A0A087YDR5_POEFO Loading...

Mitochondrial pyruvate carrier

Mediates the uptake of pyruvate into mitochondria.

AlphaFold DB , UniProt , Accession A0A087YDR5, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 88 aa.

						>A0A087YDR5_POEFO|A0A087YDR5
MSLSQHFWGPVANWGLPIAAITDMKKSPEIISGRMTFALCCYSLLFMRFAYKVQPRNWLLFACHLTNESAQLVQGSRLIKYNMEKKSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.8	Very low	51.7	Low	206 Å²	206	108.9 Å²	108.9	100%	1.015	56%	0.562	S	S	*	*				0	118.2	0	-158.8	144.7	140.6	0	0	107
2	S	42.8	Very low	52.6	Low	63 Å²	63	106.3 Å²	106.3	44%	0.441	57%	0.568	S	S	.	*			trans	-70.1	138.5	-159.6	172.2	0	0	0	0	114	S4 Q5	S2-S4 PolarHBondContact O-N 3.05Å; S2-S4 PolarHBondContact OG-N 3.38Å; S2-S4 PolarHBondContact OG-OG 3.48Å; S2-Q5 PolarHBondContact O-N 3.28Å; S2-Q5 VanDerWaalsContact O-N 3.13Å
3	L	49.8	Very low	53.6	Low	156 Å²	156	102.7 Å²	102.7	82%	0.817	55%	0.549	S	S	*	.	H	α-helix	trans	-50.9	-23.9	171.6	-146.5	87.6	0	0	0	113	H6 F7	L3-H6 PolarHBondContact O-N 3Å; L3-F7 PolarHBondContact O-N 3.34Å
4	S	44.1	Very low	54.3	Low	61 Å²	61	103.4 Å²	103.4	43%	0.427	54%	0.54	S	S	.	.	H	α-helix	trans	-69.8	-31.6	179.7	62.7	0	0	0	0	114.3	S2 W8	S2-S4 PolarHBondContact O-N 3.05Å; S2-S4 PolarHBondContact OG-N 3.38Å; S2-S4 PolarHBondContact OG-OG 3.48Å; S4-W8 WeakPolarHBondContact O-CB 3.47Å; S4-W8 PolarHBondContact O-N 3.14Å
5	Q	48.7	Very low	55.2	Low	132 Å²	132	99.3 Å²	99.3	62%	0.617	53%	0.532	S	S	*	.	H	α-helix	trans	-74.3	-27.8	177.1	-72	-175.7	-63.7	0	0	112.4	S2	S2-Q5 PolarHBondContact O-N 3.28Å; S2-Q5 VanDerWaalsContact O-N 3.13Å
6	H	53.8	Low	56	Low	129 Å²	129	97.6 Å²	97.6	60%	0.597	52%	0.523	S	S	*	.	H	α-helix	trans	-82.8	-24.2	-177.8	-72	-98.2	0	0	0	113.5	L3 P10	L3-H6 PolarHBondContact O-N 3Å; H6-P10 WeakPolarHBondContact O-CD 3.33Å; H6-P10 WeakPolarHBondContact O-CG 3.34Å
7	F	53	Low	56.6	Low	142 Å²	142	91.9 Å²	91.9	62%	0.623	49%	0.492	S	S	*	.	H	α-helix	trans	-100.6	-45	-177.4	-160.5	-100.1	0	0	0	113.1	L3 P10 V11	L3-F7 PolarHBondContact O-N 3.34Å; F7-P10 WeakPolarHBondContact O-CD 3.4Å; F7-V11 HydrophobicContact CD1-CG2 4.33Å; F7-V11 HydrophobicContact CE1-CG2 4.22Å; F7-V11 VanDerWaalsContact O-CG2 3.23Å; F7-V11 WeakPolarHBondContact O-CG2 3.5Å; F7-V11 PolarHBondContact O-N 3.44Å
8	W	52.7	Low	57.4	Low	173 Å²	173	92.3 Å²	92.3	66%	0.655	49%	0.493	S	S	*	.	H	α-helix	trans	-78.2	-29.4	-174.8	-69.5	99	0	0	0	113.6	S4 V11 A12	S4-W8 WeakPolarHBondContact O-CB 3.47Å; S4-W8 PolarHBondContact O-N 3.14Å; W8-V11 PolarHBondContact O-N 3.32Å; W8-A12 WeakPolarHBondContact O-CB 3.3Å; W8-A12 PolarHBondContact O-N 3.21Å
9	G	61.2	Low	58.1	Low	35 Å²	35	90.1 Å²	90.1	36%	0.361	49%	0.489	S	S	.	.	H	α-helix	trans	-60.5	-47.8	176.3	0	0	0	0	0	113.2	N13	G9-N13 PolarHBondContact O-N 3.49Å; G9-N13 PolarHBondContact O-ND2 3.02Å
10	P	57.7	Low	58.6	Low	30 Å²	30	85.9 Å²	85.9	20%	0.195	47%	0.467	C	S	.	.	H	α-helix	trans	-67.1	-39.7	172.6	-25.2	35.3	0	0	0	114.1	H6 F7 A12 N13 W14 L59	H6-P10 WeakPolarHBondContact O-CD 3.33Å; H6-P10 WeakPolarHBondContact O-CG 3.34Å; F7-P10 WeakPolarHBondContact O-CD 3.4Å; P10-A12 VanDerWaalsContact C-N 3.33Å; P10-A12 PolarHBondContact O-N 2.95Å; P10-N13 WeakPolarHBondContact O-CB 3.41Å; P10-N13 PolarHBondContact O-N 3.45Å; P10-N13 VanDerWaalsContact O-N 3.1Å; P10-W14 PolarHBondContact O-N 2.97Å; P10-L59 HydrophobicContact CB-CB 4.25Å; P10-L59 HydrophobicContact CB-CD1 3.63Å; P10-L59 HydrophobicContact CB-CD2 4.4Å; P10-L59 HydrophobicContact CB-CG 4.29Å; P10-L59 HydrophobicContact CG-CD1 3.62Å
11	V	62.3	Low	59.1	Low	71 Å²	71	85.5 Å²	85.5	43%	0.43	46%	0.464	S	S	.	.	H	α-helix	trans	-64.2	-37.3	178.3	171.1	0	0	0	0	111.6	F7 W8 N13 W14	F7-V11 HydrophobicContact CD1-CG2 4.33Å; F7-V11 HydrophobicContact CE1-CG2 4.22Å; F7-V11 VanDerWaalsContact O-CG2 3.23Å; F7-V11 WeakPolarHBondContact O-CG2 3.5Å; F7-V11 PolarHBondContact O-N 3.44Å; W8-V11 PolarHBondContact O-N 3.32Å; V11-N13 VanDerWaalsContact C-N 3.25Å; V11-N13 PolarHBondContact O-N 2.92Å; V11-W14 WeakPolarHBondContact O-CB 3.48Å; V11-W14 PolarHBondContact O-N 3.47Å; V11-W14 VanDerWaalsContact O-N 3.13Å
12	A	62.2	Low	60.3	Low	77 Å²	77	79.5 Å²	79.5	64%	0.636	44%	0.439	S	S	*	.	H	α-helix	trans	-62.3	-31.6	173.2	0	0	0	0	0	112.7	W8 P10 W14 G15	W8-A12 WeakPolarHBondContact O-CB 3.3Å; W8-A12 PolarHBondContact O-N 3.21Å; P10-A12 VanDerWaalsContact C-N 3.33Å; P10-A12 PolarHBondContact O-N 2.95Å; A12-W14 VanDerWaalsContact C-N 3.29Å; A12-W14 PolarHBondContact O-N 3.14Å; A12-G15 PolarHBondContact O-N 3.41Å
13	N	65.3	Low	61.5	Low	60 Å²	60	79.4 Å²	79.4	32%	0.321	43%	0.433	S	S	.	.	H	α-helix	trans	-70.3	-23.8	176.1	-80.2	-70.7	0	0	0	112.9	G9 P10 V11 G15 L16 P17 C63	G9-N13 PolarHBondContact O-N 3.49Å; G9-N13 PolarHBondContact O-ND2 3.02Å; P10-N13 WeakPolarHBondContact O-CB 3.41Å; P10-N13 PolarHBondContact O-N 3.45Å; P10-N13 VanDerWaalsContact O-N 3.1Å; V11-N13 VanDerWaalsContact C-N 3.25Å; V11-N13 PolarHBondContact O-N 2.92Å; N13-G15 PolarHBondContact O-N 2.76Å; N13-L16 PolarHBondContact O-N 3.35Å; N13-P17 WeakPolarHBondContact O-CD 3.41Å; N13-C63 PolarHBondContact O-SG 3.4Å
14	W	64.5	Low	62.2	Low	113 Å²	113	74.6 Å²	74.6	43%	0.428	41%	0.407	S	S	.	.	T	Hydrogen-bonded Turn	trans	-69.6	-9.2	175.3	-83.8	79.6	0	0	0	114	P10 V11 A12 L16 P17 I18	P10-W14 PolarHBondContact O-N 2.97Å; V11-W14 WeakPolarHBondContact O-CB 3.48Å; V11-W14 PolarHBondContact O-N 3.47Å; V11-W14 VanDerWaalsContact O-N 3.13Å; A12-W14 VanDerWaalsContact C-N 3.29Å; A12-W14 PolarHBondContact O-N 3.14Å; W14-L16 PolarHBondContact O-N 2.96Å; W14-P17 HydrophobicContact CE3-CB 4.2Å; W14-P17 HydrophobicContact CE3-CG 4.43Å; W14-P17 WeakPolarHBondContact O-CD 3.43Å; W14-I18 WeakPolarHBondContact O-CB 3.46Å; W14-I18 VanDerWaalsContact O-CG1 3.25Å; W14-I18 WeakPolarHBondContact O-CG1 3.37Å; W14-I18 PolarHBondContact O-N 3.48Å
15	G	67.6	Low	63.1	Low	41 Å²	41	80.6 Å²	80.6	42%	0.423	43%	0.426	S	S	.	.	H	α-helix	trans	-57.9	-35.9	171.5	0	0	0	0	0	113	A12 N13 A19	A12-G15 PolarHBondContact O-N 3.41Å; N13-G15 PolarHBondContact O-N 2.76Å; G15-A19 VanDerWaalsContact O-CB 3.24Å; G15-A19 WeakPolarHBondContact O-CB 3.41Å; G15-A19 PolarHBondContact O-N 3.43Å
16	L	68.5	Low	63.8	Low	72 Å²	72	79.6 Å²	79.6	38%	0.377	42%	0.42	S	S	.	.	H	α-helix	trans	-68.3	-50.7	178.2	-72.3	171.3	0	0	0	112.5	N13 W14 I18 A19 A20	N13-L16 PolarHBondContact O-N 3.35Å; W14-L16 PolarHBondContact O-N 2.96Å; L16-I18 VanDerWaalsContact C-N 3.33Å; L16-I18 PolarHBondContact O-N 3.17Å; L16-A19 PolarHBondContact O-N 2.92Å; L16-A20 WeakPolarHBondContact O-CB 3.33Å; L16-A20 PolarHBondContact O-N 3.27Å
17	P	65.1	Low	63.9	Low	1 Å²	1	76.1 Å²	76.1	1%	0.006	41%	0.41	C	S	.	.	H	α-helix	trans	-56.5	-42.8	171.8	-28.3	30.4	0	0	0	113.5	N13 W14 A20 I21 C63 T66	N13-P17 WeakPolarHBondContact O-CD 3.41Å; W14-P17 HydrophobicContact CE3-CB 4.2Å; W14-P17 HydrophobicContact CE3-CG 4.43Å; W14-P17 WeakPolarHBondContact O-CD 3.43Å; P17-A20 PolarHBondContact O-N 3.42Å; P17-I21 WeakPolarHBondContact O-CB 3.48Å; P17-I21 WeakPolarHBondContact O-CD1 3.46Å; P17-I21 WeakPolarHBondContact O-CG1 3.22Å; P17-I21 PolarHBondContact O-N 2.91Å; P17-C63 WeakPolarHBondContact CD-SG 3.33Å; P17-C63 HydrophobicContact CG-CB 4.16Å; P17-C63 WeakPolarHBondContact CG-SG 3.34Å; P17-T66 HydrophobicContact CB-CG2 4.09Å
18	I	71	Confident	64.1	Low	99 Å²	99	70.7 Å²	70.7	51%	0.508	39%	0.389	S	S	.	.	H	α-helix	trans	-66.3	-42.4	179.5	-67.7	169.5	0	0	0	110.5	W14 L16 I21 T22	W14-I18 WeakPolarHBondContact O-CB 3.46Å; W14-I18 VanDerWaalsContact O-CG1 3.25Å; W14-I18 WeakPolarHBondContact O-CG1 3.37Å; W14-I18 PolarHBondContact O-N 3.48Å; L16-I18 VanDerWaalsContact C-N 3.33Å; L16-I18 PolarHBondContact O-N 3.17Å; I18-I21 PolarHBondContact O-N 2.91Å; I18-T22 WeakPolarHBondContact O-CB 3.44Å; I18-T22 PolarHBondContact O-N 3.48Å; I18-T22 PolarHBondContact O-OG1 2.78Å
19	A	71.3	Confident	64.3	Low	50 Å²	50	68.9 Å²	68.9	41%	0.413	39%	0.388	S	S	.	.	H	α-helix	trans	-61.7	-43.5	173.8	0	0	0	0	0	111.4	G15 L16 T22 D23	G15-A19 VanDerWaalsContact O-CB 3.24Å; G15-A19 WeakPolarHBondContact O-CB 3.41Å; G15-A19 PolarHBondContact O-N 3.43Å; L16-A19 PolarHBondContact O-N 2.92Å; A19-T22 PolarHBondContact O-N 3.16Å; A19-D23 WeakPolarHBondContact O-CB 3.23Å; A19-D23 PolarHBondContact O-N 3.08Å
20	A	68.1	Low	64.1	Low	7 Å²	7	73.3 Å²	73.3	6%	0.058	40%	0.402	C	S	.	.	H	α-helix	trans	-62.2	-44.5	177.2	0	0	0	0	0	112.2	L16 P17 T22 D23 M24 N67 A70	L16-A20 WeakPolarHBondContact O-CB 3.33Å; L16-A20 PolarHBondContact O-N 3.27Å; P17-A20 PolarHBondContact O-N 3.42Å; A20-T22 VanDerWaalsContact C-N 3.32Å; A20-T22 PolarHBondContact O-N 3.02Å; A20-D23 PolarHBondContact O-N 3.39Å; A20-M24 WeakPolarHBondContact O-CG 3.27Å; A20-M24 PolarHBondContact O-N 3.27Å; A20-M24 VanDerWaalsContact O-N 3.11Å; A20-N67 WeakPolarHBondContact CB-OD1 3.34Å; A20-A70 HydrophobicContact CB-CB 4.07Å
21	I	69.6	Low	64.4	Low	78 Å²	78	73 Å²	73	40%	0.4	40%	0.398	S	S	.	.	H	α-helix	trans	-63.5	-39.6	175.4	-68.2	161.9	0	0	0	111.1	P17 I18 M24	P17-I21 WeakPolarHBondContact O-CB 3.48Å; P17-I21 WeakPolarHBondContact O-CD1 3.46Å; P17-I21 WeakPolarHBondContact O-CG1 3.22Å; P17-I21 PolarHBondContact O-N 2.91Å; I18-I21 PolarHBondContact O-N 2.91Å; I21-M24 HydrophobicContact CB-CE 4.02Å; I21-M24 HydrophobicContact CG1-CE 3.83Å; I21-M24 HydrophobicContact CG2-CE 4.01Å; I21-M24 WeakPolarHBondContact O-CB 3.17Å; I21-M24 PolarHBondContact O-N 2.67Å
22	T	68.3	Low	64.6	Low	80 Å²	80	72.6 Å²	72.6	49%	0.491	40%	0.399	S	S	.	.	H	α-helix	trans	-67.4	-38.9	177.5	-56.1	0	0	0	0	111.2	I18 A19 A20 M24 K25	I18-T22 WeakPolarHBondContact O-CB 3.44Å; I18-T22 PolarHBondContact O-N 3.48Å; I18-T22 PolarHBondContact O-OG1 2.78Å; A19-T22 PolarHBondContact O-N 3.16Å; A20-T22 VanDerWaalsContact C-N 3.32Å; A20-T22 PolarHBondContact O-N 3.02Å; T22-M24 PolarHBondContact O-N 3.4Å; T22-K25 PolarHBondContact O-N 2.98Å
23	D	67.8	Low	64.8	Low	60 Å²	60	70.5 Å²	70.5	32%	0.321	39%	0.385	S	S	.	.	H	α-helix	trans	-65.7	-24.6	174.3	-90.1	-2.7	0	0	0	112.2	A19 A20 K25 K26 Q74	A19-D23 WeakPolarHBondContact O-CB 3.23Å; A19-D23 PolarHBondContact O-N 3.08Å; A20-D23 PolarHBondContact O-N 3.39Å; D23-K25 PolarHBondContact O-N 3.47Å; D23-K25 VanDerWaalsContact O-N 3.13Å; D23-K26 PolarHBondContact O-N 3.39Å; D23-K26 WeakPolarHBondContact OD1-CD 3.13Å; D23-K26 WeakPolarHBondContact OD1-CE 3.38Å; D23-K26 IonicContact OD1-NZ 2.75Å; D23-K26 PolarHBondContact OD1-NZ 3.19Å; D23-Q74 PolarHBondContact O-NE2 3.08Å
24	M	62.9	Low	65.2	Low	55 Å²	55	78 Å²	78	27%	0.271	41%	0.408	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.7	-19	175.4	-64.6	-161.7	-76.2	0	0	113.5	A20 I21 T22 A70 Q74 R77	A20-M24 WeakPolarHBondContact O-CG 3.27Å; A20-M24 PolarHBondContact O-N 3.27Å; A20-M24 VanDerWaalsContact O-N 3.11Å; I21-M24 HydrophobicContact CB-CE 4.02Å; I21-M24 HydrophobicContact CG1-CE 3.83Å; I21-M24 HydrophobicContact CG2-CE 4.01Å; I21-M24 WeakPolarHBondContact O-CB 3.17Å; I21-M24 PolarHBondContact O-N 2.67Å; T22-M24 PolarHBondContact O-N 3.4Å; M24-A70 HydrophobicContact CE-CB 4.35Å; M24-A70 HydrophobicContact CG-CB 4.29Å; M24-A70 HydrophobicContact SD-CB 3.91Å; M24-Q74 VanDerWaalsContact CA-NE2 3.3Å; M24-Q74 HydrophobicContact CG-CG 3.95Å; M24-R77 PolarHBondContact O-NH1 3.44Å
25	K	62.8	Low	65.7	Low	188 Å²	188	78.1 Å²	78.1	82%	0.817	42%	0.415	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.5	-12.1	176.7	-64.5	-173.1	174.4	-175.6	0	113.5	T22 D23	T22-K25 PolarHBondContact O-N 2.98Å; D23-K25 PolarHBondContact O-N 3.47Å; D23-K25 VanDerWaalsContact O-N 3.13Å
26	K	64.2	Low	66.1	Low	111 Å²	111	76.8 Å²	76.8	48%	0.483	40%	0.399	S	S	.	.	S	Bend	trans	-74.8	149	178.2	-70.2	-176.4	179.7	155.9	0	111	D23	D23-K26 PolarHBondContact O-N 3.39Å; D23-K26 WeakPolarHBondContact OD1-CD 3.13Å; D23-K26 WeakPolarHBondContact OD1-CE 3.38Å; D23-K26 IonicContact OD1-NZ 2.75Å; D23-K26 PolarHBondContact OD1-NZ 3.19Å
27	S	56.3	Low	66.6	Low	56 Å²	56	80.4 Å²	80.4	39%	0.392	41%	0.412	S	S	.	.			trans	-58.5	135.4	179.4	179.1	0	0	0	0	110.3	E29 I30	S27-E29 PolarHBondContact O-N 2.76Å; S27-E29 VanDerWaalsContact O-N 3.09Å; S27-I30 WeakPolarHBondContact O-CG1 3.37Å; S27-I30 PolarHBondContact O-N 3.46Å
28	P	57.7	Low	67.4	Low	28 Å²	28	83 Å²	83	18%	0.182	43%	0.433	C	S	.	.	G	3₁₀ helix	trans	-59.6	-19.7	-179.3	22.9	-32.7	0	0	0	113.8	I30 I31 L78	P28-I30 PolarHBondContact O-N 2.87Å; P28-I31 PolarHBondContact O-N 3.32Å; P28-L78 WeakPolarHBondContact O-CD1 3.25Å
29	E	55	Low	67.8	Low	135 Å²	135	81.1 Å²	81.1	63%	0.631	42%	0.424	S	S	*	.	G	3₁₀ helix	trans	-65.4	-25.7	174.5	-70.1	-175.2	166	0	0	113.8	S27 Y81	S27-E29 PolarHBondContact O-N 2.76Å; S27-E29 VanDerWaalsContact O-N 3.09Å; E29-Y81 HydrophobicContact CG-CE1 4.07Å; E29-Y81 HydrophobicContact CG-CE2 4.21Å; E29-Y81 WeakPolarHBondContact CG-OH 3.41Å; E29-Y81 PolarHBondContact OE1-OH 3.32Å
30	I	59.1	Low	68.4	Low	127 Å²	127	79.5 Å²	79.5	65%	0.651	41%	0.409	S	S	*	.	G	3₁₀ helix	trans	-93	-9.6	-178.8	-24.5	169.8	0	0	0	110.9	S27 P28 S32	S27-I30 WeakPolarHBondContact O-CG1 3.37Å; S27-I30 PolarHBondContact O-N 3.46Å; P28-I30 PolarHBondContact O-N 2.87Å; I30-S32 PolarHBondContact O-N 3.24Å
31	I	62.2	Low	69.1	Low	24 Å²	24	82 Å²	82	12%	0.123	43%	0.425	C	S	.	.			trans	-80.6	106.9	-176.8	-58.7	-176.9	0	0	0	108.7	P28 G33 Q74 L78	P28-I31 PolarHBondContact O-N 3.32Å; I31-G33 PolarHBondContact O-N 3.46Å; I31-Q74 HydrophobicContact CD1-CB 4.26Å; I31-Q74 HydrophobicContact CD1-CG 4.23Å; I31-L78 HydrophobicContact CG2-CD2 4.38Å; I31-L78 WeakPolarHBondContact O-CD1 3.47Å; I31-L78 WeakPolarHBondContact O-CD2 3.46Å
32	S	67.1	Low	69.8	Low	63 Å²	63	83 Å²	83	44%	0.441	43%	0.425	S	S	.	.			trans	-73.6	109.3	174	177	0	0	0	0	110.5	I30 R34 M35 T36	I30-S32 PolarHBondContact O-N 3.24Å; S32-R34 PolarHBondContact O-N 3.01Å; S32-R34 VanDerWaalsContact O-N 3.16Å; S32-M35 WeakPolarHBondContact O-CA 3.4Å; S32-M35 WeakPolarHBondContact O-CB 3.41Å; S32-M35 PolarHBondContact O-N 3.44Å; S32-T36 PolarHBondContact O-N 3.09Å; S32-T36 PolarHBondContact O-OG1 3.44Å
33	G	67.6	Low	70.5	Confident	33 Å²	33	79.1 Å²	79.1	34%	0.34	40%	0.401	S	S	.	.	H	α-helix	trans	-57.6	-30.7	178.4	0	0	0	0	0	113.9	I31 M35 F37	I31-G33 PolarHBondContact O-N 3.46Å; G33-M35 VanDerWaalsContact C-N 3.34Å; G33-F37 WeakPolarHBondContact O-CB 3.39Å; G33-F37 PolarHBondContact O-N 3.01Å
34	R	73.2	Confident	71.4	Confident	217 Å²	217	80.6 Å²	80.6	82%	0.819	41%	0.409	S	S	*	.	H	α-helix	trans	-65.3	-37.8	173.6	-68	177.3	69.9	178.9	1.7	111.8	S32 A38	S32-R34 PolarHBondContact O-N 3.01Å; S32-R34 VanDerWaalsContact O-N 3.16Å; R34-A38 WeakPolarHBondContact O-CB 3.36Å; R34-A38 PolarHBondContact O-N 3.05Å
35	M	74.8	Confident	72.5	Confident	115 Å²	115	83.6 Å²	83.6	57%	0.567	43%	0.425	S	S	*	.	H	α-helix	trans	-72.4	-42.9	178.3	-171	174.3	176	0	0	111.3	S32 G33 F37 A38 L39	S32-M35 WeakPolarHBondContact O-CA 3.4Å; S32-M35 WeakPolarHBondContact O-CB 3.41Å; S32-M35 PolarHBondContact O-N 3.44Å; G33-M35 VanDerWaalsContact C-N 3.34Å; M35-F37 VanDerWaalsContact C-N 3.32Å; M35-F37 PolarHBondContact O-N 2.95Å; M35-A38 PolarHBondContact O-N 3.3Å; M35-L39 HydrophobicContact CE-CD1 4.26Å; M35-L39 HydrophobicContact CG-CD1 4.04Å; M35-L39 WeakPolarHBondContact O-CB 3.36Å; M35-L39 WeakPolarHBondContact O-CG 3.47Å; M35-L39 PolarHBondContact O-N 3.2Å
36	T	76.4	Confident	73.5	Confident	14 Å²	14	77.6 Å²	77.6	9%	0.086	40%	0.399	C	S	.	.	H	α-helix	trans	-58.5	-43.8	174.1	-52.7	0	0	0	0	111.5	S32 L39 C40 Q71	S32-T36 PolarHBondContact O-N 3.09Å; S32-T36 PolarHBondContact O-OG1 3.44Å; T36-L39 PolarHBondContact O-N 3.04Å; T36-C40 PolarHBondContact O-N 3.01Å; T36-C40 PolarHBondContact O-SG 3.24Å; T36-Q71 HydrophobicContact CG2-CB 3.92Å; T36-Q71 HydrophobicContact CG2-CG 4.46Å; T36-Q71 WeakPolarHBondContact CG2-O 3.46Å; T36-Q71 PolarHBondContact O-OE1 2.9Å
37	F	77.9	Confident	74.4	Confident	148 Å²	148	73.4 Å²	73.4	65%	0.649	38%	0.382	S	S	*	.	H	α-helix	trans	-65.3	-45.5	176.4	-177.3	-102.3	0	0	0	112.3	G33 M35 L39 C40 C41	G33-F37 WeakPolarHBondContact O-CB 3.39Å; G33-F37 PolarHBondContact O-N 3.01Å; M35-F37 VanDerWaalsContact C-N 3.32Å; M35-F37 PolarHBondContact O-N 2.95Å; F37-L39 VanDerWaalsContact C-N 3.29Å; F37-L39 PolarHBondContact O-N 3.46Å; F37-C40 PolarHBondContact O-N 3.25Å; F37-C41 PolarHBondContact O-N 3.24Å; F37-C41 PolarHBondContact O-SG 3.36Å
38	A	81.7	Confident	75.9	Confident	55 Å²	55	79 Å²	79	46%	0.455	39%	0.394	S	S	.	.	H	α-helix	trans	-58.9	-41.7	177.7	0	0	0	0	0	112	R34 M35 C41 Y42	R34-A38 WeakPolarHBondContact O-CB 3.36Å; R34-A38 PolarHBondContact O-N 3.05Å; M35-A38 PolarHBondContact O-N 3.3Å; A38-C41 PolarHBondContact O-N 3.26Å; A38-Y42 WeakPolarHBondContact O-CB 3.33Å; A38-Y42 PolarHBondContact O-N 3.34Å
39	L	80.4	Confident	77.2	Confident	59 Å²	59	83.5 Å²	83.5	31%	0.309	41%	0.411	S	S	.	.	H	α-helix	trans	-74	-29	179.6	-74.9	166.9	0	0	0	113.4	M35 T36 F37 S43	M35-L39 HydrophobicContact CE-CD1 4.26Å; M35-L39 HydrophobicContact CG-CD1 4.04Å; M35-L39 WeakPolarHBondContact O-CB 3.36Å; M35-L39 WeakPolarHBondContact O-CG 3.47Å; M35-L39 PolarHBondContact O-N 3.2Å; T36-L39 PolarHBondContact O-N 3.04Å; F37-L39 VanDerWaalsContact C-N 3.29Å; F37-L39 PolarHBondContact O-N 3.46Å; L39-S43 WeakPolarHBondContact O-CB 3.34Å; L39-S43 PolarHBondContact O-N 3.17Å; L39-S43 PolarHBondContact O-OG 3.47Å
40	C	82.4	Confident	78.5	Confident	16 Å²	16	77.1 Å²	77.1	11%	0.108	38%	0.381	C	S	.	.	H	α-helix	trans	-64.4	-50.9	168.8	-79.2	0	0	0	0	110.4	T36 F37 Y42 S43 L44	T36-C40 PolarHBondContact O-N 3.01Å; T36-C40 PolarHBondContact O-SG 3.24Å; F37-C40 PolarHBondContact O-N 3.25Å; C40-Y42 VanDerWaalsContact C-N 3.27Å; C40-Y42 PolarHBondContact O-N 3.46Å; C40-S43 PolarHBondContact O-N 3.34Å; C40-L44 PolarHBondContact O-N 3.03Å
41	C	84.4	Confident	79.5	Confident	59 Å²	59	76.9 Å²	76.9	40%	0.399	37%	0.373	S	S	.	.	H	α-helix	trans	-57.4	-41	176.4	-70.1	0	0	0	0	112.4	F37 A38 L45	F37-C41 PolarHBondContact O-N 3.24Å; F37-C41 PolarHBondContact O-SG 3.36Å; A38-C41 PolarHBondContact O-N 3.26Å; C41-L45 PolarHBondContact O-N 3.28Å; C41-L45 VanDerWaalsContact O-N 3.17Å
42	Y	83.3	Confident	80.6	Confident	99 Å²	99	82.8 Å²	82.8	39%	0.388	40%	0.398	S	S	.	.	H	α-helix	trans	-60.9	-46.1	174	177	-98.6	0	0	0	111.8	A38 C40 L45 F46 H64	A38-Y42 WeakPolarHBondContact O-CB 3.33Å; A38-Y42 PolarHBondContact O-N 3.34Å; C40-Y42 VanDerWaalsContact C-N 3.27Å; C40-Y42 PolarHBondContact O-N 3.46Å; Y42-L45 PolarHBondContact O-N 3.02Å; Y42-F46 HydrophobicContact CD1-CD2 4.41Å; Y42-F46 HydrophobicContact CD2-CD2 4Å; Y42-F46 AromaticContact CD2-CE2 3.82Å; Y42-F46 HydrophobicContact CD2-CE2 3.82Å; Y42-F46 HydrophobicContact CE1-CD2 4.09Å; Y42-F46 HydrophobicContact CE1-CE2 4.21Å; Y42-F46 AromaticContact CE2-CD2 3.66Å; Y42-F46 HydrophobicContact CE2-CD2 3.66Å; Y42-F46 AromaticContact CE2-CE2 3.12Å; Y42-F46 HydrophobicContact CE2-CE2 3.12Å; Y42-F46 AromaticContact CE2-CZ 3.88Å; Y42-F46 HydrophobicContact CE2-CZ 3.88Å; Y42-F46 HydrophobicContact CG-CD2 4.36Å; Y42-F46 AromaticContact CZ-CD2 3.68Å; Y42-F46 AromaticContact CZ-CE2 3.35Å; Y42-F46 AromaticContact CZ-CZ 3.81Å; Y42-F46 WeakPolarHBondContact O-CD2 3.48Å; Y42-F46 PolarHBondContact O-N 3.43Å; Y42-F46 VanDerWaalsContact O-N 3.12Å; Y42-F46 WeakPolarHBondContact OH-CE2 3.43Å; Y42-F46 WeakPolarHBondContact OH-CZ 3.32Å; Y42-H64 AromaticContact CE1-CE1 3.79Å
43	S	83.2	Confident	81.3	Confident	0 Å²	0	82.4 Å²	82.4	0%	0	39%	0.393	C	S	.	.	H	α-helix	trans	-64	-43.5	-179.9	-59.2	0	0	0	0	112.1	L39 C40 L45 F46 M47 N67	L39-S43 WeakPolarHBondContact O-CB 3.34Å; L39-S43 PolarHBondContact O-N 3.17Å; L39-S43 PolarHBondContact O-OG 3.47Å; C40-S43 PolarHBondContact O-N 3.34Å; S43-L45 VanDerWaalsContact C-N 3.34Å; S43-L45 PolarHBondContact O-N 3.49Å; S43-F46 PolarHBondContact O-N 2.95Å; S43-M47 WeakPolarHBondContact O-CB 3.46Å; S43-M47 VanDerWaalsContact O-CG 3.3Å; S43-M47 WeakPolarHBondContact O-CG 3.4Å; S43-M47 PolarHBondContact O-N 3.04Å; S43-N67 PolarHBondContact OG-ND2 3.21Å
44	L	86.8	Confident	81.9	Confident	91 Å²	91	88.5 Å²	88.5	48%	0.476	41%	0.413	S	S	.	.	H	α-helix	trans	-58.6	-43.7	175.1	-73	172.2	0	0	0	112.8	C40 F46 M47 R48 E68	C40-L44 PolarHBondContact O-N 3.03Å; L44-F46 VanDerWaalsContact C-N 3.34Å; L44-F46 PolarHBondContact O-N 2.93Å; L44-M47 PolarHBondContact O-N 2.92Å; L44-R48 PolarHBondContact O-N 3.13Å; L44-E68 WeakPolarHBondContact CD2-OE1 3.47Å; L44-E68 VanDerWaalsContact CD2-OE2 3.23Å; L44-E68 WeakPolarHBondContact CD2-OE2 3.3Å; L44-E68 WeakPolarHBondContact CG-OE1 3.5Å; L44-E68 VanDerWaalsContact CG-OE2 3.27Å; L44-E68 WeakPolarHBondContact CG-OE2 3.36Å; L44-E68 PolarHBondContact N-OE2 3.37Å
45	L	87.2	Confident	82.3	Confident	117 Å²	117	84.1 Å²	84.1	61%	0.613	41%	0.412	S	S	*	.	H	α-helix	trans	-62.5	-44.7	179.4	-175.2	66	0	0	0	110.8	C41 Y42 S43 R48 F49	C41-L45 PolarHBondContact O-N 3.28Å; C41-L45 VanDerWaalsContact O-N 3.17Å; Y42-L45 PolarHBondContact O-N 3.02Å; S43-L45 VanDerWaalsContact C-N 3.34Å; S43-L45 PolarHBondContact O-N 3.49Å; L45-R48 PolarHBondContact O-N 2.91Å; L45-F49 PolarHBondContact O-N 3.46Å
46	F	82.3	Confident	82.5	Confident	62 Å²	62	84.3 Å²	84.3	27%	0.272	41%	0.407	S	S	.	.	H	α-helix	trans	-69.9	-35.6	178.2	-89.4	-100.4	0	0	0	112.9	Y42 S43 L44 F49 A50 L60 H64	Y42-F46 HydrophobicContact CD1-CD2 4.41Å; Y42-F46 HydrophobicContact CD2-CD2 4Å; Y42-F46 AromaticContact CD2-CE2 3.82Å; Y42-F46 HydrophobicContact CD2-CE2 3.82Å; Y42-F46 HydrophobicContact CE1-CD2 4.09Å; Y42-F46 HydrophobicContact CE1-CE2 4.21Å; Y42-F46 AromaticContact CE2-CD2 3.66Å; Y42-F46 HydrophobicContact CE2-CD2 3.66Å; Y42-F46 AromaticContact CE2-CE2 3.12Å; Y42-F46 HydrophobicContact CE2-CE2 3.12Å; Y42-F46 AromaticContact CE2-CZ 3.88Å; Y42-F46 HydrophobicContact CE2-CZ 3.88Å; Y42-F46 HydrophobicContact CG-CD2 4.36Å; Y42-F46 AromaticContact CZ-CD2 3.68Å; Y42-F46 AromaticContact CZ-CE2 3.35Å; Y42-F46 AromaticContact CZ-CZ 3.81Å; Y42-F46 WeakPolarHBondContact O-CD2 3.48Å; Y42-F46 PolarHBondContact O-N 3.43Å; Y42-F46 VanDerWaalsContact O-N 3.12Å; Y42-F46 WeakPolarHBondContact OH-CE2 3.43Å; Y42-F46 WeakPolarHBondContact OH-CZ 3.32Å; S43-F46 PolarHBondContact O-N 2.95Å; L44-F46 VanDerWaalsContact C-N 3.34Å; L44-F46 PolarHBondContact O-N 2.93Å; F46-F49 PolarHBondContact O-N 3.4Å; F46-A50 VanDerWaalsContact O-CB 3.28Å; F46-A50 WeakPolarHBondContact O-CB 3.44Å; F46-A50 PolarHBondContact O-N 2.87Å; F46-L60 HydrophobicContact CD1-CD2 4.49Å; F46-H64 VanDerWaalsContact CB-CD2 3.46Å; F46-H64 WeakPolarHBondContact CB-CD2 3.5Å; F46-H64 WeakPolarHBondContact CB-NE2 3.39Å; F46-H64 AromaticContact CD1-CE1 3.99Å; F46-H64 AromaticContact CD1-NE2 3.49Å; F46-H64 WeakPolarHBondContact CD1-NE2 3.18Å; F46-H64 AromaticContact CG-CE1 3.75Å; F46-H64 AromaticContact CG-NE2 3.59Å
47	M	84.2	Confident	82.7	Confident	23 Å²	23	86.9 Å²	86.9	11%	0.113	42%	0.42	C	S	.	.	H	α-helix	trans	-60.9	-44.1	172	-75.8	172.8	62	0	0	111.4	S43 L44 A50 Y51 F61 H64 L65	S43-M47 WeakPolarHBondContact O-CB 3.46Å; S43-M47 VanDerWaalsContact O-CG 3.3Å; S43-M47 WeakPolarHBondContact O-CG 3.4Å; S43-M47 PolarHBondContact O-N 3.04Å; L44-M47 PolarHBondContact O-N 2.92Å; M47-A50 PolarHBondContact O-N 3.21Å; M47-Y51 WeakPolarHBondContact O-CB 3.22Å; M47-Y51 PolarHBondContact O-N 3.34Å; M47-F61 HydrophobicContact CB-CD2 3.86Å; M47-F61 HydrophobicContact CB-CE2 3.86Å; M47-F61 HydrophobicContact CE-CD2 4.32Å; M47-F61 HydrophobicContact CE-CE1 4.36Å; M47-F61 HydrophobicContact CE-CE2 3.56Å; M47-F61 HydrophobicContact CE-CZ 3.58Å; M47-F61 HydrophobicContact CG-CD2 4.06Å; M47-F61 HydrophobicContact CG-CE2 4.16Å; M47-H64 HydrophobicContact CG-CB 3.57Å; M47-H64 HydrophobicContact SD-CB 4.33Å; M47-L65 HydrophobicContact CE-CB 4.1Å; M47-L65 HydrophobicContact CE-CD1 3.58Å; M47-L65 HydrophobicContact CE-CG 4.43Å; M47-L65 HydrophobicContact SD-CB 4.19Å; M47-L65 HydrophobicContact SD-CD1 4.35Å
48	R	86.8	Confident	82.7	Confident	175 Å²	175	86.9 Å²	86.9	66%	0.66	42%	0.415	S	S	*	.	H	α-helix	trans	-62.8	-42.6	175.5	-179.3	175	174.3	83.8	-3.4	111.8	L44 L45 Y51 K52	L44-R48 PolarHBondContact O-N 3.13Å; L45-R48 PolarHBondContact O-N 2.91Å; R48-Y51 PolarHBondContact O-N 3.02Å; R48-K52 WeakPolarHBondContact O-CB 3.46Å; R48-K52 WeakPolarHBondContact O-CG 3.39Å; R48-K52 PolarHBondContact O-N 3.44Å; R48-K52 VanDerWaalsContact O-N 3.09Å
49	F	85.6	Confident	82.7	Confident	121 Å²	121	88.5 Å²	88.5	53%	0.531	42%	0.416	S	S	.	.	H	α-helix	trans	-61.9	-49.4	175.8	175.3	-101.5	0	0	0	111.7	L45 F46 Y51 K52 V53 L60	L45-F49 PolarHBondContact O-N 3.46Å; F46-F49 PolarHBondContact O-N 3.4Å; F49-Y51 PolarHBondContact O-N 3.02Å; F49-K52 PolarHBondContact O-N 3.23Å; F49-K52 VanDerWaalsContact O-N 3.08Å; F49-V53 HydrophobicContact CZ-CG2 4.28Å; F49-V53 PolarHBondContact O-N 3.33Å; F49-L60 HydrophobicContact CD1-CD2 4.3Å
50	A	82.5	Confident	82.6	Confident	1 Å²	1	86.5 Å²	86.5	1%	0.008	41%	0.405	C	S	.	.	H	α-helix	trans	-58.3	-34.7	179.6	0	0	0	0	0	113	F46 M47 N57 L60 F61	F46-A50 VanDerWaalsContact O-CB 3.28Å; F46-A50 WeakPolarHBondContact O-CB 3.44Å; F46-A50 PolarHBondContact O-N 2.87Å; M47-A50 PolarHBondContact O-N 3.21Å; A50-N57 PolarHBondContact O-N 3.36Å; A50-N57 VanDerWaalsContact O-N 3.16Å; A50-L60 HydrophobicContact CB-CB 4.05Å; A50-L60 HydrophobicContact CB-CD2 3.97Å; A50-L60 HydrophobicContact CB-CG 4.08Å; A50-F61 HydrophobicContact CB-CB 4.03Å
51	Y	79.3	Confident	82.6	Confident	122 Å²	122	88.3 Å²	88.3	48%	0.478	41%	0.412	S	S	.	.	H	α-helix	trans	-75.6	-36	176.2	-175.2	-93.6	0	0	0	113.4	M47 R48 F49 W58	M47-Y51 WeakPolarHBondContact O-CB 3.22Å; M47-Y51 PolarHBondContact O-N 3.34Å; R48-Y51 PolarHBondContact O-N 3.02Å; F49-Y51 PolarHBondContact O-N 3.02Å; Y51-W58 HydrophobicContact CE2-CH2 4.43Å
52	K	85.7	Confident	82.5	Confident	149 Å²	149	87.3 Å²	87.3	65%	0.648	41%	0.408	S	S	*	.	H	α-helix	trans	-82.3	-28.9	-176.4	-73	-71.3	-72.6	177.7	0	113.6	R48 F49	R48-K52 WeakPolarHBondContact O-CB 3.46Å; R48-K52 WeakPolarHBondContact O-CG 3.39Å; R48-K52 PolarHBondContact O-N 3.44Å; R48-K52 VanDerWaalsContact O-N 3.09Å; F49-K52 PolarHBondContact O-N 3.23Å; F49-K52 VanDerWaalsContact O-N 3.08Å
53	V	82	Confident	82.5	Confident	54 Å²	54	82.7 Å²	82.7	33%	0.327	39%	0.39	S	S	.	.	S	Bend	trans	-67.4	139.6	178.2	91.6	0	0	0	0	110.2	F49 P55 R56 N57	F49-V53 HydrophobicContact CZ-CG2 4.28Å; F49-V53 PolarHBondContact O-N 3.33Å; V53-P55 CarbonylContact O-C 3.43Å; V53-R56 VanDerWaalsContact O-CA 3.25Å; V53-R56 WeakPolarHBondContact O-CA 3.31Å; V53-R56 PolarHBondContact O-N 3.02Å; V53-N57 HydrophobicContact CG1-CB 4.23Å
54	Q	80.2	Confident	82.5	Confident	162 Å²	162	82.8 Å²	82.8	76%	0.757	39%	0.39	S	S	*	.	S	Bend	trans	-117.7	133.1	173.7	-83.3	-152.8	-13.2	0	0	111.5
55	P	80.6	Confident	82.4	Confident	125 Å²	125	82.1 Å²	82.1	81%	0.812	39%	0.387	S	S	*	.	S	Bend	cis	-65.4	147	-4.8	27.9	-34.2	0	0	0	112.7	V53 N57	V53-P55 CarbonylContact O-C 3.43Å; P55-N57 PolarHBondContact O-N 2.96Å
56	R	80.1	Confident	82.2	Confident	119 Å²	119	79 Å²	79	45%	0.449	37%	0.372	S	S	.	.			trans	-61.9	132.3	-172.7	-67.4	178.1	-177.1	137.2	-0.5	111.7	V53 W58	V53-R56 VanDerWaalsContact O-CA 3.25Å; V53-R56 WeakPolarHBondContact O-CA 3.31Å; V53-R56 PolarHBondContact O-N 3.02Å; R56-W58 HydrophobicContact CB-CZ2 4.5Å; R56-W58 PolarHBondContact O-N 3.33Å
57	N	80.6	Confident	82.2	Confident	67 Å²	67	76.3 Å²	76.3	36%	0.358	36%	0.361	S	S	.	.			trans	-95.2	79	-178.9	-167.2	-21	0	0	0	111.4	A50 V53 P55 L59 L60 F61	A50-N57 PolarHBondContact O-N 3.36Å; A50-N57 VanDerWaalsContact O-N 3.16Å; V53-N57 HydrophobicContact CG1-CB 4.23Å; P55-N57 PolarHBondContact O-N 2.96Å; N57-L59 PolarHBondContact O-N 3.09Å; N57-L59 PolarHBondContact OD1-N 3.07Å; N57-L60 HydrophobicContact CB-CB 4.17Å; N57-L60 PolarHBondContact O-N 3.11Å; N57-L60 WeakPolarHBondContact OD1-CB 3.46Å; N57-L60 PolarHBondContact OD1-N 3.47Å; N57-L60 VanDerWaalsContact OD1-N 3.08Å; N57-F61 PolarHBondContact O-N 3.38Å; N57-F61 VanDerWaalsContact O-N 3.12Å
58	W	78.4	Confident	82.2	Confident	148 Å²	148	76.3 Å²	76.3	56%	0.561	36%	0.361	S	S	*	.	H	α-helix	trans	-63	-27.4	-178.7	-64.5	108.3	0	0	0	114.1	Y51 R56 F61 A62	Y51-W58 HydrophobicContact CE2-CH2 4.43Å; R56-W58 HydrophobicContact CB-CZ2 4.5Å; R56-W58 PolarHBondContact O-N 3.33Å; W58-F61 PolarHBondContact O-N 3.06Å; W58-A62 WeakPolarHBondContact O-CB 3.47Å; W58-A62 PolarHBondContact O-N 3.08Å
59	L	80.1	Confident	82.1	Confident	90 Å²	90	71 Å²	71	47%	0.471	35%	0.35	S	S	.	.	H	α-helix	trans	-71.1	-44.4	178.5	-73.5	158.9	0	0	0	111.4	P10 N57 F61 A62 C63	P10-L59 HydrophobicContact CB-CB 4.25Å; P10-L59 HydrophobicContact CB-CD1 3.63Å; P10-L59 HydrophobicContact CB-CD2 4.4Å; P10-L59 HydrophobicContact CB-CG 4.29Å; P10-L59 HydrophobicContact CG-CD1 3.62Å; N57-L59 PolarHBondContact O-N 3.09Å; N57-L59 PolarHBondContact OD1-N 3.07Å; L59-F61 VanDerWaalsContact C-N 3.31Å; L59-F61 PolarHBondContact O-N 3.24Å; L59-A62 PolarHBondContact O-N 2.84Å; L59-C63 VanDerWaalsContact O-CB 3.31Å; L59-C63 WeakPolarHBondContact O-CB 3.32Å; L59-C63 PolarHBondContact O-N 3.38Å
60	L	78.1	Confident	82	Confident	16 Å²	16	65.5 Å²	65.5	8%	0.084	33%	0.328	C	S	.	.	H	α-helix	trans	-62.1	-42.1	173	-173	65.5	0	0	0	110.6	F46 F49 A50 N57 C63 H64	F46-L60 HydrophobicContact CD1-CD2 4.49Å; F49-L60 HydrophobicContact CD1-CD2 4.3Å; A50-L60 HydrophobicContact CB-CB 4.05Å; A50-L60 HydrophobicContact CB-CD2 3.97Å; A50-L60 HydrophobicContact CB-CG 4.08Å; N57-L60 HydrophobicContact CB-CB 4.17Å; N57-L60 PolarHBondContact O-N 3.11Å; N57-L60 WeakPolarHBondContact OD1-CB 3.46Å; N57-L60 PolarHBondContact OD1-N 3.47Å; N57-L60 VanDerWaalsContact OD1-N 3.08Å; L60-C63 WeakPolarHBondContact O-CB 3.35Å; L60-C63 PolarHBondContact O-N 3.25Å; L60-H64 WeakPolarHBondContact CD1-NE2 3.49Å; L60-H64 PolarHBondContact O-CD2 3.25Å; L60-H64 PolarHBondContact O-N 2.9Å; L60-H64 VanDerWaalsContact O-N 3.09Å
61	F	82.9	Confident	81.8	Confident	54 Å²	54	65.7 Å²	65.7	24%	0.237	33%	0.328	C	S	.	.	H	α-helix	trans	-59.9	-50.6	176	-177	-91.9	0	0	0	112.4	M47 A50 N57 W58 L59 C63 H64 L65	M47-F61 HydrophobicContact CB-CD2 3.86Å; M47-F61 HydrophobicContact CB-CE2 3.86Å; M47-F61 HydrophobicContact CE-CD2 4.32Å; M47-F61 HydrophobicContact CE-CE1 4.36Å; M47-F61 HydrophobicContact CE-CE2 3.56Å; M47-F61 HydrophobicContact CE-CZ 3.58Å; M47-F61 HydrophobicContact CG-CD2 4.06Å; M47-F61 HydrophobicContact CG-CE2 4.16Å; A50-F61 HydrophobicContact CB-CB 4.03Å; N57-F61 PolarHBondContact O-N 3.38Å; N57-F61 VanDerWaalsContact O-N 3.12Å; W58-F61 PolarHBondContact O-N 3.06Å; L59-F61 VanDerWaalsContact C-N 3.31Å; L59-F61 PolarHBondContact O-N 3.24Å; F61-C63 VanDerWaalsContact C-N 3.31Å; F61-C63 PolarHBondContact O-N 2.99Å; F61-H64 PolarHBondContact O-N 3.42Å; F61-L65 HydrophobicContact CE1-CD2 4.21Å; F61-L65 WeakPolarHBondContact O-CB 3.36Å; F61-L65 PolarHBondContact O-N 2.82Å
62	A	82.9	Confident	81.9	Confident	39 Å²	39	64.6 Å²	64.6	32%	0.322	33%	0.33	S	S	.	.	H	α-helix	trans	-63	-37.3	-179.9	0	0	0	0	0	112.6	W58 L59 T66	W58-A62 WeakPolarHBondContact O-CB 3.47Å; W58-A62 PolarHBondContact O-N 3.08Å; L59-A62 PolarHBondContact O-N 2.84Å; A62-T66 WeakPolarHBondContact O-CB 3.33Å; A62-T66 PolarHBondContact O-N 2.83Å; A62-T66 PolarHBondContact O-OG1 3.12Å
63	C	82.3	Confident	81.8	Confident	1 Å²	1	61.3 Å²	61.3	1%	0.007	32%	0.322	C	S	.	.	H	α-helix	trans	-58.5	-54.7	174	168.8	0	0	0	0	111.5	N13 P17 L59 L60 F61 L65 T66 N67	N13-C63 PolarHBondContact O-SG 3.4Å; P17-C63 WeakPolarHBondContact CD-SG 3.33Å; P17-C63 HydrophobicContact CG-CB 4.16Å; P17-C63 WeakPolarHBondContact CG-SG 3.34Å; L59-C63 VanDerWaalsContact O-CB 3.31Å; L59-C63 WeakPolarHBondContact O-CB 3.32Å; L59-C63 PolarHBondContact O-N 3.38Å; L60-C63 WeakPolarHBondContact O-CB 3.35Å; L60-C63 PolarHBondContact O-N 3.25Å; F61-C63 VanDerWaalsContact C-N 3.31Å; F61-C63 PolarHBondContact O-N 2.99Å; C63-L65 PolarHBondContact O-N 2.93Å; C63-T66 PolarHBondContact O-N 2.98Å; C63-N67 PolarHBondContact O-N 2.95Å
64	H	83	Confident	81.6	Confident	3 Å²	3	59.2 Å²	59.2	1%	0.014	31%	0.309	C	S	.	.	H	α-helix	trans	-68.7	-33.7	-179	-74	-72.6	0	0	0	112.9	Y42 F46 M47 L60 F61 T66 N67 E68	Y42-H64 AromaticContact CE1-CE1 3.79Å; F46-H64 VanDerWaalsContact CB-CD2 3.46Å; F46-H64 WeakPolarHBondContact CB-CD2 3.5Å; F46-H64 WeakPolarHBondContact CB-NE2 3.39Å; F46-H64 AromaticContact CD1-CE1 3.99Å; F46-H64 AromaticContact CD1-NE2 3.49Å; F46-H64 WeakPolarHBondContact CD1-NE2 3.18Å; F46-H64 AromaticContact CG-CE1 3.75Å; F46-H64 AromaticContact CG-NE2 3.59Å; M47-H64 HydrophobicContact CG-CB 3.57Å; M47-H64 HydrophobicContact SD-CB 4.33Å; L60-H64 WeakPolarHBondContact CD1-NE2 3.49Å; L60-H64 PolarHBondContact O-CD2 3.25Å; L60-H64 PolarHBondContact O-N 2.9Å; L60-H64 VanDerWaalsContact O-N 3.09Å; F61-H64 PolarHBondContact O-N 3.42Å; H64-T66 VanDerWaalsContact C-N 3.31Å; H64-T66 PolarHBondContact O-N 3.3Å; H64-N67 PolarHBondContact O-N 2.8Å; H64-E68 WeakPolarHBondContact O-CB 3.47Å; H64-E68 PolarHBondContact O-N 2.91Å
65	L	85.6	Confident	81.4	Confident	77 Å²	77	52.2 Å²	52.2	40%	0.403	28%	0.28	S	S	.	.	H	α-helix	trans	-60.8	-41.3	172.8	-177.9	70.1	0	0	0	111.8	M47 F61 C63 S69	M47-L65 HydrophobicContact CE-CB 4.1Å; M47-L65 HydrophobicContact CE-CD1 3.58Å; M47-L65 HydrophobicContact CE-CG 4.43Å; M47-L65 HydrophobicContact SD-CB 4.19Å; M47-L65 HydrophobicContact SD-CD1 4.35Å; F61-L65 HydrophobicContact CE1-CD2 4.21Å; F61-L65 WeakPolarHBondContact O-CB 3.36Å; F61-L65 PolarHBondContact O-N 2.82Å; C63-L65 PolarHBondContact O-N 2.93Å; L65-S69 WeakPolarHBondContact O-CB 3.49Å; L65-S69 PolarHBondContact O-N 3.01Å; L65-S69 PolarHBondContact O-OG 3.43Å
66	T	83.3	Confident	81.3	Confident	50 Å²	50	49.4 Å²	49.4	31%	0.307	26%	0.263	S	S	.	.	H	α-helix	trans	-68	-43.6	177.7	-55.7	0	0	0	0	111.1	P17 A62 C63 H64 S69 A70	P17-T66 HydrophobicContact CB-CG2 4.09Å; A62-T66 WeakPolarHBondContact O-CB 3.33Å; A62-T66 PolarHBondContact O-N 2.83Å; A62-T66 PolarHBondContact O-OG1 3.12Å; C63-T66 PolarHBondContact O-N 2.98Å; H64-T66 VanDerWaalsContact C-N 3.31Å; H64-T66 PolarHBondContact O-N 3.3Å; T66-S69 PolarHBondContact O-N 3.42Å; T66-A70 PolarHBondContact O-N 2.99Å
67	N	82.1	Confident	81.2	Confident	7 Å²	7	49.6 Å²	49.6	4%	0.037	26%	0.264	C	S	.	.	H	α-helix	trans	-60.6	-45.9	175.9	-175.5	42.7	0	0	0	112	A20 S43 C63 H64 A70 Q71	A20-N67 WeakPolarHBondContact CB-OD1 3.34Å; S43-N67 PolarHBondContact OG-ND2 3.21Å; C63-N67 PolarHBondContact O-N 2.95Å; H64-N67 PolarHBondContact O-N 2.8Å; N67-A70 PolarHBondContact O-N 3.5Å; N67-Q71 PolarHBondContact ND2-NE2 3.47Å; N67-Q71 WeakPolarHBondContact O-CB 3.25Å; N67-Q71 WeakPolarHBondContact O-CG 3.28Å; N67-Q71 PolarHBondContact O-N 2.88Å; N67-Q71 PolarHBondContact OD1-NE2 3.22Å
68	E	83.8	Confident	81	Confident	23 Å²	23	47.1 Å²	47.1	11%	0.107	25%	0.251	C	S	.	.	H	α-helix	trans	-64.2	-42.5	177.8	-176.1	153.5	-175.2	0	0	112.1	L44 H64 A70 Q71 L72	L44-E68 WeakPolarHBondContact CD2-OE1 3.47Å; L44-E68 VanDerWaalsContact CD2-OE2 3.23Å; L44-E68 WeakPolarHBondContact CD2-OE2 3.3Å; L44-E68 WeakPolarHBondContact CG-OE1 3.5Å; L44-E68 VanDerWaalsContact CG-OE2 3.27Å; L44-E68 WeakPolarHBondContact CG-OE2 3.36Å; L44-E68 PolarHBondContact N-OE2 3.37Å; H64-E68 WeakPolarHBondContact O-CB 3.47Å; H64-E68 PolarHBondContact O-N 2.91Å; E68-A70 PolarHBondContact O-N 3.3Å; E68-Q71 PolarHBondContact O-N 2.87Å; E68-L72 HydrophobicContact CG-CD1 4.12Å; E68-L72 HydrophobicContact CG-CG 4.41Å; E68-L72 WeakPolarHBondContact O-CB 3.46Å; E68-L72 WeakPolarHBondContact O-CG 3.24Å; E68-L72 PolarHBondContact O-N 3.42Å
69	S	85.4	Confident	80.9	Confident	62 Å²	62	45.1 Å²	45.1	43%	0.434	25%	0.25	S	C	.	.	H	α-helix	trans	-59.8	-45.2	175.4	-59.5	0	0	0	0	111.9	L65 T66 Q71 L72 V73	L65-S69 WeakPolarHBondContact O-CB 3.49Å; L65-S69 PolarHBondContact O-N 3.01Å; L65-S69 PolarHBondContact O-OG 3.43Å; T66-S69 PolarHBondContact O-N 3.42Å; S69-Q71 VanDerWaalsContact C-N 3.34Å; S69-Q71 PolarHBondContact O-N 3.3Å; S69-L72 PolarHBondContact O-N 3.16Å; S69-V73 WeakPolarHBondContact O-CG2 3.34Å; S69-V73 PolarHBondContact O-N 3.37Å
70	A	82.4	Confident	80.9	Confident	7 Å²	7	47.4 Å²	47.4	6%	0.058	26%	0.256	C	S	.	.	H	α-helix	trans	-62.2	-41.3	177.1	0	0	0	0	0	112	A20 M24 T66 N67 E68 V73 Q74	A20-A70 HydrophobicContact CB-CB 4.07Å; M24-A70 HydrophobicContact CE-CB 4.35Å; M24-A70 HydrophobicContact CG-CB 4.29Å; M24-A70 HydrophobicContact SD-CB 3.91Å; T66-A70 PolarHBondContact O-N 2.99Å; N67-A70 PolarHBondContact O-N 3.5Å; E68-A70 PolarHBondContact O-N 3.3Å; A70-V73 PolarHBondContact O-N 3.12Å; A70-Q74 WeakPolarHBondContact O-CG 3.37Å; A70-Q74 PolarHBondContact O-N 3.31Å
71	Q	79.2	Confident	80.8	Confident	5 Å²	5	49.5 Å²	49.5	2%	0.023	26%	0.263	C	S	.	.	H	α-helix	trans	-71.7	-36.1	179.6	-75	178.4	23	0	0	113.7	T36 N67 E68 S69 V73 Q74 G75	T36-Q71 HydrophobicContact CG2-CB 3.92Å; T36-Q71 HydrophobicContact CG2-CG 4.46Å; T36-Q71 WeakPolarHBondContact CG2-O 3.46Å; T36-Q71 PolarHBondContact O-OE1 2.9Å; N67-Q71 PolarHBondContact ND2-NE2 3.47Å; N67-Q71 WeakPolarHBondContact O-CB 3.25Å; N67-Q71 WeakPolarHBondContact O-CG 3.28Å; N67-Q71 PolarHBondContact O-N 2.88Å; N67-Q71 PolarHBondContact OD1-NE2 3.22Å; E68-Q71 PolarHBondContact O-N 2.87Å; S69-Q71 VanDerWaalsContact C-N 3.34Å; S69-Q71 PolarHBondContact O-N 3.3Å; Q71-V73 VanDerWaalsContact C-N 3.29Å; Q71-V73 PolarHBondContact O-N 3.36Å; Q71-Q74 PolarHBondContact O-N 2.84Å; Q71-G75 PolarHBondContact O-N 3.47Å
72	L	81.7	Confident	80.4	Confident	99 Å²	99	51 Å²	51	52%	0.518	27%	0.273	S	S	.	.	H	α-helix	trans	-62.2	-39.7	172.9	-74.8	171.3	0	0	0	111.2	E68 S69 S76	E68-L72 HydrophobicContact CG-CD1 4.12Å; E68-L72 HydrophobicContact CG-CG 4.41Å; E68-L72 WeakPolarHBondContact O-CB 3.46Å; E68-L72 WeakPolarHBondContact O-CG 3.24Å; E68-L72 PolarHBondContact O-N 3.42Å; S69-L72 PolarHBondContact O-N 3.16Å; L72-S76 WeakPolarHBondContact O-CB 3.48Å; L72-S76 PolarHBondContact O-N 3.47Å; L72-S76 PolarHBondContact O-OG 3.3Å
73	V	83.1	Confident	80.1	Confident	79 Å²	79	54.6 Å²	54.6	48%	0.479	29%	0.285	S	S	.	.	H	α-helix	trans	-64.6	-46.8	174.6	172.8	0	0	0	0	110.9	S69 A70 Q71 S76 R77	S69-V73 WeakPolarHBondContact O-CG2 3.34Å; S69-V73 PolarHBondContact O-N 3.37Å; A70-V73 PolarHBondContact O-N 3.12Å; Q71-V73 VanDerWaalsContact C-N 3.29Å; Q71-V73 PolarHBondContact O-N 3.36Å; V73-S76 PolarHBondContact O-N 3.18Å; V73-R77 WeakPolarHBondContact O-CG 3.47Å; V73-R77 PolarHBondContact O-N 3.09Å; V73-R77 VanDerWaalsContact O-N 3.08Å
74	Q	76.7	Confident	79.6	Confident	11 Å²	11	61 Å²	61	5%	0.051	32%	0.315	C	S	.	.	H	α-helix	trans	-61.7	-45.3	175.4	-74.3	176.9	-36.1	0	0	112.7	D23 M24 I31 A70 Q71 S76 R77 L78	D23-Q74 PolarHBondContact O-NE2 3.08Å; M24-Q74 VanDerWaalsContact CA-NE2 3.3Å; M24-Q74 HydrophobicContact CG-CG 3.95Å; I31-Q74 HydrophobicContact CD1-CB 4.26Å; I31-Q74 HydrophobicContact CD1-CG 4.23Å; A70-Q74 WeakPolarHBondContact O-CG 3.37Å; A70-Q74 PolarHBondContact O-N 3.31Å; Q71-Q74 PolarHBondContact O-N 2.84Å; Q74-S76 VanDerWaalsContact C-N 3.31Å; Q74-S76 PolarHBondContact O-N 3.5Å; Q74-R77 WeakPolarHBondContact O-CB 3.4Å; Q74-R77 PolarHBondContact O-N 3.13Å; Q74-L78 PolarHBondContact O-N 2.91Å
75	G	76.7	Confident	78.8	Confident	14 Å²	14	67.3 Å²	67.3	14%	0.144	34%	0.342	C	S	.	.	H	α-helix	trans	-60.9	-40.8	177.7	0	0	0	0	0	111.8	Q71 R77 L78 I79	Q71-G75 PolarHBondContact O-N 3.47Å; G75-R77 PolarHBondContact O-N 3.44Å; G75-L78 PolarHBondContact O-N 3.05Å; G75-I79 VanDerWaalsContact O-CG1 3.3Å; G75-I79 WeakPolarHBondContact O-CG1 3.38Å; G75-I79 PolarHBondContact O-N 2.75Å
76	S	79.4	Confident	77.7	Confident	66 Å²	66	72.6 Å²	72.6	46%	0.462	36%	0.362	S	S	.	.	H	α-helix	trans	-62.7	-41.2	174.7	-60.3	0	0	0	0	112.2	L72 V73 Q74 K80	L72-S76 WeakPolarHBondContact O-CB 3.48Å; L72-S76 PolarHBondContact O-N 3.47Å; L72-S76 PolarHBondContact O-OG 3.3Å; V73-S76 PolarHBondContact O-N 3.18Å; Q74-S76 VanDerWaalsContact C-N 3.31Å; Q74-S76 PolarHBondContact O-N 3.5Å; S76-K80 WeakPolarHBondContact O-CG 3.23Å; S76-K80 PolarHBondContact O-N 3.05Å; S76-K80 VanDerWaalsContact O-N 3.14Å
77	R	77.4	Confident	76.6	Confident	124 Å²	124	75.3 Å²	75.3	47%	0.468	38%	0.383	S	S	.	.	H	α-helix	trans	-64.9	-41	174.9	-69.4	175.4	72.3	-166.8	0.8	111.8	M24 V73 Q74 G75 K80 Y81	M24-R77 PolarHBondContact O-NH1 3.44Å; V73-R77 WeakPolarHBondContact O-CG 3.47Å; V73-R77 PolarHBondContact O-N 3.09Å; V73-R77 VanDerWaalsContact O-N 3.08Å; Q74-R77 WeakPolarHBondContact O-CB 3.4Å; Q74-R77 PolarHBondContact O-N 3.13Å; G75-R77 PolarHBondContact O-N 3.44Å; R77-K80 PolarHBondContact O-N 3.42Å; R77-Y81 PolarHBondContact O-N 2.75Å
78	L	77	Confident	75.1	Confident	15 Å²	15	83 Å²	83	8%	0.079	44%	0.437	C	S	.	.	H	α-helix	trans	-64.6	-43.4	177.2	-178.6	69.7	0	0	0	112.2	P28 I31 Q74 G75 Y81 N82	P28-L78 WeakPolarHBondContact O-CD1 3.25Å; I31-L78 HydrophobicContact CG2-CD2 4.38Å; I31-L78 WeakPolarHBondContact O-CD1 3.47Å; I31-L78 WeakPolarHBondContact O-CD2 3.46Å; Q74-L78 PolarHBondContact O-N 2.91Å; G75-L78 PolarHBondContact O-N 3.05Å; L78-Y81 PolarHBondContact O-N 2.9Å; L78-N82 WeakPolarHBondContact O-CB 3.47Å; L78-N82 PolarHBondContact O-N 3.4Å; L78-N82 PolarHBondContact O-ND2 3.31Å
79	I	76.4	Confident	74.7	Confident	106 Å²	106	86 Å²	86	54%	0.544	45%	0.454	S	S	.	.	H	α-helix	trans	-61.1	-46.4	177.4	-69.3	165.4	0	0	0	110.2	G75 Y81 N82 M83	G75-I79 VanDerWaalsContact O-CG1 3.3Å; G75-I79 WeakPolarHBondContact O-CG1 3.38Å; G75-I79 PolarHBondContact O-N 2.75Å; I79-Y81 PolarHBondContact O-N 3.22Å; I79-N82 PolarHBondContact O-N 3.46Å; I79-M83 HydrophobicContact CG2-CG 4.44Å; I79-M83 HydrophobicContact CG2-SD 4.03Å; I79-M83 WeakPolarHBondContact O-CG 3.34Å; I79-M83 PolarHBondContact O-N 3.37Å
80	K	79.8	Confident	74.1	Confident	138 Å²	138	87.2 Å²	87.2	60%	0.6	46%	0.455	S	S	*	.	H	α-helix	trans	-58.1	-48	175.9	-74.6	-176.1	177.3	-171.5	0	112	S76 R77 N82 M83 E84	S76-K80 WeakPolarHBondContact O-CG 3.23Å; S76-K80 PolarHBondContact O-N 3.05Å; S76-K80 VanDerWaalsContact O-N 3.14Å; R77-K80 PolarHBondContact O-N 3.42Å; K80-N82 PolarHBondContact O-N 3.35Å; K80-M83 PolarHBondContact O-N 3.46Å; K80-E84 PolarHBondContact O-N 3.33Å
81	Y	75.8	Confident	73.6	Confident	60 Å²	60	91.7 Å²	91.7	24%	0.235	48%	0.477	C	S	.	.	H	α-helix	trans	-59.6	-44.4	177.3	176.2	-91.6	0	0	0	112.5	E29 R77 L78 I79 M83 E84 K85	E29-Y81 HydrophobicContact CG-CE1 4.07Å; E29-Y81 HydrophobicContact CG-CE2 4.21Å; E29-Y81 WeakPolarHBondContact CG-OH 3.41Å; E29-Y81 PolarHBondContact OE1-OH 3.32Å; R77-Y81 PolarHBondContact O-N 2.75Å; L78-Y81 PolarHBondContact O-N 2.9Å; I79-Y81 PolarHBondContact O-N 3.22Å; Y81-M83 VanDerWaalsContact C-N 3.34Å; Y81-M83 PolarHBondContact O-N 3.1Å; Y81-E84 PolarHBondContact O-N 3.34Å; Y81-K85 HydrophobicContact CE1-CD 4.31Å; Y81-K85 WeakPolarHBondContact O-CB 3.46Å; Y81-K85 PolarHBondContact O-N 2.87Å
82	N	75.3	Confident	73.3	Confident	84 Å²	84	96.8 Å²	96.8	45%	0.449	50%	0.503	S	S	.	.	H	α-helix	trans	-66.4	-33.6	177.6	-75.8	-28.4	0	0	0	112.8	L78 I79 K80 K86	L78-N82 WeakPolarHBondContact O-CB 3.47Å; L78-N82 PolarHBondContact O-N 3.4Å; L78-N82 PolarHBondContact O-ND2 3.31Å; I79-N82 PolarHBondContact O-N 3.46Å; K80-N82 PolarHBondContact O-N 3.35Å; N82-K86 WeakPolarHBondContact O-CB 3.45Å; N82-K86 PolarHBondContact O-N 3.39Å; N82-K86 VanDerWaalsContact O-N 3.14Å
83	M	74.8	Confident	72.8	Confident	116 Å²	116	96.6 Å²	96.6	57%	0.571	50%	0.503	S	S	*	.	H	α-helix	trans	-70	-42.4	175.2	-74	-179.5	6.4	0	0	112.3	I79 K80 Y81 K86 S87	I79-M83 HydrophobicContact CG2-CG 4.44Å; I79-M83 HydrophobicContact CG2-SD 4.03Å; I79-M83 WeakPolarHBondContact O-CG 3.34Å; I79-M83 PolarHBondContact O-N 3.37Å; K80-M83 PolarHBondContact O-N 3.46Å; Y81-M83 VanDerWaalsContact C-N 3.34Å; Y81-M83 PolarHBondContact O-N 3.1Å; M83-K86 PolarHBondContact O-N 3.13Å; M83-S87 PolarHBondContact O-N 3.46Å; M83-S87 PolarHBondContact O-OG 3Å
84	E	72.3	Confident	72.1	Confident	136 Å²	136	97.8 Å²	97.8	64%	0.636	50%	0.504	S	S	*	.	H	α-helix	trans	-62.9	-46.7	175.4	-75.3	172.2	-176.2	0	0	110.8	K80 Y81 K86 S87	K80-E84 PolarHBondContact O-N 3.33Å; Y81-E84 PolarHBondContact O-N 3.34Å; E84-K86 VanDerWaalsContact C-N 3.27Å; E84-K86 PolarHBondContact O-N 3.25Å; E84-S87 PolarHBondContact O-N 2.73Å
85	K	67.1	Low	71.8	Confident	134 Å²	134	104 Å²	104	58%	0.583	54%	0.536	S	S	*	.	H	α-helix	trans	-61.6	-31.2	176.4	-176.7	171	-179.8	162.6	0	113.6	Y81 S87	Y81-K85 HydrophobicContact CE1-CD 4.31Å; Y81-K85 WeakPolarHBondContact O-CB 3.46Å; Y81-K85 PolarHBondContact O-N 2.87Å; K85-S87 VanDerWaalsContact C-N 3.25Å; K85-S87 PolarHBondContact O-N 3.18Å
86	K	63.1	Low	71.4	Confident	188 Å²	188	110.9 Å²	110.9	82%	0.817	57%	0.567	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.5	-13.4	177.7	-158.6	-178.4	-178.9	-165.8	0	112.9	N82 M83 E84	N82-K86 WeakPolarHBondContact O-CB 3.45Å; N82-K86 PolarHBondContact O-N 3.39Å; N82-K86 VanDerWaalsContact O-N 3.14Å; M83-K86 PolarHBondContact O-N 3.13Å; E84-K86 VanDerWaalsContact C-N 3.27Å; E84-K86 PolarHBondContact O-N 3.25Å
87	S	58.8	Low	70.7	Confident	107 Å²	107	114.7 Å²	114.7	75%	0.748	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.3	-0.3	-177.6	-55.4	0	0	0	0	113.8	M83 E84 K85	M83-S87 PolarHBondContact O-N 3.46Å; M83-S87 PolarHBondContact O-OG 3Å; E84-S87 PolarHBondContact O-N 2.73Å; K85-S87 VanDerWaalsContact C-N 3.25Å; K85-S87 PolarHBondContact O-N 3.18Å
88	S	51.3	Low	70.1	Confident	168 Å²	168	113.8 Å²	113.8	100%	1.175	59%	0.585	S	S	*	*			trans	-110	0	171.6	-98.5	0	0	0	0	110.5

Retrieved 88 of 88 residues in 71.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).