 3.25Å; T58-N62 WeakPolarHBondContact O-CB 3.4Å; T58-N62 PolarHBondContact O-N 2.88Å; I59-N62 PolarHBondContact O-N 3.34Å; N62-Y64 VanDerWaalsContact C-N 3.35Å; N62-Y64 PolarHBondContact O-N 3.1Å; N62-Q65 PolarHBondContact O-N 3.36Å; N62-Q66 WeakPolarHBondContact O-CB 3.45Å; N62-Q66 VanDerWaalsContact O-CG 3.27Å; N62-Q66 WeakPolarHBondContact O-CG 3.29Å; N62-Q66 PolarHBondContact O-N 2.96Å; N62-Q66 PolarHBondContact OD1-NE2 3.12Å
63	R	96	Very high	95.3	Very high	174 Å²	174	108.1 Å²	108.1	66%	0.657	52%	0.52	S	S	*	.	H	α-helix	trans	-62.1	-42.3	174.6	-74	178.9	66.4	-164.4	-0.6	112.1	I59 C60 E61 A67	I59-R63 WeakPolarHBondContact O-CB 3.38Å; I59-R63 VanDerWaalsContact O-CG 3.32Å; I59-R63 WeakPolarHBondContact O-CG 3.42Å; I59-R63 PolarHBondContact O-N 2.93Å; C60-R63 PolarHBondContact O-N 3.24Å; E61-R63 VanDerWaalsContact C-N 3.35Å; E61-R63 PolarHBondContact O-N 3.13Å; R63-A67 WeakPolarHBondContact O-CB 3.32Å; R63-A67 PolarHBondContact O-N 3.26Å; R63-A67 VanDerWaalsContact O-N 3.12Å
64	Y	96.4	Very high	95.1	Very high	156 Å²	156	108.1 Å²	108.1	61%	0.612	51%	0.514	S	S	*	.	H	α-helix	trans	-60.9	-51.6	175.8	179	-95.4	0	0	0	110.6	C60 E61 N62 Q66 A67 H68	C60-Y64 WeakPolarHBondContact O-CB 3.35Å; C60-Y64 PolarHBondContact O-N 2.96Å; E61-Y64 WeakPolarHBondContact O-CB 3.39Å; E61-Y64 PolarHBondContact O-N 3.4Å; N62-Y64 VanDerWaalsContact C-N 3.35Å; N62-Y64 PolarHBondContact O-N 3.1Å; Y64-Q66 PolarHBondContact O-N 3.42Å; Y64-A67 PolarHBondContact O-N 3.44Å; Y64-H68 HydrophobicContact CE1-CB 4.4Å; Y64-H68 AromaticContact CE1-CD2 3.81Å; Y64-H68 AromaticContact CZ-CD2 3.71Å; Y64-H68 WeakPolarHBondContact O-CB 3.38Å; Y64-H68 PolarHBondContact O-N 3.03Å; Y64-H68 PolarHBondContact OH-CD2 3.5Å
65	Q	95.4	Very high	95	Very high	108 Å²	108	106.5 Å²	106.5	51%	0.505	51%	0.513	S	S	.	.	H	α-helix	trans	-61.7	-40.3	-179.1	-70.4	179.1	17.9	0	0	112.8	E61 N62 H68	E61-Q65 HydrophobicContact CG-CG 4.4Å; E61-Q65 VanDerWaalsContact CG-NE2 3.29Å; E61-Q65 WeakPolarHBondContact O-CG 3.27Å; E61-Q65 PolarHBondContact O-N 3.06Å; E61-Q65 PolarHBondContact OE1-NE2 3.14Å; N62-Q65 PolarHBondContact O-N 3.36Å; Q65-H68 PolarHBondContact O-N 3.24Å
66	Q	93.7	Very high	95	Very high	125 Å²	125	107.4 Å²	107.4	58%	0.584	52%	0.517	S	S	*	.	H	α-helix	trans	-62.8	-44.2	176.8	-77.2	176.7	-0.1	0	0	112.4	N62 Y64 S69	N62-Q66 WeakPolarHBondContact O-CB 3.45Å; N62-Q66 VanDerWaalsContact O-CG 3.27Å; N62-Q66 WeakPolarHBondContact O-CG 3.29Å; N62-Q66 PolarHBondContact O-N 2.96Å; N62-Q66 PolarHBondContact OD1-NE2 3.12Å; Y64-Q66 PolarHBondContact O-N 3.42Å; Q66-S69 PolarHBondContact O-OG 2.9Å
67	A	93.5	Very high	94.9	Very high	47 Å²	47	109 Å²	109	39%	0.388	52%	0.518	S	S	.	.	H	α-helix	trans	-75.6	-26.2	178.1	0	0	0	0	0	112.5	R63 Y64 S69 E70 Q71	R63-A67 WeakPolarHBondContact O-CB 3.32Å; R63-A67 PolarHBondContact O-N 3.26Å; R63-A67 VanDerWaalsContact O-N 3.12Å; Y64-A67 PolarHBondContact O-N 3.44Å; A67-S69 PolarHBondContact O-N 3Å; A67-E70 PolarHBondContact O-N 3.43Å; A67-Q71 VanDerWaalsContact O-CB 3.29Å; A67-Q71 WeakPolarHBondContact O-CB 3.49Å; A67-Q71 PolarHBondContact O-N 3.37Å
68	H	93.9	Very high	94.8	Very high	86 Å²	86	108.3 Å²	108.3	40%	0.398	52%	0.518	S	S	.	.	H	α-helix	trans	-64.9	-38.1	-174	-175.8	-89	0	0	0	113	Y64 Q65 Q71 L72	Y64-H68 HydrophobicContact CE1-CB 4.4Å; Y64-H68 AromaticContact CE1-CD2 3.81Å; Y64-H68 AromaticContact CZ-CD2 3.71Å; Y64-H68 WeakPolarHBondContact O-CB 3.38Å; Y64-H68 PolarHBondContact O-N 3.03Å; Y64-H68 PolarHBondContact OH-CD2 3.5Å; Q65-H68 PolarHBondContact O-N 3.24Å; H68-Q71 PolarHBondContact O-N 2.86Å; H68-L72 WeakPolarHBondContact O-CB 3.49Å; H68-L72 PolarHBondContact O-N 3.31Å
69	S	84.4	Confident	94.8	Very high	69 Å²	69	108.3 Å²	108.3	48%	0.483	52%	0.518	S	S	.	.	H	α-helix	trans	-65.4	-46.2	177.4	54.7	0	0	0	0	111.8	Q66 A67 Q71 L72 E73	Q66-S69 PolarHBondContact O-OG 2.9Å; A67-S69 PolarHBondContact O-N 3Å; S69-Q71 VanDerWaalsContact C-N 3.34Å; S69-Q71 PolarHBondContact O-N 2.83Å; S69-L72 PolarHBondContact O-N 2.92Å; S69-E73 PolarHBondContact O-N 3.38Å; S69-E73 VanDerWaalsContact O-N 3.1Å
70	E	87.7	Confident	94.7	Very high	132 Å²	132	107.6 Å²	107.6	62%	0.617	52%	0.518	S	S	*	.	H	α-helix	trans	-62.3	-42.7	176.4	-175.9	178.5	179.2	0	0	111.3	A67 L72 E73 L74	A67-E70 PolarHBondContact O-N 3.43Å; E70-L72 PolarHBondContact O-N 3.28Å; E70-E73 PolarHBondContact O-N 3.39Å; E70-L74 HydrophobicContact CG-CD1 4.47Å; E70-L74 WeakPolarHBondContact O-CG 3.17Å; E70-L74 PolarHBondContact O-N 2.98Å
71	Q	93.6	Very high	94.6	Very high	127 Å²	127	108.5 Å²	108.5	59%	0.593	53%	0.525	S	S	*	.	H	α-helix	trans	-63.3	-41.3	178	-174.9	160.2	-15.4	0	0	112.4	A67 H68 S69 E73 L74 E75	A67-Q71 VanDerWaalsContact O-CB 3.29Å; A67-Q71 WeakPolarHBondContact O-CB 3.49Å; A67-Q71 PolarHBondContact O-N 3.37Å; H68-Q71 PolarHBondContact O-N 2.86Å; S69-Q71 VanDerWaalsContact C-N 3.34Å; S69-Q71 PolarHBondContact O-N 2.83Å; Q71-E73 VanDerWaalsContact C-N 3.34Å; Q71-E73 PolarHBondContact O-N 3.42Å; Q71-L74 PolarHBondContact O-N 3.48Å; Q71-E75 PolarHBondContact O-N 3.11Å
72	L	94.6	Very high	94.5	Very high	94 Å²	94	109.5 Å²	109.5	49%	0.492	53%	0.532	S	S	.	.	H	α-helix	trans	-65	-38.2	176.6	-176	69.6	0	0	0	111.9	H68 S69 E70 E75 R76	H68-L72 WeakPolarHBondContact O-CB 3.49Å; H68-L72 PolarHBondContact O-N 3.31Å; S69-L72 PolarHBondContact O-N 2.92Å; E70-L72 PolarHBondContact O-N 3.28Å; L72-E75 PolarHBondContact O-N 3.03Å; L72-R76 PolarHBondContact O-N 3.1Å
73	E	94	Very high	94.5	Very high	110 Å²	110	112.9 Å²	112.9	51%	0.514	54%	0.54	S	S	.	.	H	α-helix	trans	-64.9	-41.5	175.9	-75	-168.8	-167.9	0	0	112.2	S69 E70 Q71 R76 R77	S69-E73 PolarHBondContact O-N 3.38Å; S69-E73 VanDerWaalsContact O-N 3.1Å; E70-E73 PolarHBondContact O-N 3.39Å; Q71-E73 VanDerWaalsContact C-N 3.34Å; Q71-E73 PolarHBondContact O-N 3.42Å; E73-R76 PolarHBondContact O-N 3.08Å; E73-R77 VanDerWaalsContact O-CG 3.28Å; E73-R77 WeakPolarHBondContact O-CG 3.25Å; E73-R77 PolarHBondContact O-N 3.46Å; E73-R77 IonicContact OE2-NH2 3.13Å; E73-R77 PolarHBondContact OE2-NH2 2.97Å; E73-R77 VanDerWaalsContact OE2-NH2 3.13Å
74	L	94.8	Very high	94.4	Very high	85 Å²	85	109 Å²	109	45%	0.445	53%	0.53	S	S	.	.	H	α-helix	trans	-61.3	-47.8	174.2	-71.3	169.4	0	0	0	111	E70 Q71 R76 R77 D78	E70-L74 HydrophobicContact CG-CD1 4.47Å; E70-L74 WeakPolarHBondContact O-CG 3.17Å; E70-L74 PolarHBondContact O-N 2.98Å; Q71-L74 PolarHBondContact O-N 3.48Å; L74-R76 VanDerWaalsContact C-N 3.32Å; L74-R76 PolarHBondContact O-N 3.46Å; L74-R77 WeakPolarHBondContact O-CB 3.4Å; L74-R77 PolarHBondContact O-N 3.44Å; L74-R77 VanDerWaalsContact O-N 3.08Å; L74-D78 PolarHBondContact O-N 3.12Å
75	E	95.8	Very high	94.3	Very high	119 Å²	119	108.7 Å²	108.7	56%	0.556	53%	0.527	S	S	*	.	H	α-helix	trans	-60.9	-39.5	178.6	-172.1	178	169	0	0	112.3	Q71 L72 D78 T79	Q71-E75 PolarHBondContact O-N 3.11Å; L72-E75 PolarHBondContact O-N 3.03Å; E75-D78 PolarHBondContact O-N 3.29Å; E75-T79 WeakPolarHBondContact O-CB 3.48Å; E75-T79 PolarHBondContact O-N 3.36Å; E75-T79 PolarHBondContact O-OG1 3.5Å
76	R	97.4	Very high	94	Very high	182 Å²	182	106.7 Å²	106.7	69%	0.687	53%	0.525	S	S	*	.	H	α-helix	trans	-60.6	-46.2	172.5	-95.6	-164.7	74.3	105.6	-0.2	111.9	L72 E73 L74 D78 T79 V80	L72-R76 PolarHBondContact O-N 3.1Å; E73-R76 PolarHBondContact O-N 3.08Å; L74-R76 VanDerWaalsContact C-N 3.32Å; L74-R76 PolarHBondContact O-N 3.46Å; R76-D78 VanDerWaalsContact C-N 3.35Å; R76-T79 PolarHBondContact O-N 2.99Å; R76-V80 WeakPolarHBondContact O-CG2 3.42Å; R76-V80 PolarHBondContact O-N 2.96Å; R76-V80 VanDerWaalsContact O-N 3.1Å
77	R	97.6	Very high	93.8	Very high	157 Å²	157	104.2 Å²	104.2	59%	0.592	52%	0.516	S	S	*	.	H	α-helix	trans	-63	-43.5	180	-70.1	171.6	-165.5	-178.9	9.8	110.8	E73 L74 V80 S81	E73-R77 VanDerWaalsContact O-CG 3.28Å; E73-R77 WeakPolarHBondContact O-CG 3.25Å; E73-R77 PolarHBondContact O-N 3.46Å; E73-R77 IonicContact OE2-NH2 3.13Å; E73-R77 PolarHBondContact OE2-NH2 2.97Å; E73-R77 VanDerWaalsContact OE2-NH2 3.13Å; L74-R77 WeakPolarHBondContact O-CB 3.4Å; L74-R77 PolarHBondContact O-N 3.44Å; L74-R77 VanDerWaalsContact O-N 3.08Å; R77-V80 PolarHBondContact O-N 3.33Å; R77-S81 WeakPolarHBondContact O-CB 3.42Å; R77-S81 PolarHBondContact O-N 3.07Å
78	D	96.1	Very high	93.6	Very high	102 Å²	102	106 Å²	106	55%	0.545	52%	0.516	S	S	.	.	H	α-helix	trans	-64	-44.8	178.5	-74.7	-8.6	0	0	0	111.8	L74 E75 R76 V80 S81 L82	L74-D78 PolarHBondContact O-N 3.12Å; E75-D78 PolarHBondContact O-N 3.29Å; R76-D78 VanDerWaalsContact C-N 3.35Å; D78-V80 VanDerWaalsContact C-N 3.34Å; D78-V80 PolarHBondContact O-N 3.1Å; D78-S81 PolarHBondContact O-N 3.33Å; D78-L82 WeakPolarHBondContact O-CG 3.38Å; D78-L82 PolarHBondContact O-N 2.91Å
79	T	96.4	Very high	93.3	Very high	85 Å²	85	107.5 Å²	107.5	52%	0.521	52%	0.523	S	S	.	.	H	α-helix	trans	-58.6	-46.3	177.3	-59.5	0	0	0	0	111.3	E75 R76 Y83	E75-T79 WeakPolarHBondContact O-CB 3.48Å; E75-T79 PolarHBondContact O-N 3.36Å; E75-T79 PolarHBondContact O-OG1 3.5Å; R76-T79 PolarHBondContact O-N 2.99Å; T79-Y83 VanDerWaalsContact O-CB 3.31Å; T79-Y83 WeakPolarHBondContact O-CB 3.25Å; T79-Y83 PolarHBondContact O-N 3.44Å
80	V	97	Very high	93.1	Very high	87 Å²	87	113.6 Å²	113.6	53%	0.527	54%	0.536	S	S	.	.	H	α-helix	trans	-65	-43.6	178.2	172.3	0	0	0	0	111.3	R76 R77 D78 L82 Y83 Q84	R76-V80 WeakPolarHBondContact O-CG2 3.42Å; R76-V80 PolarHBondContact O-N 2.96Å; R76-V80 VanDerWaalsContact O-N 3.1Å; R77-V80 PolarHBondContact O-N 3.33Å; D78-V80 VanDerWaalsContact C-N 3.34Å; D78-V80 PolarHBondContact O-N 3.1Å; V80-L82 PolarHBondContact O-N 3.2Å; V80-Y83 PolarHBondContact O-N 2.83Å; V80-Q84 WeakPolarHBondContact O-CB 3.31Å; V80-Q84 PolarHBondContact O-N 2.93Å
81	S	95.1	Very high	92.5	Very high	69 Å²	69	109.9 Å²	109.9	48%	0.483	53%	0.528	S	S	.	.	H	α-helix	trans	-60.1	-45.6	178.8	-178.3	0	0	0	0	112.2	R77 D78 Q84 R85	R77-S81 WeakPolarHBondContact O-CB 3.42Å; R77-S81 PolarHBondContact O-N 3.07Å; D78-S81 PolarHBondContact O-N 3.33Å; S81-Q84 PolarHBondContact O-N 3.22Å; S81-R85 WeakPolarHBondContact O-CB 3.35Å; S81-R85 PolarHBondContact O-N 3.24Å
82	L	95.3	Very high	91.3	Very high	107 Å²	107	110.6 Å²	110.6	56%	0.56	53%	0.529	S	S	*	.	H	α-helix	trans	-66.8	-40.4	176.9	-70.4	175.3	0	0	0	112.2	D78 V80 R85 S86	D78-L82 WeakPolarHBondContact O-CG 3.38Å; D78-L82 PolarHBondContact O-N 2.91Å; V80-L82 PolarHBondContact O-N 3.2Å; L82-R85 PolarHBondContact O-N 3.37Å; L82-S86 WeakPolarHBondContact O-CB 3.48Å; L82-S86 PolarHBondContact O-N 3.26Å; L82-S86 PolarHBondContact O-OG 3.15Å
83	Y	95.3	Very high	89.6	Confident	149 Å²	149	109.2 Å²	109.2	58%	0.584	52%	0.519	S	S	*	.	H	α-helix	trans	-61.5	-47.8	176.1	-179.3	-108.9	0	0	0	111.3	T79 V80 R85 S86 L87	T79-Y83 VanDerWaalsContact O-CB 3.31Å; T79-Y83 WeakPolarHBondContact O-CB 3.25Å; T79-Y83 PolarHBondContact O-N 3.44Å; V80-Y83 PolarHBondContact O-N 2.83Å; Y83-R85 PolarHBondContact O-N 3.07Å; Y83-S86 WeakPolarHBondContact O-CB 3.27Å; Y83-S86 PolarHBondContact O-N 3.4Å; Y83-S86 VanDerWaalsContact O-N 3.13Å; Y83-L87 HydrophobicContact CD1-CD1 4.06Å; Y83-L87 HydrophobicContact CE1-CD1 3.47Å; Y83-L87 VanDerWaalsContact CE1-CD1 3.47Å; Y83-L87 HydrophobicContact CE1-CG 4.14Å; Y83-L87 HydrophobicContact CE2-CD2 4.45Å; Y83-L87 HydrophobicContact CE2-CG 4.43Å; Y83-L87 PolarHBondContact O-N 2.97Å
84	Q	94.5	Very high	87.8	Confident	94 Å²	94	108.7 Å²	108.7	44%	0.439	53%	0.527	S	S	.	.	H	α-helix	trans	-59.8	-47.1	177.4	-178.5	59	29	0	0	111.6	V80 S81 S86 L87 E88	V80-Q84 WeakPolarHBondContact O-CB 3.31Å; V80-Q84 PolarHBondContact O-N 2.93Å; S81-Q84 PolarHBondContact O-N 3.22Å; Q84-S86 VanDerWaalsContact C-N 3.27Å; Q84-S86 PolarHBondContact O-N 3.42Å; Q84-L87 PolarHBondContact O-N 3.18Å; Q84-E88 PolarHBondContact NE2-OE1 2.96Å; Q84-E88 WeakPolarHBondContact O-CG 3.33Å; Q84-E88 PolarHBondContact O-N 3.45Å
85	R	93.4	Very high	86	Confident	149 Å²	149	110.9 Å²	110.9	56%	0.562	54%	0.544	S	S	*	.	H	α-helix	trans	-57.1	-41.2	175	-177.5	-174.2	-65.5	-128.4	-0.1	112	S81 L82 Y83 E88 Q89	S81-R85 WeakPolarHBondContact O-CB 3.35Å; S81-R85 PolarHBondContact O-N 3.24Å; L82-R85 PolarHBondContact O-N 3.37Å; Y83-R85 PolarHBondContact O-N 3.07Å; R85-E88 PolarHBondContact O-N 2.64Å; R85-Q89 WeakPolarHBondContact O-CB 3.4Å; R85-Q89 VanDerWaalsContact O-CG 3.32Å; R85-Q89 WeakPolarHBondContact O-CG 3.49Å; R85-Q89 PolarHBondContact O-N 3.49Å
86	S	89.8	Confident	84	Confident	66 Å²	66	107.5 Å²	107.5	46%	0.462	54%	0.541	S	S	.	.	H	α-helix	trans	-66.3	-41	-179.8	-57	0	0	0	0	111.5	L82 Y83 Q84 Q89 R90	L82-S86 WeakPolarHBondContact O-CB 3.48Å; L82-S86 PolarHBondContact O-N 3.26Å; L82-S86 PolarHBondContact O-OG 3.15Å; Y83-S86 WeakPolarHBondContact O-CB 3.27Å; Y83-S86 PolarHBondContact O-N 3.4Å; Y83-S86 VanDerWaalsContact O-N 3.13Å; Q84-S86 VanDerWaalsContact C-N 3.27Å; Q84-S86 PolarHBondContact O-N 3.42Å; S86-Q89 PolarHBondContact O-N 3.2Å; S86-R90 WeakPolarHBondContact O-CB 3.45Å; S86-R90 PolarHBondContact O-N 3.15Å
87	L	90.4	Very high	81.8	Confident	72 Å²	72	103.1 Å²	103.1	38%	0.377	55%	0.552	S	S	.	*	H	α-helix	trans	-63.3	-44.4	174.1	-68.6	-177.2	0	0	0	111.8	Y83 Q84 Q89 R90 A91	Y83-L87 HydrophobicContact CD1-CD1 4.06Å; Y83-L87 HydrophobicContact CE1-CD1 3.47Å; Y83-L87 VanDerWaalsContact CE1-CD1 3.47Å; Y83-L87 HydrophobicContact CE1-CG 4.14Å; Y83-L87 HydrophobicContact CE2-CD2 4.45Å; Y83-L87 HydrophobicContact CE2-CG 4.43Å; Y83-L87 PolarHBondContact O-N 2.97Å; Q84-L87 PolarHBondContact O-N 3.18Å; L87-Q89 PolarHBondContact O-N 3.36Å; L87-R90 PolarHBondContact O-N 3.25Å; L87-A91 WeakPolarHBondContact O-CB 3.42Å; L87-A91 PolarHBondContact O-N 2.98Å
88	E	89.8	Confident	79.3	Confident	84 Å²	84	97.3 Å²	97.3	39%	0.393	54%	0.541	S	S	.	.	H	α-helix	trans	-63.6	-40.7	177.6	-73.4	176.6	-160.7	0	0	112.8	Q84 R85 R90 A91 K92	Q84-E88 PolarHBondContact NE2-OE1 2.96Å; Q84-E88 WeakPolarHBondContact O-CG 3.33Å; Q84-E88 PolarHBondContact O-N 3.45Å; R85-E88 PolarHBondContact O-N 2.64Å; E88-R90 VanDerWaalsContact C-N 3.31Å; E88-A91 PolarHBondContact O-N 2.98Å; E88-K92 WeakPolarHBondContact O-CB 3.4Å; E88-K92 VanDerWaalsContact O-CG 3.24Å; E88-K92 WeakPolarHBondContact O-CG 3.45Å; E88-K92 PolarHBondContact O-N 3.48Å; E88-K92 IonicContact OE2-NZ 3.95Å
89	Q	86.8	Confident	77.1	Confident	119 Å²	119	97.8 Å²	97.8	56%	0.556	54%	0.544	S	S	*	.	H	α-helix	trans	-62.5	-40.7	174.4	-76.2	177.7	-19.7	0	0	111.2	R85 S86 L87 K92 K93	R85-Q89 WeakPolarHBondContact O-CB 3.4Å; R85-Q89 VanDerWaalsContact O-CG 3.32Å; R85-Q89 WeakPolarHBondContact O-CG 3.49Å; R85-Q89 PolarHBondContact O-N 3.49Å; S86-Q89 PolarHBondContact O-N 3.2Å; L87-Q89 PolarHBondContact O-N 3.36Å; Q89-K92 PolarHBondContact O-N 3.4Å; Q89-K93 WeakPolarHBondContact O-CB 3.5Å; Q89-K93 PolarHBondContact O-N 2.94Å
90	R	80.3	Confident	75.1	Confident	197 Å²	197	98.5 Å²	98.5	74%	0.743	55%	0.55	S	S	*	*	H	α-helix	trans	-66.7	-41.6	177.3	-163.1	173	-176.8	-174.7	1.5	112.2	S86 L87 E88 K93 S94	S86-R90 WeakPolarHBondContact O-CB 3.45Å; S86-R90 PolarHBondContact O-N 3.15Å; L87-R90 PolarHBondContact O-N 3.25Å; E88-R90 VanDerWaalsContact C-N 3.31Å; R90-K93 PolarHBondContact O-N 3.37Å; R90-S94 PolarHBondContact O-N 3.43Å; R90-S94 VanDerWaalsContact O-N 3.16Å; R90-S94 PolarHBondContact O-OG 3.43Å
91	A	73.9	Confident	72.9	Confident	54 Å²	54	100.1 Å²	100.1	45%	0.446	56%	0.556	S	S	.	*	H	α-helix	trans	-68.1	-38.1	176.3	0	0	0	0	0	112.7	L87 E88 K93 S94 V95	L87-A91 WeakPolarHBondContact O-CB 3.42Å; L87-A91 PolarHBondContact O-N 2.98Å; E88-A91 PolarHBondContact O-N 2.98Å; A91-K93 VanDerWaalsContact C-N 3.35Å; A91-S94 WeakPolarHBondContact CA-OG 3.46Å; A91-S94 PolarHBondContact O-N 2.99Å; A91-S94 PolarHBondContact O-OG 3.48Å; A91-V95 WeakPolarHBondContact O-CG2 3.4Å; A91-V95 PolarHBondContact O-N 3.46Å
92	K	68.7	Low	70.7	Confident	142 Å²	142	100.8 Å²	100.8	62%	0.617	56%	0.56	S	S	*	*	H	α-helix	trans	-66.4	-37.2	173.6	-73.3	167.9	-177.9	167.5	0	111.6	E88 Q89 S94 V95 G96	E88-K92 WeakPolarHBondContact O-CB 3.4Å; E88-K92 VanDerWaalsContact O-CG 3.24Å; E88-K92 WeakPolarHBondContact O-CG 3.45Å; E88-K92 PolarHBondContact O-N 3.48Å; E88-K92 IonicContact OE2-NZ 3.95Å; Q89-K92 PolarHBondContact O-N 3.4Å; K92-S94 VanDerWaalsContact C-N 3.29Å; K92-S94 PolarHBondContact O-N 3.11Å; K92-V95 PolarHBondContact O-N 3.22Å; K92-G96 PolarHBondContact O-N 3.3Å; K92-G96 VanDerWaalsContact O-N 3.09Å
93	K	60.3	Low	68.8	Low	64 Å²	64	97.4 Å²	97.4	28%	0.278	55%	0.548	S	S	.	.	H	α-helix	trans	-67.3	-26.6	175.6	-160.2	178.2	-176.5	-156.6	0	113.2	Q89 R90 A91 G98 D99 A103	Q89-K93 WeakPolarHBondContact O-CB 3.5Å; Q89-K93 PolarHBondContact O-N 2.94Å; R90-K93 PolarHBondContact O-N 3.37Å; A91-K93 VanDerWaalsContact C-N 3.35Å; K93-G98 VanDerWaalsContact CE-O 3.3Å; K93-G98 WeakPolarHBondContact CE-O 3.46Å; K93-D99 WeakPolarHBondContact CE-O 3.45Å; K93-D99 PolarHBondContact NZ-O 3.35Å; K93-A103 HydrophobicContact CD-CB 3.93Å
94	S	55.2	Low	66.8	Low	99 Å²	99	93.6 Å²	93.6	69%	0.692	54%	0.543	S	S	*	.	H	α-helix	trans	-81.6	-20.1	174.2	54.8	0	0	0	0	114.5	R90 A91 K92	R90-S94 PolarHBondContact O-N 3.43Å; R90-S94 VanDerWaalsContact O-N 3.16Å; R90-S94 PolarHBondContact O-OG 3.43Å; A91-S94 WeakPolarHBondContact CA-OG 3.46Å; A91-S94 PolarHBondContact O-N 2.99Å; A91-S94 PolarHBondContact O-OG 3.48Å; K92-S94 VanDerWaalsContact C-N 3.29Å; K92-S94 PolarHBondContact O-N 3.11Å
95	V	56.6	Low	65	Low	131 Å²	131	91.3 Å²	91.3	79%	0.794	54%	0.537	S	S	*	.	H	α-helix	trans	-97.5	-31.7	-177.7	176.3	0	0	0	0	112.6	A91 K92	A91-V95 WeakPolarHBondContact O-CG2 3.4Å; A91-V95 PolarHBondContact O-N 3.46Å; K92-V95 PolarHBondContact O-N 3.22Å
96	G	53.4	Low	63.4	Low	49 Å²	49	88.2 Å²	88.2	51%	0.505	54%	0.535	S	S	.	.	T	Hydrogen-bonded Turn	trans	-112.4	107.4	169.4	0	0	0	0	0	109.1	K92 G98	K92-G96 PolarHBondContact O-N 3.3Å; K92-G96 VanDerWaalsContact O-N 3.09Å; G96-G98 PolarHBondContact O-N 3.41Å
97	G	52.5	Low	62.1	Low	89 Å²	89	91.4 Å²	91.4	92%	0.918	54%	0.543	S	S	*	.	T	Hydrogen-bonded Turn	trans	-37.7	97.8	-172.8	0	0	0	0	0	113.9
98	G	44.9	Very low	60.5	Low	35 Å²	35	94.1 Å²	94.1	36%	0.361	55%	0.554	S	S	.	*			trans	-99.7	112.6	-177.3	0	0	0	0	0	110.7	K93 G96	K93-G98 VanDerWaalsContact CE-O 3.3Å; K93-G98 WeakPolarHBondContact CE-O 3.46Å; G96-G98 PolarHBondContact O-N 3.41Å
99	D	48.7	Very low	59.3	Low	113 Å²	113	97.3 Å²	97.3	60%	0.604	56%	0.562	S	S	*	*			trans	-40.7	129.8	172.3	-141.7	-73.8	0	0	0	112	K93 D101	K93-D99 WeakPolarHBondContact CE-O 3.45Å; K93-D99 PolarHBondContact NZ-O 3.35Å; D99-D101 PolarHBondContact O-N 3.3Å
100	P	55.2	Low	58.3	Low	100 Å²	100	96 Å²	96	65%	0.649	56%	0.558	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.1	-25.7	-171.5	20.4	-31.4	0	0	0	114	S102	P100-S102 PolarHBondContact O-N 2.87Å
101	D	51.1	Low	57.7	Low	121 Å²	121	91.6 Å²	91.6	65%	0.647	55%	0.55	S	S	*	*	H	α-helix	trans	-67.7	-30.9	-174.3	-104.4	-66.5	0	0	0	114.8	D99 S105	D99-D101 PolarHBondContact O-N 3.3Å; D101-S105 WeakPolarHBondContact O-CB 3.39Å; D101-S105 PolarHBondContact O-N 2.9Å
102	S	49.4	Very low	57.5	Low	83 Å²	83	93.1 Å²	93.1	58%	0.58	55%	0.554	S	S	*	*	H	α-helix	trans	-79.5	-23.2	-174.3	-75.2	0	0	0	0	114.8	P100 T106	P100-S102 PolarHBondContact O-N 2.87Å; S102-T106 PolarHBondContact O-OG1 3.25Å
103	A	54.5	Low	57.5	Low	36 Å²	36	91 Å²	91	30%	0.298	55%	0.549	S	S	.	.	H	α-helix	trans	-81.7	-43.8	176.2	0	0	0	0	0	111.4	K93 S105 T106 E107	K93-A103 HydrophobicContact CD-CB 3.93Å; A103-S105 VanDerWaalsContact C-N 3.34Å; A103-S105 PolarHBondContact O-N 3.21Å; A103-T106 PolarHBondContact O-N 3.47Å; A103-T106 VanDerWaalsContact O-N 3.14Å; A103-E107 PolarHBondContact O-N 2.95Å
104	S	54	Low	58.1	Low	68 Å²	68	92.4 Å²	92.4	48%	0.476	56%	0.558	S	S	.	*	H	α-helix	trans	-59.1	-45.2	177.6	174.8	0	0	0	0	111.3	T106 E107 Q108	S104-T106 VanDerWaalsContact C-N 3.25Å; S104-T106 PolarHBondContact O-N 3.23Å; S104-E107 PolarHBondContact O-N 3.34Å; S104-Q108 VanDerWaalsContact O-CB 3.29Å; S104-Q108 WeakPolarHBondContact O-CB 3.38Å; S104-Q108 PolarHBondContact O-N 2.88Å
105	S	56.6	Low	58.6	Low	46 Å²	46	90 Å²	90	32%	0.322	54%	0.544	S	S	.	.	H	α-helix	trans	-61.3	-32.1	178.1	-167.3	0	0	0	0	113.4	D101 A103 R109	D101-S105 WeakPolarHBondContact O-CB 3.39Å; D101-S105 PolarHBondContact O-N 2.9Å; A103-S105 VanDerWaalsContact C-N 3.34Å; A103-S105 PolarHBondContact O-N 3.21Å; S105-R109 WeakPolarHBondContact O-CG 3.36Å; S105-R109 PolarHBondContact O-N 2.93Å; S105-R109 VanDerWaalsContact O-N 3.13Å; S105-R109 PolarHBondContact O-NH1 3.41Å; S105-R109 PolarHBondContact OG-NH2 3.36Å
106	T	59.1	Low	59.1	Low	84 Å²	84	88.1 Å²	88.1	52%	0.515	53%	0.533	S	S	.	.	H	α-helix	trans	-82.8	-38	-177.6	-45.9	0	0	0	0	111.9	S102 A103 S104 N110	S102-T106 PolarHBondContact O-OG1 3.25Å; A103-T106 PolarHBondContact O-N 3.47Å; A103-T106 VanDerWaalsContact O-N 3.14Å; S104-T106 VanDerWaalsContact C-N 3.25Å; S104-T106 PolarHBondContact O-N 3.23Å; T106-N110 WeakPolarHBondContact O-CB 3.38Å; T106-N110 PolarHBondContact O-N 3.47Å
107	E	62.1	Low	59.8	Low	133 Å²	133	94 Å²	94	62%	0.621	54%	0.54	S	S	*	.	H	α-helix	trans	-64.9	-40.2	169.3	-89.3	179.6	90.1	0	0	112.3	A103 S104 N110 N111	A103-E107 PolarHBondContact O-N 2.95Å; S104-E107 PolarHBondContact O-N 3.34Å; E107-N110 PolarHBondContact O-N 3Å; E107-N111 PolarHBondContact O-N 2.86Å; E107-N111 PolarHBondContact O-ND2 3.01Å
108	Q	58.2	Low	60.3	Low	130 Å²	130	94.1 Å²	94.1	61%	0.607	52%	0.523	S	S	*	.	H	α-helix	trans	-61.5	-47.5	176.3	-163.5	100.4	8.5	0	0	110.8	S104 N110 N111 T112	S104-Q108 VanDerWaalsContact O-CB 3.29Å; S104-Q108 WeakPolarHBondContact O-CB 3.38Å; S104-Q108 PolarHBondContact O-N 2.88Å; Q108-N110 VanDerWaalsContact C-N 3.34Å; Q108-N110 PolarHBondContact O-N 3.46Å; Q108-N111 PolarHBondContact O-N 3.4Å; Q108-T112 PolarHBondContact O-N 2.9Å; Q108-T112 VanDerWaalsContact O-N 3.1Å; Q108-T112 PolarHBondContact O-OG1 3.37Å; Q108-T112 VanDerWaalsContact O-OG1 3.07Å
109	R	63	Low	60.9	Low	150 Å²	150	96.7 Å²	96.7	57%	0.566	54%	0.536	S	S	*	.	H	α-helix	trans	-62.4	-38.8	176.5	-80	-169.5	-140.8	89.9	1.2	112.8	S105 T112 L113	S105-R109 WeakPolarHBondContact O-CG 3.36Å; S105-R109 PolarHBondContact O-N 2.93Å; S105-R109 VanDerWaalsContact O-N 3.13Å; S105-R109 PolarHBondContact O-NH1 3.41Å; S105-R109 PolarHBondContact OG-NH2 3.36Å; R109-T112 PolarHBondContact O-N 3.18Å; R109-L113 WeakPolarHBondContact O-CB 3.44Å; R109-L113 PolarHBondContact O-N 2.92Å
110	N	66.2	Low	61	Low	91 Å²	91	95.4 Å²	95.4	49%	0.487	54%	0.54	S	S	.	.	H	α-helix	trans	-68.1	-45.3	-179.8	-164.7	-25.3	0	0	0	111.2	T106 E107 Q108 T112 L113 I114	T106-N110 WeakPolarHBondContact O-CB 3.38Å; T106-N110 PolarHBondContact O-N 3.47Å; E107-N110 PolarHBondContact O-N 3Å; Q108-N110 VanDerWaalsContact C-N 3.34Å; Q108-N110 PolarHBondContact O-N 3.46Å; N110-T112 VanDerWaalsContact C-N 3.32Å; N110-T112 PolarHBondContact O-N 3.26Å; N110-L113 PolarHBondContact O-N 3.23Å; N110-L113 VanDerWaalsContact O-N 3.11Å; N110-I114 WeakPolarHBondContact O-CG1 3.39Å; N110-I114 PolarHBondContact O-N 3.44Å; N110-I114 WeakPolarHBondContact OD1-CD1 3.42Å
111	N	68.8	Low	60.6	Low	106 Å²	106	96.5 Å²	96.5	57%	0.567	55%	0.549	S	S	*	.	H	α-helix	trans	-57.7	-43	174.5	-84	-65.4	0	0	0	112.6	E107 Q108 I114 A115	E107-N111 PolarHBondContact O-N 2.86Å; E107-N111 PolarHBondContact O-ND2 3.01Å; Q108-N111 PolarHBondContact O-N 3.4Å; N111-I114 PolarHBondContact O-N 3.03Å; N111-A115 PolarHBondContact O-N 3.19Å; N111-A115 VanDerWaalsContact O-N 3.12Å
112	T	68.9	Low	60.3	Low	85 Å²	85	98.5 Å²	98.5	52%	0.521	57%	0.573	S	S	.	*	H	α-helix	trans	-64.2	-39.9	175.6	-54.8	0	0	0	0	112	Q108 R109 N110 A115 V116	Q108-T112 PolarHBondContact O-N 2.9Å; Q108-T112 VanDerWaalsContact O-N 3.1Å; Q108-T112 PolarHBondContact O-OG1 3.37Å; Q108-T112 VanDerWaalsContact O-OG1 3.07Å; R109-T112 PolarHBondContact O-N 3.18Å; N110-T112 VanDerWaalsContact C-N 3.32Å; N110-T112 PolarHBondContact O-N 3.26Å; T112-A115 PolarHBondContact O-N 2.9Å; T112-V116 VanDerWaalsContact O-CG2 3.27Å; T112-V116 WeakPolarHBondContact O-CG2 3.26Å; T112-V116 PolarHBondContact O-N 2.89Å; T112-V116 VanDerWaalsContact O-N 3.07Å
113	L	68.8	Low	60.8	Low	99 Å²	99	99.3 Å²	99.3	52%	0.518	57%	0.572	S	S	.	*	H	α-helix	trans	-67.4	-38.5	179.7	-171.6	66.6	0	0	0	112.5	R109 N110 V116 R117	R109-L113 WeakPolarHBondContact O-CB 3.44Å; R109-L113 PolarHBondContact O-N 2.92Å; N110-L113 PolarHBondContact O-N 3.23Å; N110-L113 VanDerWaalsContact O-N 3.11Å; L113-V116 PolarHBondContact O-N 3.23Å; L113-R117 PolarHBondContact O-N 3.49Å; L113-R117 VanDerWaalsContact O-N 3.08Å
114	I	71.9	Confident	61.2	Low	92 Å²	92	102.6 Å²	102.6	47%	0.472	59%	0.587	S	S	.	*	H	α-helix	trans	-63.5	-46.7	175.4	-66.7	173.7	0	0	0	110	N110 N111 V116 R117 T118	N110-I114 WeakPolarHBondContact O-CG1 3.39Å; N110-I114 PolarHBondContact O-N 3.44Å; N110-I114 WeakPolarHBondContact OD1-CD1 3.42Å; N111-I114 PolarHBondContact O-N 3.03Å; I114-V116 VanDerWaalsContact C-N 3.32Å; I114-V116 PolarHBondContact O-N 3.45Å; I114-R117 PolarHBondContact O-N 3.45Å; I114-T118 HydrophobicContact CG2-CG2 4.44Å; I114-T118 WeakPolarHBondContact O-CG2 3.4Å; I114-T118 PolarHBondContact O-N 3.44Å; I114-T118 PolarHBondContact O-OG1 3.33Å
115	A	65.6	Low	61.6	Low	49 Å²	49	104.6 Å²	104.6	41%	0.405	59%	0.593	S	S	.	*	H	α-helix	trans	-60.8	-38.5	178.4	0	0	0	0	0	112.9	N111 T112 T118 S119	N111-A115 PolarHBondContact O-N 3.19Å; N111-A115 VanDerWaalsContact O-N 3.12Å; T112-A115 PolarHBondContact O-N 2.9Å; A115-T118 PolarHBondContact O-OG1 3.31Å; A115-S119 WeakPolarHBondContact O-CB 3.24Å; A115-S119 PolarHBondContact O-N 2.73Å; A115-S119 VanDerWaalsContact O-N 3.15Å; A115-S119 PolarHBondContact O-OG 3.33Å
116	V	68.8	Low	61.9	Low	91 Å²	91	108 Å²	108	55%	0.552	61%	0.609	S	S	*	*	H	α-helix	trans	-69.7	-36.8	177.3	175.5	0	0	0	0	111.4	T112 L113 I114 S119 A120	T112-V116 VanDerWaalsContact O-CG2 3.27Å; T112-V116 WeakPolarHBondContact O-CG2 3.26Å; T112-V116 PolarHBondContact O-N 2.89Å; T112-V116 VanDerWaalsContact O-N 3.07Å; L113-V116 PolarHBondContact O-N 3.23Å; I114-V116 VanDerWaalsContact C-N 3.32Å; I114-V116 PolarHBondContact O-N 3.45Å; V116-S119 PolarHBondContact O-N 3.4Å; V116-A120 PolarHBondContact O-N 2.94Å
117	R	67.5	Low	62	Low	173 Å²	173	109.5 Å²	109.5	65%	0.653	62%	0.615	S	S	*	*	H	α-helix	trans	-70.5	-38.4	178	-171.8	174.1	-74.3	155.2	-3.5	112.4	L113 I114 S119 A120	L113-R117 PolarHBondContact O-N 3.49Å; L113-R117 VanDerWaalsContact O-N 3.08Å; I114-R117 PolarHBondContact O-N 3.45Å; R117-S119 VanDerWaalsContact C-N 3.31Å; R117-A120 PolarHBondContact O-N 2.86Å
118	T	64	Low	62	Low	92 Å²	92	107.9 Å²	107.9	56%	0.564	61%	0.614	S	S	*	*	H	α-helix	trans	-69	-31.3	175.8	54.5	0	0	0	0	112.2	I114 A115	I114-T118 HydrophobicContact CG2-CG2 4.44Å; I114-T118 WeakPolarHBondContact O-CG2 3.4Å; I114-T118 PolarHBondContact O-N 3.44Å; I114-T118 PolarHBondContact O-OG1 3.33Å; A115-T118 PolarHBondContact O-OG1 3.31Å
119	S	56.3	Low	62.3	Low	89 Å²	89	106.4 Å²	106.4	62%	0.622	62%	0.615	S	S	*	*	H	α-helix	trans	-73.4	-25.5	177.3	-53.1	0	0	0	0	113.3	A115 V116 R117	A115-S119 WeakPolarHBondContact O-CB 3.24Å; A115-S119 PolarHBondContact O-N 2.73Å; A115-S119 VanDerWaalsContact O-N 3.15Å; A115-S119 PolarHBondContact O-OG 3.33Å; V116-S119 PolarHBondContact O-N 3.4Å; R117-S119 VanDerWaalsContact C-N 3.31Å
120	A	51.8	Low	62.2	Low	85 Å²	85	103 Å²	103	70%	0.702	62%	0.619	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.1	-11.4	-179.5	0	0	0	0	0	114	V116 R117	V116-A120 PolarHBondContact O-N 2.94Å; R117-A120 PolarHBondContact O-N 2.86Å
121	C	46	Very low	61.9	Low	123 Å²	123	104 Å²	104	83%	0.831	63%	0.63	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.2	8.5	178.2	-98.7	0	0	0	0	113.7
122	S	44.7	Very low	61.3	Low	164 Å²	164	103.8 Å²	103.8	100%	1.147	64%	0.635	S	S	*	*			trans	-108.5	0	179.4	-164.6	0	0	0	0	113.2

Retrieved 122 of 122 residues in 32.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).