A0A087YE96_POEFO Loading...

Small ribosomal subunit protein bS6m

AlphaFold DB , UniProt , Accession A0A087YE96, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 109 aa.

						>A0A087YE96_POEFO|A0A087YE96
MPRYELALILKAMQRPETAAAVRRTVETLMERGAVVRNLENMGERLLPYKITKHNERHSRGTYFLVDFYCAPSILDGLLNHLHRDVDVVRPTVLKKEEQEPKSSGCGPS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	74.1	Confident	90.7	Very high	167 Å²	167	38.1 Å²	38.1	82%	0.823	19%	0.192	S	C	*	.				0	130.7	0	-69.3	174.3	-178.9	0	0	107.8	Y69	M1-Y69 WeakPolarHBondContact O-CD1 3.36Å
2	P	86.9	Confident	90.7	Very high	46 Å²	46	38.9 Å²	38.9	30%	0.299	21%	0.209	S	C	.	.			trans	-62	145.9	178.3	19.4	-25.9	0	0	0	111.8	Y4 C70	P2-Y4 HydrophobicContact CB-CE2 3.74Å; P2-Y4 HydrophobicContact CG-CE2 3.66Å; P2-C70 WeakPolarHBondContact CD-O 3.48Å; P2-C70 WeakPolarHBondContact CG-O 3.46Å; P2-C70 PolarHBondContact O-N 2.76Å
3	R	90.4	Very high	90.7	Very high	44 Å²	44	37.9 Å²	37.9	17%	0.166	20%	0.203	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-91.4	133.7	176.3	-167.3	176.7	177.1	-177.7	-5.6	109.8	D67 Y69 K96	R3-D67 IonicContact CZ-OD2 2.72Å; R3-D67 IonicContact NH2-OD2 2.7Å; R3-D67 PolarHBondContact NH2-OD2 2.96Å; R3-Y69 HydrophobicContact CB-CD1 3.95Å; R3-Y69 HydrophobicContact CB-CE1 3.64Å; R3-Y69 HydrophobicContact CG-CD1 4.29Å; R3-Y69 HydrophobicContact CG-CE1 3.91Å; R3-K96 HydrophobicContact CB-CB 4.28Å; R3-K96 HydrophobicContact CG-CB 4.03Å; R3-K96 HydrophobicContact CG-CD 4.4Å; R3-K96 PolarHBondContact O-N 2.99Å
4	Y	92.1	Very high	90.7	Very high	23 Å²	23	44.8 Å²	44.8	9%	0.09	23%	0.233	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-125.7	155.2	175.5	-63.4	-83.4	0	0	0	110.2	P2 F68 C70 L75 V93 L94 K95	P2-Y4 HydrophobicContact CB-CE2 3.74Å; P2-Y4 HydrophobicContact CG-CE2 3.66Å; Y4-F68 PolarHBondContact N-O 2.72Å; Y4-F68 PolarHBondContact O-N 3Å; Y4-F68 VanDerWaalsContact O-O 3.07Å; Y4-C70 WeakPolarHBondContact CD2-SG 3.48Å; Y4-C70 VanDerWaalsContact CE2-SG 3.58Å; Y4-L75 HydrophobicContact CD1-CD1 4.27Å; Y4-L75 HydrophobicContact CD1-CD2 4.49Å; Y4-L75 HydrophobicContact CD2-CD2 4.48Å; Y4-L75 HydrophobicContact CE1-CD1 3.69Å; Y4-L75 HydrophobicContact CE2-CD1 4.09Å; Y4-L75 HydrophobicContact CG-CD2 4.4Å; Y4-V93 HydrophobicContact CD1-CG1 3.98Å; Y4-V93 HydrophobicContact CG-CG1 4.34Å; Y4-L94 CarbonylContact C-O 3.6Å; Y4-L94 WeakPolarHBondContact CA-O 3.4Å; Y4-K95 HydrophobicContact CD1-CB 4.27Å; Y4-K95 HydrophobicContact CD1-CG 4.5Å; Y4-K95 HydrophobicContact CE1-CB 4.16Å; Y4-K95 HydrophobicContact CE1-CG 4.17Å
5	E	93.1	Very high	90.6	Very high	42 Å²	42	56.9 Å²	56.9	20%	0.196	27%	0.274	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.3	127.4	171.1	-171.1	173.9	98	0	0	107.7	V66 V93 L94 K96	E5-V66 CarbonylContact C-O 3.51Å; E5-V66 WeakPolarHBondContact CA-O 3.32Å; E5-V93 WeakPolarHBondContact O-CA 3.48Å; E5-L94 PolarHBondContact N-O 3.11Å; E5-L94 PolarHBondContact O-N 3.49Å; E5-K96 HydrophobicContact CB-CD 4.36Å; E5-K96 IonicContact OE2-NZ 2.7Å; E5-K96 PolarHBondContact OE2-NZ 2.99Å
6	L	92.8	Very high	90.7	Very high	0 Å²	0	59.3 Å²	59.3	0%	0	30%	0.296	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.9	107.9	175.4	168.2	65	0	0	0	107.8	L8 T25 L29 V66 F68 L82 P91 T92 V93	L6-L8 HydrophobicContact CD1-CG 4.09Å; L6-L8 HydrophobicContact CD2-CD1 3.51Å; L6-L8 HydrophobicContact CD2-CG 3.96Å; L6-L8 HydrophobicContact CG-CD1 3.69Å; L6-L8 HydrophobicContact CG-CG 3.75Å; L6-T25 HydrophobicContact CD2-CG2 4.34Å; L6-L29 HydrophobicContact CD2-CD1 4.34Å; L6-V66 HydrophobicContact CB-CB 4.29Å; L6-V66 PolarHBondContact N-O 2.8Å; L6-V66 PolarHBondContact O-N 2.83Å; L6-F68 HydrophobicContact CB-CD1 4.25Å; L6-F68 HydrophobicContact CB-CE1 3.5Å; L6-F68 VanDerWaalsContact CB-CE1 3.5Å; L6-F68 HydrophobicContact CB-CZ 4.31Å; L6-L82 HydrophobicContact CD1-CD1 3.89Å; L6-L82 HydrophobicContact CD2-CD1 3.87Å; L6-P91 HydrophobicContact CD1-CB 4.39Å; L6-T92 CarbonylContact C-O 3.59Å; L6-T92 WeakPolarHBondContact CA-O 3.49Å; L6-V93 HydrophobicContact CD1-CG2 3.73Å
7	A	93.6	Very high	90.7	Very high	24 Å²	24	61.6 Å²	61.6	20%	0.198	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.2	108.2	168.2	0	0	0	0	0	109	L65 T92	A7-L65 HydrophobicContact CB-CD2 3.84Å; A7-T92 PolarHBondContact N-O 3.4Å; A7-T92 PolarHBondContact O-N 2.96Å
8	L	93.4	Very high	90.7	Very high	7 Å²	7	59 Å²	59	4%	0.037	29%	0.294	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101	125.7	179	-86	147.8	0	0	0	109.9	L6 L10 T25 F64 V66 L82 V88	L6-L8 HydrophobicContact CD1-CG 4.09Å; L6-L8 HydrophobicContact CD2-CD1 3.51Å; L6-L8 HydrophobicContact CD2-CG 3.96Å; L6-L8 HydrophobicContact CG-CD1 3.69Å; L6-L8 HydrophobicContact CG-CG 3.75Å; L8-L10 HydrophobicContact CD2-CD2 4.38Å; L8-T25 HydrophobicContact CD1-CG2 3.8Å; L8-F64 HydrophobicContact CB-CB 4.14Å; L8-F64 PolarHBondContact N-O 3.44Å; L8-F64 PolarHBondContact O-N 3.41Å; L8-V66 HydrophobicContact CD1-CG2 4Å; L8-L82 HydrophobicContact CD2-CD2 4.18Å; L8-V88 HydrophobicContact CD2-CG1 4.06Å; L8-V88 HydrophobicContact CD2-CG2 4.1Å
9	I	94.6	Very high	90.8	Very high	21 Å²	21	59.2 Å²	59.2	11%	0.108	31%	0.305	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105	109.5	165.2	-52.5	-176.2	0	0	0	107	L47 Y63 V89 R90	I9-L47 HydrophobicContact CG2-CD2 3.78Å; I9-Y63 HydrophobicContact CD1-CD1 4.3Å; I9-Y63 HydrophobicContact CD1-CE1 3.62Å; I9-Y63 HydrophobicContact CG1-CD1 3.97Å; I9-Y63 HydrophobicContact CG1-CE1 3.81Å; I9-V89 HydrophobicContact CB-CB 4.46Å; I9-V89 HydrophobicContact CG2-CB 4.08Å; I9-V89 HydrophobicContact CG2-CG1 4.43Å; I9-V89 WeakPolarHBondContact O-CA 3.47Å; I9-V89 WeakPolarHBondContact O-CB 3.44Å; I9-V89 PolarHBondContact O-N 2.97Å; I9-R90 HydrophobicContact CB-CB 4.19Å; I9-R90 HydrophobicContact CD1-CB 4.17Å; I9-R90 HydrophobicContact CG1-CB 4.38Å; I9-R90 PolarHBondContact N-O 3.23Å; I9-R90 PolarHBondContact O-N 3.41Å; I9-R90 VanDerWaalsContact O-N 3.15Å
10	L	93.8	Very high	90.9	Very high	1 Å²	1	58.5 Å²	58.5	1%	0.005	31%	0.309	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.8	155	173.2	-61	-177.8	0	0	0	110.3	L8 M13 T18 A21 V22 G61 T62 F64 D87 V88	L8-L10 HydrophobicContact CD2-CD2 4.38Å; L10-M13 HydrophobicContact CB-CE 4.48Å; L10-T18 HydrophobicContact CD1-CG2 4.1Å; L10-A21 HydrophobicContact CD1-CB 4.15Å; L10-V22 HydrophobicContact CD1-CG2 3.8Å; L10-G61 CarbonylContact O-C 3.59Å; L10-G61 WeakPolarHBondContact O-CA 3.44Å; L10-T62 PolarHBondContact N-O 3.27Å; L10-T62 PolarHBondContact O-N 2.91Å; L10-F64 HydrophobicContact CD1-CD2 3.76Å; L10-F64 HydrophobicContact CD1-CE2 3.74Å; L10-F64 HydrophobicContact CG-CD2 4.17Å; L10-F64 HydrophobicContact CG-CE2 4.48Å; L10-D87 WeakPolarHBondContact CA-O 3.42Å; L10-V88 HydrophobicContact CD2-CB 4.48Å; L10-V88 HydrophobicContact CD2-CG2 3.84Å
11	K	93	Very high	90.9	Very high	44 Å²	44	55.7 Å²	55.7	19%	0.191	29%	0.294	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-65.6	151.3	172.9	82.8	-172	-175.9	-163.1	0	109.4	M13 D87 V89	K11-M13 HydrophobicContact CD-CG 4.09Å; K11-M13 HydrophobicContact CD-SD 4.2Å; K11-M13 VanDerWaalsContact CE-CG 3.46Å; K11-M13 WeakPolarHBondContact CE-SD 3.5Å; K11-M13 HydrophobicContact CG-CE 4.12Å; K11-M13 HydrophobicContact CG-CG 3.41Å; K11-M13 VanDerWaalsContact CG-CG 3.41Å; K11-M13 HydrophobicContact CG-SD 3.84Å; K11-M13 PolarHBondContact O-N 3.26Å; K11-M13 VanDerWaalsContact O-N 3.14Å; K11-D87 WeakPolarHBondContact CE-OD1 3.45Å; K11-D87 PolarHBondContact N-O 3.45Å; K11-D87 IonicContact NZ-OD1 3.62Å; K11-D87 PolarHBondContact NZ-OD1 3.13Å; K11-V89 HydrophobicContact CB-CG2 3.78Å
12	A	90.4	Very high	91.8	Very high	48 Å²	48	48.9 Å²	48.9	40%	0.397	26%	0.262	S	S	.	.	S	Bend	trans	-66.8	114	176.5	0	0	0	0	0	109.4	E44 R60	A12-E44 HydrophobicContact CB-CG 4.42Å; A12-E44 WeakPolarHBondContact CB-OE1 3.43Å; A12-R60 HydrophobicContact CB-CB 4.03Å
13	M	90.4	Very high	92	Very high	26 Å²	26	54.6 Å²	54.6	13%	0.128	28%	0.278	C	S	.	.			trans	-135.6	172.5	-173	-71.8	-172.8	-74.2	0	0	111	L10 K11 E17 A21 D87	L10-M13 HydrophobicContact CB-CE 4.48Å; K11-M13 HydrophobicContact CD-CG 4.09Å; K11-M13 HydrophobicContact CD-SD 4.2Å; K11-M13 VanDerWaalsContact CE-CG 3.46Å; K11-M13 WeakPolarHBondContact CE-SD 3.5Å; K11-M13 HydrophobicContact CG-CE 4.12Å; K11-M13 HydrophobicContact CG-CG 3.41Å; K11-M13 VanDerWaalsContact CG-CG 3.41Å; K11-M13 HydrophobicContact CG-SD 3.84Å; K11-M13 PolarHBondContact O-N 3.26Å; K11-M13 VanDerWaalsContact O-N 3.14Å; M13-E17 HydrophobicContact CB-CB 3.98Å; M13-E17 WeakPolarHBondContact CB-OE2 3.47Å; M13-E17 HydrophobicContact CG-CB 4.46Å; M13-E17 HydrophobicContact SD-CB 3.87Å; M13-A21 HydrophobicContact CE-CB 4.12Å; M13-D87 HydrophobicContact CE-CB 3.91Å; M13-D87 HydrophobicContact SD-CB 4.3Å
14	Q	91.5	Very high	92.1	Very high	134 Å²	134	57.4 Å²	57.4	63%	0.626	29%	0.288	S	S	*	.			trans	-65.9	155.5	169.2	-62.1	-61.3	-42.4	0	0	110.9	P16 E17 T18	Q14-P16 HydrophobicContact CB-CG 4.2Å; Q14-E17 HydrophobicContact CB-CG 4.42Å; Q14-E17 PolarHBondContact N-OE2 3.4Å; Q14-E17 VanDerWaalsContact N-OE2 3.13Å; Q14-E17 PolarHBondContact O-N 3.24Å; Q14-T18 PolarHBondContact O-N 3.2Å; Q14-T18 PolarHBondContact O-OG1 2.76Å
15	R	88.2	Confident	92.1	Very high	226 Å²	226	56.4 Å²	56.4	85%	0.853	29%	0.285	S	S	*	.	H	α-helix	trans	-50.5	-47.8	176.8	-76.5	-174.6	172.2	-172.8	-2	114.4	E17 T18 A19	R15-E17 PolarHBondContact O-N 2.92Å; R15-T18 PolarHBondContact O-N 2.98Å; R15-A19 WeakPolarHBondContact O-CB 3.28Å; R15-A19 PolarHBondContact O-N 3.17Å
16	P	92.4	Very high	92.1	Very high	95 Å²	95	55.8 Å²	55.8	62%	0.617	28%	0.283	S	S	*	.	H	α-helix	trans	-63.9	-39.7	179.7	23.1	-34.9	0	0	0	113.2	Q14 A19 A20	Q14-P16 HydrophobicContact CB-CG 4.2Å; P16-A19 PolarHBondContact O-N 3.36Å; P16-A20 WeakPolarHBondContact O-CB 3.11Å; P16-A20 PolarHBondContact O-N 3.07Å
17	E	90.8	Very high	92.1	Very high	100 Å²	100	59.3 Å²	59.3	47%	0.467	30%	0.3	S	S	.	.	H	α-helix	trans	-66.3	-42.5	178.4	-64.2	171.4	164.2	0	0	111	M13 Q14 R15 A20 A21	M13-E17 HydrophobicContact CB-CB 3.98Å; M13-E17 WeakPolarHBondContact CB-OE2 3.47Å; M13-E17 HydrophobicContact CG-CB 4.46Å; M13-E17 HydrophobicContact SD-CB 3.87Å; Q14-E17 HydrophobicContact CB-CG 4.42Å; Q14-E17 PolarHBondContact N-OE2 3.4Å; Q14-E17 VanDerWaalsContact N-OE2 3.13Å; Q14-E17 PolarHBondContact O-N 3.24Å; R15-E17 PolarHBondContact O-N 2.92Å; E17-A20 PolarHBondContact O-N 3.04Å; E17-A21 PolarHBondContact O-N 3.36Å
18	T	91.9	Very high	91.9	Very high	14 Å²	14	58.8 Å²	58.8	9%	0.086	29%	0.294	C	S	.	.	H	α-helix	trans	-61.4	-46.8	175.7	-53.4	0	0	0	0	110.9	L10 Q14 R15 A20 A21 V22 T62 F64	L10-T18 HydrophobicContact CD1-CG2 4.1Å; Q14-T18 PolarHBondContact O-N 3.2Å; Q14-T18 PolarHBondContact O-OG1 2.76Å; R15-T18 PolarHBondContact O-N 2.98Å; T18-A20 VanDerWaalsContact C-N 3.31Å; T18-A20 PolarHBondContact O-N 3.49Å; T18-A21 PolarHBondContact O-N 3.33Å; T18-V22 WeakPolarHBondContact O-CG2 3.4Å; T18-V22 PolarHBondContact O-N 3.09Å; T18-T62 HydrophobicContact CG2-CG2 4.46Å; T18-F64 HydrophobicContact CG2-CE2 3.5Å; T18-F64 VanDerWaalsContact CG2-CE2 3.5Å; T18-F64 HydrophobicContact CG2-CZ 3.57Å
19	A	91	Very high	91.8	Very high	62 Å²	62	58.6 Å²	58.6	51%	0.512	29%	0.293	S	S	.	.	H	α-helix	trans	-61.4	-39.8	177.2	0	0	0	0	0	111.9	R15 P16 R23	R15-A19 WeakPolarHBondContact O-CB 3.28Å; R15-A19 PolarHBondContact O-N 3.17Å; P16-A19 PolarHBondContact O-N 3.36Å; A19-R23 VanDerWaalsContact O-CB 3.25Å; A19-R23 WeakPolarHBondContact O-CB 3.37Å; A19-R23 PolarHBondContact O-N 3.5Å
20	A	93.3	Very high	91.6	Very high	46 Å²	46	63.2 Å²	63.2	38%	0.38	32%	0.316	S	S	.	.	H	α-helix	trans	-66.3	-40.2	175.9	0	0	0	0	0	112.7	P16 E17 T18 R23 R24	P16-A20 WeakPolarHBondContact O-CB 3.11Å; P16-A20 PolarHBondContact O-N 3.07Å; E17-A20 PolarHBondContact O-N 3.04Å; T18-A20 VanDerWaalsContact C-N 3.31Å; T18-A20 PolarHBondContact O-N 3.49Å; A20-R23 PolarHBondContact O-N 3.23Å; A20-R24 WeakPolarHBondContact O-CB 3.38Å; A20-R24 VanDerWaalsContact O-CG 3.32Å; A20-R24 WeakPolarHBondContact O-CG 3.48Å; A20-R24 PolarHBondContact O-N 3.32Å; A20-R24 PolarHBondContact O-NE 2.86Å
21	A	91.9	Very high	91.5	Very high	0 Å²	0	70.8 Å²	70.8	0%	0	35%	0.351	C	S	.	.	H	α-helix	trans	-64.5	-45.4	175.4	0	0	0	0	0	112.1	L10 M13 E17 T18 R23 R24 T25 D87	L10-A21 HydrophobicContact CD1-CB 4.15Å; M13-A21 HydrophobicContact CE-CB 4.12Å; E17-A21 PolarHBondContact O-N 3.36Å; T18-A21 PolarHBondContact O-N 3.33Å; A21-R23 PolarHBondContact O-N 2.86Å; A21-R24 PolarHBondContact O-N 3.38Å; A21-T25 PolarHBondContact O-N 3.12Å; A21-T25 PolarHBondContact O-OG1 3.38Å; A21-D87 HydrophobicContact CB-CB 4.26Å
22	V	91.8	Very high	91.2	Very high	23 Å²	23	72.9 Å²	72.9	14%	0.139	36%	0.358	C	S	.	.	H	α-helix	trans	-61	-46.6	175.8	171.9	0	0	0	0	110.8	L10 T18 R24 T25 V26 L39 F64	L10-V22 HydrophobicContact CD1-CG2 3.8Å; T18-V22 WeakPolarHBondContact O-CG2 3.4Å; T18-V22 PolarHBondContact O-N 3.09Å; V22-R24 PolarHBondContact O-N 3.09Å; V22-T25 WeakPolarHBondContact O-CB 3.44Å; V22-T25 PolarHBondContact O-N 3.21Å; V22-V26 HydrophobicContact CG1-CG2 4.42Å; V22-V26 WeakPolarHBondContact O-CG2 3.34Å; V22-V26 PolarHBondContact O-N 3.34Å; V22-L39 HydrophobicContact CG1-CD1 3.5Å; V22-L39 VanDerWaalsContact CG1-CD1 3.5Å; V22-F64 HydrophobicContact CG2-CD1 4.15Å; V22-F64 HydrophobicContact CG2-CD2 4.12Å; V22-F64 HydrophobicContact CG2-CE1 3.98Å; V22-F64 HydrophobicContact CG2-CE2 3.95Å; V22-F64 HydrophobicContact CG2-CG 4.22Å; V22-F64 HydrophobicContact CG2-CZ 3.88Å
23	R	92.6	Very high	91.1	Very high	167 Å²	167	72.8 Å²	72.8	63%	0.63	36%	0.361	S	S	*	.	H	α-helix	trans	-58.3	-49.3	178.2	-178.8	176.9	171.5	-179.5	-1.5	112.1	A19 A20 A21 T25 V26 E27	A19-R23 VanDerWaalsContact O-CB 3.25Å; A19-R23 WeakPolarHBondContact O-CB 3.37Å; A19-R23 PolarHBondContact O-N 3.5Å; A20-R23 PolarHBondContact O-N 3.23Å; A21-R23 PolarHBondContact O-N 2.86Å; R23-T25 VanDerWaalsContact C-N 3.27Å; R23-T25 PolarHBondContact O-N 2.94Å; R23-V26 PolarHBondContact O-N 2.82Å; R23-E27 HydrophobicContact CG-CG 4.35Å; R23-E27 WeakPolarHBondContact CG-OE1 3.48Å; R23-E27 IonicContact CZ-OE1 3.47Å; R23-E27 IonicContact NE-OE1 2.77Å; R23-E27 PolarHBondContact NE-OE1 3.39Å; R23-E27 IonicContact NH2-OE1 3.27Å; R23-E27 PolarHBondContact NH2-OE1 3.45Å; R23-E27 WeakPolarHBondContact O-CB 3.5Å; R23-E27 WeakPolarHBondContact O-CG 3.38Å; R23-E27 PolarHBondContact O-N 3.48Å
24	R	92.6	Very high	91.1	Very high	102 Å²	102	71.8 Å²	71.8	39%	0.385	36%	0.357	S	S	.	.	H	α-helix	trans	-56.5	-41.3	175.8	-76.3	-179.3	-71.6	156.7	-5.4	112.3	A20 A21 V22 T28 D87	A20-R24 WeakPolarHBondContact O-CB 3.38Å; A20-R24 VanDerWaalsContact O-CG 3.32Å; A20-R24 WeakPolarHBondContact O-CG 3.48Å; A20-R24 PolarHBondContact O-N 3.32Å; A20-R24 PolarHBondContact O-NE 2.86Å; A21-R24 PolarHBondContact O-N 3.38Å; V22-R24 PolarHBondContact O-N 3.09Å; R24-T28 WeakPolarHBondContact O-CB 3.38Å; R24-T28 PolarHBondContact O-N 2.98Å; R24-T28 PolarHBondContact O-OG1 3.33Å; R24-D87 IonicContact CZ-OD2 2.74Å; R24-D87 IonicContact NH1-OD2 2.75Å; R24-D87 IonicContact NH2-OD2 2.84Å; R24-D87 PolarHBondContact NH2-OD2 3.13Å
25	T	91.5	Very high	91.1	Very high	3 Å²	3	69.5 Å²	69.5	2%	0.018	35%	0.353	C	S	.	.	H	α-helix	trans	-65.2	-44.7	179	-57.2	0	0	0	0	111.5	L6 L8 A21 V22 R23 T28 L29 L82	L6-T25 HydrophobicContact CD2-CG2 4.34Å; L8-T25 HydrophobicContact CD1-CG2 3.8Å; A21-T25 PolarHBondContact O-N 3.12Å; A21-T25 PolarHBondContact O-OG1 3.38Å; V22-T25 WeakPolarHBondContact O-CB 3.44Å; V22-T25 PolarHBondContact O-N 3.21Å; R23-T25 VanDerWaalsContact C-N 3.27Å; R23-T25 PolarHBondContact O-N 2.94Å; T25-T28 PolarHBondContact O-N 3.19Å; T25-L29 HydrophobicContact CG2-CD1 4.44Å; T25-L29 WeakPolarHBondContact O-CG 3.41Å; T25-L29 PolarHBondContact O-N 2.88Å; T25-L82 HydrophobicContact CG2-CD2 3.77Å
26	V	91.8	Very high	91.3	Very high	28 Å²	28	60.9 Å²	60.9	17%	0.17	33%	0.325	C	S	.	.	H	α-helix	trans	-67	-43.4	177.8	171.4	0	0	0	0	111.3	V22 R23 T28 L29 M30 V36 L39	V22-V26 HydrophobicContact CG1-CG2 4.42Å; V22-V26 WeakPolarHBondContact O-CG2 3.34Å; V22-V26 PolarHBondContact O-N 3.34Å; R23-V26 PolarHBondContact O-N 2.82Å; V26-T28 VanDerWaalsContact C-N 3.34Å; V26-T28 PolarHBondContact O-N 3.05Å; V26-L29 WeakPolarHBondContact O-CB 3.48Å; V26-L29 PolarHBondContact O-N 2.85Å; V26-M30 HydrophobicContact CG1-CG 4.46Å; V26-M30 HydrophobicContact CG1-SD 4.02Å; V26-M30 WeakPolarHBondContact O-CG 3.43Å; V26-M30 PolarHBondContact O-N 3.17Å; V26-V36 HydrophobicContact CG1-CG2 4.28Å; V26-L39 HydrophobicContact CG2-CD1 3.91Å
27	E	92.9	Very high	91.3	Very high	74 Å²	74	63.3 Å²	63.3	35%	0.346	32%	0.322	S	S	.	.	H	α-helix	trans	-58.1	-47.4	175.5	-75.2	170.3	172.5	0	0	110.6	R23 L29 M30 E31	R23-E27 HydrophobicContact CG-CG 4.35Å; R23-E27 WeakPolarHBondContact CG-OE1 3.48Å; R23-E27 IonicContact CZ-OE1 3.47Å; R23-E27 IonicContact NE-OE1 2.77Å; R23-E27 PolarHBondContact NE-OE1 3.39Å; R23-E27 IonicContact NH2-OE1 3.27Å; R23-E27 PolarHBondContact NH2-OE1 3.45Å; R23-E27 WeakPolarHBondContact O-CB 3.5Å; R23-E27 WeakPolarHBondContact O-CG 3.38Å; R23-E27 PolarHBondContact O-N 3.48Å; E27-L29 VanDerWaalsContact C-N 3.31Å; E27-L29 PolarHBondContact O-N 3.1Å; E27-M30 PolarHBondContact O-N 2.98Å; E27-M30 VanDerWaalsContact O-N 3.1Å; E27-E31 WeakPolarHBondContact O-CG 3.18Å; E27-E31 PolarHBondContact O-N 3.46Å
28	T	91.2	Very high	91.3	Very high	14 Å²	14	62.7 Å²	62.7	9%	0.086	32%	0.322	C	S	.	.	H	α-helix	trans	-60.6	-38.1	176.6	-57.3	0	0	0	0	112.8	R24 T25 V26 R32 H81	R24-T28 WeakPolarHBondContact O-CB 3.38Å; R24-T28 PolarHBondContact O-N 2.98Å; R24-T28 PolarHBondContact O-OG1 3.33Å; T25-T28 PolarHBondContact O-N 3.19Å; V26-T28 VanDerWaalsContact C-N 3.34Å; V26-T28 PolarHBondContact O-N 3.05Å; T28-R32 WeakPolarHBondContact O-CD 3.35Å; T28-R32 VanDerWaalsContact O-CG 3.28Å; T28-R32 WeakPolarHBondContact O-CG 3.27Å; T28-R32 PolarHBondContact O-N 3.12Å; T28-H81 PolarHBondContact OG1-NE2 2.93Å
29	L	90.2	Very high	91.4	Very high	2 Å²	2	65.3 Å²	65.3	1%	0.01	34%	0.335	C	S	.	.	H	α-helix	trans	-61.8	-48	174.3	-81.8	165.9	0	0	0	110.5	L6 T25 V26 E27 R32 A34 V36 V66 F68 L78	L6-L29 HydrophobicContact CD2-CD1 4.34Å; T25-L29 HydrophobicContact CG2-CD1 4.44Å; T25-L29 WeakPolarHBondContact O-CG 3.41Å; T25-L29 PolarHBondContact O-N 2.88Å; V26-L29 WeakPolarHBondContact O-CB 3.48Å; V26-L29 PolarHBondContact O-N 2.85Å; E27-L29 VanDerWaalsContact C-N 3.31Å; E27-L29 PolarHBondContact O-N 3.1Å; L29-R32 PolarHBondContact O-N 3.28Å; L29-A34 HydrophobicContact CB-CB 4.21Å; L29-A34 HydrophobicContact CD2-CB 4.09Å; L29-A34 WeakPolarHBondContact O-CB 3.42Å; L29-A34 PolarHBondContact O-N 2.97Å; L29-V36 HydrophobicContact CB-CG2 4.34Å; L29-V36 HydrophobicContact CD1-CG2 4.37Å; L29-V66 HydrophobicContact CD1-CG1 4.11Å; L29-F68 HydrophobicContact CD2-CD2 3.97Å; L29-F68 HydrophobicContact CD2-CE2 3.91Å; L29-F68 HydrophobicContact CD2-CG 4.38Å; L29-F68 HydrophobicContact CD2-CZ 4.35Å; L29-L78 HydrophobicContact CD2-CD1 3.62Å; L29-L78 HydrophobicContact CD2-CD2 3.46Å; L29-L78 VanDerWaalsContact CD2-CD2 3.46Å; L29-L78 HydrophobicContact CD2-CG 4.17Å; L29-L78 HydrophobicContact CG-CD1 3.98Å
30	M	90.3	Very high	91.5	Very high	119 Å²	119	67.3 Å²	67.3	59%	0.586	33%	0.333	S	S	*	.	H	α-helix	trans	-66.6	-42.4	-178.4	-67.8	179.3	72	0	0	112.5	V26 E27 R32 G33 V36	V26-M30 HydrophobicContact CG1-CG 4.46Å; V26-M30 HydrophobicContact CG1-SD 4.02Å; V26-M30 WeakPolarHBondContact O-CG 3.43Å; V26-M30 PolarHBondContact O-N 3.17Å; E27-M30 PolarHBondContact O-N 2.98Å; E27-M30 VanDerWaalsContact O-N 3.1Å; M30-R32 PolarHBondContact O-N 3.35Å; M30-G33 PolarHBondContact O-N 2.7Å; M30-V36 HydrophobicContact CG-CG2 4.48Å
31	E	91.4	Very high	91.5	Very high	160 Å²	160	69.6 Å²	69.6	75%	0.748	34%	0.339	S	S	*	.	H	α-helix	trans	-57.7	-31.8	177.2	-76.5	175.4	-179.7	0	0	112.8	E27 G33	E27-E31 WeakPolarHBondContact O-CG 3.18Å; E27-E31 PolarHBondContact O-N 3.46Å; E31-G33 VanDerWaalsContact C-N 3.28Å; E31-G33 PolarHBondContact O-N 2.84Å
32	R	87.4	Confident	91.5	Very high	87 Å²	87	73 Å²	73	33%	0.328	36%	0.356	S	S	.	.	T	Hydrogen-bonded Turn	trans	-87.2	2.6	179.9	-63.8	171.7	-172.9	-137.2	2.3	113.3	T28 L29 M30 I74 G77 L78	T28-R32 WeakPolarHBondContact O-CD 3.35Å; T28-R32 VanDerWaalsContact O-CG 3.28Å; T28-R32 WeakPolarHBondContact O-CG 3.27Å; T28-R32 PolarHBondContact O-N 3.12Å; L29-R32 PolarHBondContact O-N 3.28Å; M30-R32 PolarHBondContact O-N 3.35Å; R32-I74 HydrophobicContact CB-CG2 3.61Å; R32-I74 HydrophobicContact CG-CG2 4.41Å; R32-I74 WeakPolarHBondContact O-CD1 3.33Å; R32-G77 PolarHBondContact NH1-O 2.79Å; R32-L78 VanDerWaalsContact NH1-N 3.14Å
33	G	87.8	Confident	91.5	Very high	46 Å²	46	73.1 Å²	73.1	47%	0.474	36%	0.362	S	S	.	.	T	Hydrogen-bonded Turn	trans	84.5	22.6	-179.8	0	0	0	0	0	114.1	M30 E31	M30-G33 PolarHBondContact O-N 2.7Å; E31-G33 VanDerWaalsContact C-N 3.28Å; E31-G33 PolarHBondContact O-N 2.84Å
34	A	91.1	Very high	91.5	Very high	5 Å²	5	69 Å²	69	4%	0.041	35%	0.35	C	S	.	.			trans	-84.9	142.5	167.8	0	0	0	0	0	111.1	L29 F68 Y69 C70	L29-A34 HydrophobicContact CB-CB 4.21Å; L29-A34 HydrophobicContact CD2-CB 4.09Å; L29-A34 WeakPolarHBondContact O-CB 3.42Å; L29-A34 PolarHBondContact O-N 2.97Å; A34-F68 HydrophobicContact CB-CD2 4.01Å; A34-Y69 CarbonylContact C-O 3.55Å; A34-Y69 VanDerWaalsContact CA-O 3.27Å; A34-Y69 WeakPolarHBondContact CA-O 3.31Å; A34-C70 HydrophobicContact CB-CB 3.9Å
35	V	92	Very high	91.5	Very high	87 Å²	87	70.8 Å²	70.8	53%	0.527	36%	0.357	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.8	110.9	176.4	-178.2	0	0	0	0	108.9	F68 Y69	V35-F68 CarbonylContact O-C 3.58Å; V35-F68 VanDerWaalsContact O-CA 3.23Å; V35-F68 WeakPolarHBondContact O-CA 3.36Å; V35-F68 WeakPolarHBondContact O-CB 3.45Å; V35-Y69 PolarHBondContact N-O 2.69Å; V35-Y69 PolarHBondContact O-N 3.46Å
36	V	92.4	Very high	91.6	Very high	45 Å²	45	77 Å²	77	27%	0.273	39%	0.389	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79	129.2	178.3	-177.4	0	0	0	0	109.7	V26 L29 M30 V66 F68	V26-V36 HydrophobicContact CG1-CG2 4.28Å; L29-V36 HydrophobicContact CB-CG2 4.34Å; L29-V36 HydrophobicContact CD1-CG2 4.37Å; M30-V36 HydrophobicContact CG-CG2 4.48Å; V36-V66 HydrophobicContact CG1-CG1 3.98Å; V36-F68 HydrophobicContact CG2-CB 4.38Å
37	R	91.7	Very high	91.7	Very high	146 Å²	146	76.3 Å²	76.3	55%	0.551	38%	0.384	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-101.8	-45.8	-178.5	-177.1	-179.6	-179.2	164.9	-2.2	112.2	D67 Y69	R37-D67 HydrophobicContact CB-CB 4.32Å; R37-D67 PolarHBondContact N-O 3.01Å; R37-Y69 HydrophobicContact CB-CE2 4.47Å; R37-Y69 PolarHBondContact NH1-OH 2.9Å
38	N	91.9	Very high	91.7	Very high	86 Å²	86	78.4 Å²	78.4	46%	0.46	40%	0.404	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.5	150.9	-177.6	-165.7	26.5	0	0	0	110.7	D67	N38-D67 HydrophobicContact CB-CB 4.05Å; N38-D67 PolarHBondContact N-O 3.45Å; N38-D67 PolarHBondContact O-N 2.87Å
39	L	93.2	Very high	91.8	Very high	69 Å²	69	84.1 Å²	84.1	36%	0.361	43%	0.425	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134	119.6	174.1	-172.6	154.7	0	0	0	108.4	V22 V26 F64 L65 V66	V22-L39 HydrophobicContact CG1-CD1 3.5Å; V22-L39 VanDerWaalsContact CG1-CD1 3.5Å; V26-L39 HydrophobicContact CG2-CD1 3.91Å; L39-F64 HydrophobicContact CD2-CD1 4.19Å; L39-L65 WeakPolarHBondContact CA-O 3.23Å; L39-V66 HydrophobicContact CD1-CG2 4.4Å; L39-V66 HydrophobicContact CG-CG2 4.34Å
40	E	93.8	Very high	91.9	Very high	104 Å²	104	89.7 Å²	89.7	49%	0.486	45%	0.449	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.3	135.7	-178.6	-171.6	176.3	172.5	0	0	110.6	F64 L65	E40-F64 WeakPolarHBondContact O-CA 3.47Å; E40-L65 HydrophobicContact CB-CB 4.3Å; E40-L65 PolarHBondContact N-O 2.98Å; E40-L65 PolarHBondContact O-N 2.8Å
41	N	92.7	Very high	92.1	Very high	95 Å²	95	85.1 Å²	85.1	51%	0.508	43%	0.427	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.8	113.8	176.8	-177.6	0.4	0	0	0	109.5	G43 F64	N41-G43 VanDerWaalsContact C-N 3.3Å; N41-G43 WeakPolarHBondContact OD1-CA 2.95Å; N41-G43 PolarHBondContact OD1-N 2.79Å; N41-F64 HydrophobicContact CB-CD1 4.02Å; N41-F64 HydrophobicContact CB-CE1 3.66Å; N41-F64 VanDerWaalsContact CG-CE1 3.48Å
42	M	92.1	Very high	92.1	Very high	71 Å²	71	82.4 Å²	82.4	35%	0.35	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.1	-4.2	178.8	-62.2	-175.8	76.6	0	0	113.2	R45 Y63 L65	M42-R45 PolarHBondContact O-NE 2.99Å; M42-R45 PolarHBondContact O-NH2 2.86Å; M42-Y63 PolarHBondContact N-O 3.15Å; M42-L65 HydrophobicContact CG-CD1 4.17Å; M42-L65 HydrophobicContact CG-CG 4.24Å; M42-L65 HydrophobicContact SD-CD1 3.72Å; M42-L65 HydrophobicContact SD-CD2 4.32Å; M42-L65 HydrophobicContact SD-CG 3.82Å
43	G	90.6	Very high	92.2	Very high	25 Å²	25	80.2 Å²	80.2	26%	0.258	42%	0.415	S	S	.	.	E	Extended strand (participates in β ladder)	trans	87.6	177.9	179.5	0	0	0	0	0	114.1	N41 Y63	N41-G43 VanDerWaalsContact C-N 3.3Å; N41-G43 WeakPolarHBondContact OD1-CA 2.95Å; N41-G43 PolarHBondContact OD1-N 2.79Å; G43-Y63 PolarHBondContact O-N 3.5Å
44	E	92.9	Very high	92.3	Very high	82 Å²	82	81.6 Å²	81.6	38%	0.383	41%	0.408	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.6	126.8	175.4	-163	-164.9	142.7	0	0	110.2	A12 R60 G61	A12-E44 HydrophobicContact CB-CG 4.42Å; A12-E44 WeakPolarHBondContact CB-OE1 3.43Å; E44-R60 VanDerWaalsContact CD-NH2 3.29Å; E44-R60 IonicContact OE1-CZ 2.69Å; E44-R60 IonicContact OE1-NE 3.77Å; E44-R60 PolarHBondContact OE1-NE 2.77Å; E44-R60 IonicContact OE1-NH2 2.76Å; E44-R60 PolarHBondContact OE1-NH2 2.95Å; E44-R60 IonicContact OE2-NH2 3.63Å; E44-G61 WeakPolarHBondContact CA-O 3.37Å
45	R	92.9	Very high	92.2	Very high	139 Å²	139	89.6 Å²	89.6	53%	0.525	45%	0.45	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.7	160.2	-179.7	-57.5	-177	-172.5	-164.5	0	110.9	M42 G61 Y63	M42-R45 PolarHBondContact O-NE 2.99Å; M42-R45 PolarHBondContact O-NH2 2.86Å; R45-G61 PolarHBondContact N-O 3.16Å; R45-G61 PolarHBondContact O-N 2.96Å; R45-G61 VanDerWaalsContact O-O 3.11Å; R45-Y63 HydrophobicContact CB-CD2 4.08Å; R45-Y63 HydrophobicContact CB-CE2 3.87Å; R45-Y63 HydrophobicContact CG-CD2 4.4Å
46	L	93.5	Very high	92.1	Very high	132 Å²	132	90.1 Å²	90.1	69%	0.691	45%	0.447	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-67.4	134.8	169.1	-75.7	161.8	0	0	0	109.4	R60	L46-R60 HydrophobicContact CD2-CG 3.51Å; L46-R60 HydrophobicContact CG-CG 4.26Å
47	L	93.1	Very high	92.1	Very high	15 Å²	15	95.6 Å²	95.6	8%	0.079	46%	0.463	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.6	143.1	174.2	-61.4	173.6	0	0	0	108.8	I9 Y49 I51 H58 S59 Y63	I9-L47 HydrophobicContact CG2-CD2 3.78Å; L47-Y49 VanDerWaalsContact CB-O 3.26Å; L47-Y49 WeakPolarHBondContact CB-O 3.36Å; L47-Y49 PolarHBondContact O-N 3.29Å; L47-Y49 VanDerWaalsContact O-N 3.11Å; L47-I51 HydrophobicContact CD1-CB 4.32Å; L47-I51 HydrophobicContact CD1-CD1 4Å; L47-I51 HydrophobicContact CD1-CG1 4.09Å; L47-H58 HydrophobicContact CD1-CB 3.97Å; L47-S59 PolarHBondContact N-O 3.27Å; L47-Y63 HydrophobicContact CD2-CE2 4.25Å; L47-Y63 WeakPolarHBondContact CD2-OH 3.47Å
48	P	93	Very high	92.2	Very high	118 Å²	118	89 Å²	89	77%	0.766	44%	0.438	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-58.3	-27.4	178.5	-24.7	33.5	0	0	0	113.3
49	Y	94.5	Very high	92.2	Very high	133 Å²	133	87.3 Å²	87.3	52%	0.522	43%	0.433	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.3	162.2	173.9	60.8	-87.4	0	0	0	109.9	L47 I51 R90	L47-Y49 VanDerWaalsContact CB-O 3.26Å; L47-Y49 WeakPolarHBondContact CB-O 3.36Å; L47-Y49 PolarHBondContact O-N 3.29Å; L47-Y49 VanDerWaalsContact O-N 3.11Å; Y49-I51 HydrophobicContact CD2-CG1 4.03Å; Y49-I51 HydrophobicContact CE2-CD1 4.32Å; Y49-I51 HydrophobicContact CE2-CG1 3.65Å; Y49-I51 PolarHBondContact O-N 2.95Å; Y49-R90 PolarHBondContact OH-NH1 2.91Å
50	K	92.4	Very high	92.3	Very high	119 Å²	119	90.2 Å²	90.2	52%	0.517	44%	0.439	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.8	122.3	179.6	-63.3	179.6	179.6	178	0	109.9	R57 H58	K50-R57 HydrophobicContact CB-CG 4.36Å; K50-R57 VanDerWaalsContact CD-CZ 3.45Å; K50-R57 VanDerWaalsContact CD-NH2 3.31Å; K50-H58 WeakPolarHBondContact CA-O 3.48Å
51	I	93.1	Very high	92.3	Very high	24 Å²	24	85.3 Å²	85.3	12%	0.123	42%	0.416	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102	125.7	178.6	-58	179.7	0	0	0	108.2	L47 Y49 H58 V89	L47-I51 HydrophobicContact CD1-CB 4.32Å; L47-I51 HydrophobicContact CD1-CD1 4Å; L47-I51 HydrophobicContact CD1-CG1 4.09Å; Y49-I51 HydrophobicContact CD2-CG1 4.03Å; Y49-I51 HydrophobicContact CE2-CD1 4.32Å; Y49-I51 HydrophobicContact CE2-CG1 3.65Å; Y49-I51 PolarHBondContact O-N 2.95Å; I51-H58 PolarHBondContact N-O 3.2Å; I51-H58 PolarHBondContact O-N 2.85Å; I51-V89 HydrophobicContact CB-CG1 3.97Å; I51-V89 HydrophobicContact CD1-CG1 4Å; I51-V89 HydrophobicContact CG2-CG1 3.74Å
52	T	91.8	Very high	92.4	Very high	103 Å²	103	81.2 Å²	81.2	63%	0.632	40%	0.395	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-99	118.4	170.8	-53.1	0	0	0	0	108.6	E56	T52-E56 CarbonylContact C-O 3.52Å; T52-E56 VanDerWaalsContact CA-O 3.31Å; T52-E56 WeakPolarHBondContact CA-O 3.5Å
53	K	90	Very high	92.5	Very high	41 Å²	41	80.1 Å²	80.1	18%	0.178	39%	0.387	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.9	148	175.5	-160.4	-180	172.3	-144.7	0	109.5	N55 E56 V88 V89	K53-N55 PolarHBondContact O-N 3.33Å; K53-N55 VanDerWaalsContact O-N 3.17Å; K53-E56 PolarHBondContact N-O 3.01Å; K53-E56 PolarHBondContact O-N 3.04Å; K53-E56 VanDerWaalsContact O-O 3.06Å; K53-V88 PolarHBondContact NZ-O 2.88Å; K53-V89 WeakPolarHBondContact CD-O 3.43Å
54	H	90.3	Very high	92.7	Very high	75 Å²	75	79.6 Å²	79.6	35%	0.347	38%	0.378	S	S	.	.	T	Hydrogen-bonded Turn	trans	51.8	39.2	-179.8	-57.3	-66.9	0	0	0	113.8	E56 H83 D85	H54-E56 PolarHBondContact O-N 2.84Å; H54-E56 VanDerWaalsContact O-N 3.16Å; H54-H83 PolarHBondContact CE1-O 2.92Å; H54-H83 VanDerWaalsContact CE1-O 3.23Å; H54-D85 PolarHBondContact NE2-O 3.19Å; H54-D85 VanDerWaalsContact NE2-O 3.12Å
55	N	88.9	Confident	92.7	Very high	172 Å²	172	77.4 Å²	77.4	92%	0.92	37%	0.368	S	S	*	.	T	Hydrogen-bonded Turn	trans	59.9	13.8	-175.1	-65.8	-15.6	0	0	0	115.6	K53	K53-N55 PolarHBondContact O-N 3.33Å; K53-N55 VanDerWaalsContact O-N 3.17Å
56	E	89.9	Confident	92.8	Very high	98 Å²	98	70.9 Å²	70.9	46%	0.458	34%	0.344	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.9	147.8	175.2	-161	-174.3	149.6	0	0	110.6	T52 K53 H54 H58	T52-E56 CarbonylContact C-O 3.52Å; T52-E56 VanDerWaalsContact CA-O 3.31Å; T52-E56 WeakPolarHBondContact CA-O 3.5Å; K53-E56 PolarHBondContact N-O 3.01Å; K53-E56 PolarHBondContact O-N 3.04Å; K53-E56 VanDerWaalsContact O-O 3.06Å; H54-E56 PolarHBondContact O-N 2.84Å; H54-E56 VanDerWaalsContact O-N 3.16Å; E56-H58 VanDerWaalsContact CD-CE1 3.4Å; E56-H58 IonicContact OE1-CE1 3.5Å; E56-H58 IonicContact OE1-ND1 3.55Å; E56-H58 IonicContact OE2-CE1 3.64Å; E56-H58 PolarHBondContact OE2-CE1 3.01Å
57	R	91.8	Very high	92.8	Very high	160 Å²	160	65.2 Å²	65.2	60%	0.604	32%	0.315	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-105.5	106.6	177.6	-168.3	179.1	-169.5	-179.9	4.2	110.1	K50	K50-R57 HydrophobicContact CB-CG 4.36Å; K50-R57 VanDerWaalsContact CD-CZ 3.45Å; K50-R57 VanDerWaalsContact CD-NH2 3.31Å
58	H	92.9	Very high	92.8	Very high	7 Å²	7	64.5 Å²	64.5	3%	0.032	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.5	127.9	-179.4	-50.1	-72.3	0	0	0	110.7	L47 K50 I51 E56 V89	L47-H58 HydrophobicContact CD1-CB 3.97Å; K50-H58 WeakPolarHBondContact CA-O 3.48Å; I51-H58 PolarHBondContact N-O 3.2Å; I51-H58 PolarHBondContact O-N 2.85Å; E56-H58 VanDerWaalsContact CD-CE1 3.4Å; E56-H58 IonicContact OE1-CE1 3.5Å; E56-H58 IonicContact OE1-ND1 3.55Å; E56-H58 IonicContact OE2-CE1 3.64Å; E56-H58 PolarHBondContact OE2-CE1 3.01Å; H58-V89 HydrophobicContact CB-CG1 4.33Å; H58-V89 HydrophobicContact CB-CG2 4.25Å
59	S	93.6	Very high	92.7	Very high	51 Å²	51	61.6 Å²	61.6	36%	0.357	29%	0.285	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.3	-18.3	171	-54.7	0	0	0	0	112.4	L47	L47-S59 PolarHBondContact N-O 3.27Å
60	R	93.6	Very high	92.6	Very high	131 Å²	131	55.3 Å²	55.3	49%	0.494	26%	0.261	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.1	151	178.3	-69.1	173.4	64.9	157.1	-0.9	108.6	A12 E44 L46	A12-R60 HydrophobicContact CB-CB 4.03Å; E44-R60 VanDerWaalsContact CD-NH2 3.29Å; E44-R60 IonicContact OE1-CZ 2.69Å; E44-R60 IonicContact OE1-NE 3.77Å; E44-R60 PolarHBondContact OE1-NE 2.77Å; E44-R60 IonicContact OE1-NH2 2.76Å; E44-R60 PolarHBondContact OE1-NH2 2.95Å; E44-R60 IonicContact OE2-NH2 3.63Å; L46-R60 HydrophobicContact CD2-CG 3.51Å; L46-R60 HydrophobicContact CG-CG 4.26Å
61	G	94	Very high	92.5	Very high	0 Å²	0	51.3 Å²	51.3	0%	0	25%	0.249	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-154.6	155.6	176.1	0	0	0	0	0	111.8	L10 E44 R45	L10-G61 CarbonylContact O-C 3.59Å; L10-G61 WeakPolarHBondContact O-CA 3.44Å; E44-G61 WeakPolarHBondContact CA-O 3.37Å; R45-G61 PolarHBondContact N-O 3.16Å; R45-G61 PolarHBondContact O-N 2.96Å; R45-G61 VanDerWaalsContact O-O 3.11Å
62	T	94.9	Very high	92.2	Very high	9 Å²	9	53.8 Å²	53.8	6%	0.055	27%	0.267	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.7	126	176.1	-47.9	0	0	0	0	109.3	L10 T18 F64	L10-T62 PolarHBondContact N-O 3.27Å; L10-T62 PolarHBondContact O-N 2.91Å; T18-T62 HydrophobicContact CG2-CG2 4.46Å; T62-F64 HydrophobicContact CG2-CD2 4.05Å; T62-F64 HydrophobicContact CG2-CE2 3.31Å; T62-F64 HydrophobicContact CG2-CZ 3.85Å
63	Y	94.6	Very high	92.1	Very high	48 Å²	48	53.5 Å²	53.5	19%	0.188	27%	0.27	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.5	126.5	-175.8	-72.7	-98	0	0	0	110.5	I9 M42 G43 R45 L47	I9-Y63 HydrophobicContact CD1-CD1 4.3Å; I9-Y63 HydrophobicContact CD1-CE1 3.62Å; I9-Y63 HydrophobicContact CG1-CD1 3.97Å; I9-Y63 HydrophobicContact CG1-CE1 3.81Å; M42-Y63 PolarHBondContact N-O 3.15Å; G43-Y63 PolarHBondContact O-N 3.5Å; R45-Y63 HydrophobicContact CB-CD2 4.08Å; R45-Y63 HydrophobicContact CB-CE2 3.87Å; R45-Y63 HydrophobicContact CG-CD2 4.4Å; L47-Y63 HydrophobicContact CD2-CE2 4.25Å; L47-Y63 WeakPolarHBondContact CD2-OH 3.47Å
64	F	94.6	Very high	92	Very high	14 Å²	14	53.3 Å²	53.3	6%	0.061	27%	0.27	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127	140.2	174.9	-72.6	-85	0	0	0	110.4	L8 L10 T18 V22 L39 E40 N41 T62	L8-F64 HydrophobicContact CB-CB 4.14Å; L8-F64 PolarHBondContact N-O 3.44Å; L8-F64 PolarHBondContact O-N 3.41Å; L10-F64 HydrophobicContact CD1-CD2 3.76Å; L10-F64 HydrophobicContact CD1-CE2 3.74Å; L10-F64 HydrophobicContact CG-CD2 4.17Å; L10-F64 HydrophobicContact CG-CE2 4.48Å; T18-F64 HydrophobicContact CG2-CE2 3.5Å; T18-F64 VanDerWaalsContact CG2-CE2 3.5Å; T18-F64 HydrophobicContact CG2-CZ 3.57Å; V22-F64 HydrophobicContact CG2-CD1 4.15Å; V22-F64 HydrophobicContact CG2-CD2 4.12Å; V22-F64 HydrophobicContact CG2-CE1 3.98Å; V22-F64 HydrophobicContact CG2-CE2 3.95Å; V22-F64 HydrophobicContact CG2-CG 4.22Å; V22-F64 HydrophobicContact CG2-CZ 3.88Å; L39-F64 HydrophobicContact CD2-CD1 4.19Å; E40-F64 WeakPolarHBondContact O-CA 3.47Å; N41-F64 HydrophobicContact CB-CD1 4.02Å; N41-F64 HydrophobicContact CB-CE1 3.66Å; N41-F64 VanDerWaalsContact CG-CE1 3.48Å; T62-F64 HydrophobicContact CG2-CD2 4.05Å; T62-F64 HydrophobicContact CG2-CE2 3.31Å; T62-F64 HydrophobicContact CG2-CZ 3.85Å
65	L	94.1	Very high	91.9	Very high	36 Å²	36	51 Å²	51	19%	0.188	26%	0.26	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.9	128.3	170.5	-62.9	174.9	0	0	0	108.5	A7 L39 E40 M42	A7-L65 HydrophobicContact CB-CD2 3.84Å; L39-L65 WeakPolarHBondContact CA-O 3.23Å; E40-L65 HydrophobicContact CB-CB 4.3Å; E40-L65 PolarHBondContact N-O 2.98Å; E40-L65 PolarHBondContact O-N 2.8Å; M42-L65 HydrophobicContact CG-CD1 4.17Å; M42-L65 HydrophobicContact CG-CG 4.24Å; M42-L65 HydrophobicContact SD-CD1 3.72Å; M42-L65 HydrophobicContact SD-CD2 4.32Å; M42-L65 HydrophobicContact SD-CG 3.82Å
66	V	93.7	Very high	91.9	Very high	3 Å²	3	48.1 Å²	48.1	2%	0.018	25%	0.245	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-122.1	116.9	177	-175.8	0	0	0	0	108.5	E5 L6 L8 L29 V36 L39 F68	E5-V66 CarbonylContact C-O 3.51Å; E5-V66 WeakPolarHBondContact CA-O 3.32Å; L6-V66 HydrophobicContact CB-CB 4.29Å; L6-V66 PolarHBondContact N-O 2.8Å; L6-V66 PolarHBondContact O-N 2.83Å; L8-V66 HydrophobicContact CD1-CG2 4Å; L29-V66 HydrophobicContact CD1-CG1 4.11Å; V36-V66 HydrophobicContact CG1-CG1 3.98Å; L39-V66 HydrophobicContact CD1-CG2 4.4Å; L39-V66 HydrophobicContact CG-CG2 4.34Å; V66-F68 HydrophobicContact CG1-CD1 4.43Å; V66-F68 WeakPolarHBondContact O-CD1 3.34Å
67	D	93.6	Very high	91.9	Very high	12 Å²	12	44.9 Å²	44.9	6%	0.064	24%	0.237	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-91.5	127	173.3	-86.8	-13.7	0	0	0	109.7	R3 R37 N38 K96	R3-D67 IonicContact CZ-OD2 2.72Å; R3-D67 IonicContact NH2-OD2 2.7Å; R3-D67 PolarHBondContact NH2-OD2 2.96Å; R37-D67 HydrophobicContact CB-CB 4.32Å; R37-D67 PolarHBondContact N-O 3.01Å; N38-D67 HydrophobicContact CB-CB 4.05Å; N38-D67 PolarHBondContact N-O 3.45Å; N38-D67 PolarHBondContact O-N 2.87Å; D67-K96 IonicContact OD1-NZ 3.03Å; D67-K96 PolarHBondContact OD1-NZ 2.82Å; D67-K96 IonicContact OD2-NZ 3.62Å; D67-K96 PolarHBondContact OD2-NZ 2.88Å
68	F	92.9	Very high	91.8	Very high	0 Å²	0	37.3 Å²	37.3	0%	0	21%	0.209	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-150.4	157.9	-179.3	65.4	-74.1	0	0	0	112.9	Y4 L6 L29 A34 V35 V36 V66 C70 L75 L78 V93	Y4-F68 PolarHBondContact N-O 2.72Å; Y4-F68 PolarHBondContact O-N 3Å; Y4-F68 VanDerWaalsContact O-O 3.07Å; L6-F68 HydrophobicContact CB-CD1 4.25Å; L6-F68 HydrophobicContact CB-CE1 3.5Å; L6-F68 VanDerWaalsContact CB-CE1 3.5Å; L6-F68 HydrophobicContact CB-CZ 4.31Å; L29-F68 HydrophobicContact CD2-CD2 3.97Å; L29-F68 HydrophobicContact CD2-CE2 3.91Å; L29-F68 HydrophobicContact CD2-CG 4.38Å; L29-F68 HydrophobicContact CD2-CZ 4.35Å; A34-F68 HydrophobicContact CB-CD2 4.01Å; V35-F68 CarbonylContact O-C 3.58Å; V35-F68 VanDerWaalsContact O-CA 3.23Å; V35-F68 WeakPolarHBondContact O-CA 3.36Å; V35-F68 WeakPolarHBondContact O-CB 3.45Å; V36-F68 HydrophobicContact CG2-CB 4.38Å; V66-F68 HydrophobicContact CG1-CD1 4.43Å; V66-F68 WeakPolarHBondContact O-CD1 3.34Å; F68-C70 HydrophobicContact CD2-CB 3.94Å; F68-C70 HydrophobicContact CE2-CB 3.95Å; F68-C70 WeakPolarHBondContact CE2-SG 3.15Å; F68-L75 HydrophobicContact CZ-CD2 4.43Å; F68-L78 HydrophobicContact CE2-CD2 4.27Å; F68-L78 HydrophobicContact CZ-CD2 4.11Å; F68-V93 HydrophobicContact CZ-CG1 4.48Å
69	Y	92.1	Very high	91.7	Very high	57 Å²	57	39.1 Å²	39.1	22%	0.224	22%	0.219	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-103.5	131.1	168.7	-66.3	-84.5	0	0	0	109	M1 R3 A34 V35 R37	M1-Y69 WeakPolarHBondContact O-CD1 3.36Å; R3-Y69 HydrophobicContact CB-CD1 3.95Å; R3-Y69 HydrophobicContact CB-CE1 3.64Å; R3-Y69 HydrophobicContact CG-CD1 4.29Å; R3-Y69 HydrophobicContact CG-CE1 3.91Å; A34-Y69 CarbonylContact C-O 3.55Å; A34-Y69 VanDerWaalsContact CA-O 3.27Å; A34-Y69 WeakPolarHBondContact CA-O 3.31Å; V35-Y69 PolarHBondContact N-O 2.69Å; V35-Y69 PolarHBondContact O-N 3.46Å; R37-Y69 HydrophobicContact CB-CE2 4.47Å; R37-Y69 PolarHBondContact NH1-OH 2.9Å
70	C	91.1	Very high	91.6	Very high	2 Å²	2	41 Å²	41	1%	0.014	23%	0.225	C	C	.	.			trans	-147.8	164.5	173.1	72.8	0	0	0	0	111.6	P2 Y4 A34 F68 I74	P2-C70 WeakPolarHBondContact CD-O 3.48Å; P2-C70 WeakPolarHBondContact CG-O 3.46Å; P2-C70 PolarHBondContact O-N 2.76Å; Y4-C70 WeakPolarHBondContact CD2-SG 3.48Å; Y4-C70 VanDerWaalsContact CE2-SG 3.58Å; A34-C70 HydrophobicContact CB-CB 3.9Å; F68-C70 HydrophobicContact CD2-CB 3.94Å; F68-C70 HydrophobicContact CE2-CB 3.95Å; F68-C70 WeakPolarHBondContact CE2-SG 3.15Å; C70-I74 HydrophobicContact CB-CD1 4.48Å
71	A	90.4	Very high	91.5	Very high	34 Å²	34	37.9 Å²	37.9	28%	0.281	22%	0.216	S	C	.	.			trans	-75.8	142.3	165.2	0	0	0	0	0	109.9	S73 I74	A71-S73 PolarHBondContact O-N 3.26Å; A71-S73 VanDerWaalsContact O-N 3.13Å; A71-I74 HydrophobicContact CB-CD1 3.94Å; A71-I74 HydrophobicContact CB-CG1 4.46Å; A71-I74 WeakPolarHBondContact O-CB 3.39Å; A71-I74 PolarHBondContact O-N 2.9Å
72	P	87.6	Confident	91.3	Very high	76 Å²	76	37.9 Å²	37.9	49%	0.494	22%	0.216	S	C	.	.	H	α-helix	trans	-60.5	-26.5	-178	23	-32.6	0	0	0	113.1	I74 L75	P72-I74 PolarHBondContact O-N 2.8Å; P72-L75 WeakPolarHBondContact O-CB 3.33Å; P72-L75 PolarHBondContact O-N 2.99Å
73	S	89.3	Confident	91.1	Very high	98 Å²	98	41.9 Å²	41.9	69%	0.685	23%	0.233	S	C	*	.	H	α-helix	trans	-62.5	-22.2	175.7	49.3	0	0	0	0	114.4	A71	A71-S73 PolarHBondContact O-N 3.26Å; A71-S73 VanDerWaalsContact O-N 3.13Å
74	I	88.4	Confident	90.9	Very high	36 Å²	36	49.3 Å²	49.3	19%	0.185	26%	0.261	C	S	.	.	H	α-helix	trans	-84.3	-22.2	-178.3	-61.5	158	0	0	0	111.4	R32 C70 A71 P72 D76 G77 L78	R32-I74 HydrophobicContact CB-CG2 3.61Å; R32-I74 HydrophobicContact CG-CG2 4.41Å; R32-I74 WeakPolarHBondContact O-CD1 3.33Å; C70-I74 HydrophobicContact CB-CD1 4.48Å; A71-I74 HydrophobicContact CB-CD1 3.94Å; A71-I74 HydrophobicContact CB-CG1 4.46Å; A71-I74 WeakPolarHBondContact O-CB 3.39Å; A71-I74 PolarHBondContact O-N 2.9Å; P72-I74 PolarHBondContact O-N 2.8Å; I74-D76 PolarHBondContact O-N 3.5Å; I74-G77 PolarHBondContact O-N 3.49Å; I74-L78 WeakPolarHBondContact O-CB 3.44Å; I74-L78 PolarHBondContact O-N 2.96Å
75	L	88.1	Confident	90.8	Very high	26 Å²	26	49.5 Å²	49.5	14%	0.136	26%	0.263	C	S	.	.	H	α-helix	trans	-60.6	-47.2	-172.4	-73.2	174.4	0	0	0	113	Y4 F68 P72 G77 L78 L79 V93	Y4-L75 HydrophobicContact CD1-CD1 4.27Å; Y4-L75 HydrophobicContact CD1-CD2 4.49Å; Y4-L75 HydrophobicContact CD2-CD2 4.48Å; Y4-L75 HydrophobicContact CE1-CD1 3.69Å; Y4-L75 HydrophobicContact CE2-CD1 4.09Å; Y4-L75 HydrophobicContact CG-CD2 4.4Å; F68-L75 HydrophobicContact CZ-CD2 4.43Å; P72-L75 WeakPolarHBondContact O-CB 3.33Å; P72-L75 PolarHBondContact O-N 2.99Å; L75-G77 VanDerWaalsContact C-N 3.3Å; L75-G77 PolarHBondContact O-N 3.36Å; L75-L78 WeakPolarHBondContact O-CB 3.4Å; L75-L78 PolarHBondContact O-N 3.43Å; L75-L78 VanDerWaalsContact O-N 3.12Å; L75-L79 WeakPolarHBondContact O-CB 3.25Å; L75-L79 WeakPolarHBondContact O-CG 3.44Å; L75-L79 PolarHBondContact O-N 2.88Å; L75-V93 HydrophobicContact CD2-CG1 3.84Å
76	D	89.3	Confident	90.6	Very high	113 Å²	113	51.6 Å²	51.6	60%	0.604	28%	0.277	S	S	*	.	H	α-helix	trans	-60.5	-44.2	179.5	-70.5	-64	0	0	0	111.2	I74 L78 N80	I74-D76 PolarHBondContact O-N 3.5Å; D76-L78 VanDerWaalsContact C-N 3.33Å; D76-L78 PolarHBondContact O-N 3.27Å; D76-N80 WeakPolarHBondContact O-CB 3.45Å; D76-N80 PolarHBondContact O-N 3.42Å; D76-N80 PolarHBondContact O-ND2 3.01Å
77	G	89.5	Confident	90.5	Very high	29 Å²	29	52.3 Å²	52.3	30%	0.299	28%	0.281	S	S	.	.	H	α-helix	trans	-59.8	-45.3	174.8	0	0	0	0	0	111.6	R32 I74 L75 N80 H81	R32-G77 PolarHBondContact NH1-O 2.79Å; I74-G77 PolarHBondContact O-N 3.49Å; L75-G77 VanDerWaalsContact C-N 3.3Å; L75-G77 PolarHBondContact O-N 3.36Å; G77-N80 PolarHBondContact O-N 2.95Å; G77-H81 PolarHBondContact O-N 3.39Å; G77-H81 VanDerWaalsContact O-N 3.09Å
78	L	89.6	Confident	90.5	Very high	2 Å²	2	51.8 Å²	51.8	1%	0.01	28%	0.278	C	S	.	.	H	α-helix	trans	-64.1	-48.3	-177.7	174.9	70.3	0	0	0	110.6	L29 R32 F68 I74 L75 D76 N80 H81 L82	L29-L78 HydrophobicContact CD2-CD1 3.62Å; L29-L78 HydrophobicContact CD2-CD2 3.46Å; L29-L78 VanDerWaalsContact CD2-CD2 3.46Å; L29-L78 HydrophobicContact CD2-CG 4.17Å; L29-L78 HydrophobicContact CG-CD1 3.98Å; R32-L78 VanDerWaalsContact NH1-N 3.14Å; F68-L78 HydrophobicContact CE2-CD2 4.27Å; F68-L78 HydrophobicContact CZ-CD2 4.11Å; I74-L78 WeakPolarHBondContact O-CB 3.44Å; I74-L78 PolarHBondContact O-N 2.96Å; L75-L78 WeakPolarHBondContact O-CB 3.4Å; L75-L78 PolarHBondContact O-N 3.43Å; L75-L78 VanDerWaalsContact O-N 3.12Å; D76-L78 VanDerWaalsContact C-N 3.33Å; D76-L78 PolarHBondContact O-N 3.27Å; L78-N80 VanDerWaalsContact C-N 3.29Å; L78-N80 PolarHBondContact O-N 2.91Å; L78-H81 WeakPolarHBondContact O-CB 3.26Å; L78-H81 PolarHBondContact O-N 2.8Å; L78-H81 VanDerWaalsContact O-N 3.09Å; L78-L82 HydrophobicContact CD1-CD1 4.22Å; L78-L82 HydrophobicContact CD1-CG 4.37Å; L78-L82 HydrophobicContact CG-CD1 4.01Å; L78-L82 HydrophobicContact CG-CG 4.49Å; L78-L82 WeakPolarHBondContact O-CG 3.43Å; L78-L82 PolarHBondContact O-N 2.89Å
79	L	90.6	Very high	90.5	Very high	45 Å²	45	52 Å²	52	24%	0.236	28%	0.279	C	S	.	.	H	α-helix	trans	-59.2	-42.3	177.3	-72.7	173.4	0	0	0	111.3	L75 H81 L82 H83 V93	L75-L79 WeakPolarHBondContact O-CB 3.25Å; L75-L79 WeakPolarHBondContact O-CG 3.44Å; L75-L79 PolarHBondContact O-N 2.88Å; L79-H81 VanDerWaalsContact C-N 3.29Å; L79-H81 PolarHBondContact O-N 2.89Å; L79-L82 PolarHBondContact O-N 3.5Å; L79-H83 WeakPolarHBondContact O-CB 3.41Å; L79-H83 VanDerWaalsContact O-CG 3.24Å; L79-H83 PolarHBondContact O-N 2.87Å; L79-H83 PolarHBondContact O-ND1 3Å; L79-V93 HydrophobicContact CD2-CG2 3.73Å; L79-V93 HydrophobicContact CG-CG2 4.39Å
80	N	91.6	Very high	90.5	Very high	90 Å²	90	54.6 Å²	54.6	48%	0.481	29%	0.288	S	S	.	.	H	α-helix	trans	-61.9	-35.8	175.5	-75.6	-34.8	0	0	0	113.1	D76 G77 L78 R84	D76-N80 WeakPolarHBondContact O-CB 3.45Å; D76-N80 PolarHBondContact O-N 3.42Å; D76-N80 PolarHBondContact O-ND2 3.01Å; G77-N80 PolarHBondContact O-N 2.95Å; L78-N80 VanDerWaalsContact C-N 3.29Å; L78-N80 PolarHBondContact O-N 2.91Å; N80-R84 WeakPolarHBondContact O-CG 3.17Å; N80-R84 PolarHBondContact O-N 2.85Å
81	H	91.4	Very high	90.6	Very high	66 Å²	66	55.1 Å²	55.1	31%	0.306	29%	0.292	S	S	.	.	H	α-helix	trans	-69.3	-48.3	174.6	179.6	84.6	0	0	0	111.6	T28 G77 L78 L79 H83 R84 D85	T28-H81 PolarHBondContact OG1-NE2 2.93Å; G77-H81 PolarHBondContact O-N 3.39Å; G77-H81 VanDerWaalsContact O-N 3.09Å; L78-H81 WeakPolarHBondContact O-CB 3.26Å; L78-H81 PolarHBondContact O-N 2.8Å; L78-H81 VanDerWaalsContact O-N 3.09Å; L79-H81 VanDerWaalsContact C-N 3.29Å; L79-H81 PolarHBondContact O-N 2.89Å; H81-H83 VanDerWaalsContact C-N 3.28Å; H81-H83 PolarHBondContact O-N 3.14Å; H81-R84 PolarHBondContact O-N 2.9Å; H81-R84 VanDerWaalsContact O-N 3.07Å; H81-D85 PolarHBondContact O-N 2.84Å
82	L	90.8	Very high	90.8	Very high	0 Å²	0	55.8 Å²	55.8	0%	0	29%	0.292	C	S	.	.	H	α-helix	trans	-65.4	-28.8	179.2	-65.5	174.5	0	0	0	113.2	L6 L8 T25 L78 L79 R84 V88 P91	L6-L82 HydrophobicContact CD1-CD1 3.89Å; L6-L82 HydrophobicContact CD2-CD1 3.87Å; L8-L82 HydrophobicContact CD2-CD2 4.18Å; T25-L82 HydrophobicContact CG2-CD2 3.77Å; L78-L82 HydrophobicContact CD1-CD1 4.22Å; L78-L82 HydrophobicContact CD1-CG 4.37Å; L78-L82 HydrophobicContact CG-CD1 4.01Å; L78-L82 HydrophobicContact CG-CG 4.49Å; L78-L82 WeakPolarHBondContact O-CG 3.43Å; L78-L82 PolarHBondContact O-N 2.89Å; L79-L82 PolarHBondContact O-N 3.5Å; L82-R84 VanDerWaalsContact C-N 3.3Å; L82-V88 HydrophobicContact CD2-CG2 4.35Å; L82-P91 HydrophobicContact CB-CB 3.82Å; L82-P91 HydrophobicContact CB-CG 3.94Å; L82-P91 HydrophobicContact CD1-CB 3.85Å; L82-P91 HydrophobicContact CG-CB 4.46Å
83	H	90.3	Very high	91	Very high	92 Å²	92	53.9 Å²	53.9	43%	0.426	28%	0.279	S	S	.	.	H	α-helix	trans	-70.8	-25.8	174	-76.1	145.7	0	0	0	113.3	H54 L79 H81	H54-H83 PolarHBondContact CE1-O 2.92Å; H54-H83 VanDerWaalsContact CE1-O 3.23Å; L79-H83 WeakPolarHBondContact O-CB 3.41Å; L79-H83 VanDerWaalsContact O-CG 3.24Å; L79-H83 PolarHBondContact O-N 2.87Å; L79-H83 PolarHBondContact O-ND1 3Å; H81-H83 VanDerWaalsContact C-N 3.28Å; H81-H83 PolarHBondContact O-N 3.14Å
84	R	91.2	Very high	91.1	Very high	204 Å²	204	53.3 Å²	53.3	77%	0.77	27%	0.268	S	S	*	.	H	α-helix	trans	-87.2	-20	178.1	-68.4	173.5	-175.7	-174.1	1.6	112.8	N80 H81 L82 V86	N80-R84 WeakPolarHBondContact O-CG 3.17Å; N80-R84 PolarHBondContact O-N 2.85Å; H81-R84 PolarHBondContact O-N 2.9Å; H81-R84 VanDerWaalsContact O-N 3.07Å; L82-R84 VanDerWaalsContact C-N 3.3Å; R84-V86 PolarHBondContact O-N 2.74Å
85	D	91.3	Very high	91.1	Very high	18 Å²	18	59.2 Å²	59.2	10%	0.096	29%	0.293	C	S	.	.			trans	-70.4	119.6	176.8	-167.2	-15.9	0	0	0	110.8	H54 H81 D87 V88	H54-D85 PolarHBondContact NE2-O 3.19Å; H54-D85 VanDerWaalsContact NE2-O 3.12Å; H81-D85 PolarHBondContact O-N 2.84Å; D85-D87 PolarHBondContact O-N 2.75Å; D85-D87 PolarHBondContact OD1-N 2.7Å; D85-V88 HydrophobicContact CB-CB 4.29Å; D85-V88 HydrophobicContact CB-CG2 3.81Å; D85-V88 PolarHBondContact O-N 2.89Å
86	V	90.6	Very high	90.9	Very high	81 Å²	81	60.5 Å²	60.5	49%	0.491	30%	0.297	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67.2	-22.9	-179.1	-63.9	0	0	0	0	113	R84 V88	R84-V86 PolarHBondContact O-N 2.74Å; V86-V88 VanDerWaalsContact C-N 3.33Å
87	D	92.1	Very high	90.3	Very high	18 Å²	18	63 Å²	63	10%	0.096	31%	0.305	C	S	.	.	T	Hydrogen-bonded Turn	trans	-84.2	-14.8	-179.2	-62.6	-36.3	0	0	0	112.3	L10 K11 M13 A21 R24 D85	L10-D87 WeakPolarHBondContact CA-O 3.42Å; K11-D87 WeakPolarHBondContact CE-OD1 3.45Å; K11-D87 PolarHBondContact N-O 3.45Å; K11-D87 IonicContact NZ-OD1 3.62Å; K11-D87 PolarHBondContact NZ-OD1 3.13Å; M13-D87 HydrophobicContact CE-CB 3.91Å; M13-D87 HydrophobicContact SD-CB 4.3Å; A21-D87 HydrophobicContact CB-CB 4.26Å; R24-D87 IonicContact CZ-OD2 2.74Å; R24-D87 IonicContact NH1-OD2 2.75Å; R24-D87 IonicContact NH2-OD2 2.84Å; R24-D87 PolarHBondContact NH2-OD2 3.13Å; D85-D87 PolarHBondContact O-N 2.75Å; D85-D87 PolarHBondContact OD1-N 2.7Å
88	V	93.1	Very high	89.1	Confident	0 Å²	0	68.7 Å²	68.7	0%	0	32%	0.324	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.7	113.8	178.3	-179.8	0	0	0	0	109.5	L8 L10 K53 L82 D85 V86 P91	L8-V88 HydrophobicContact CD2-CG1 4.06Å; L8-V88 HydrophobicContact CD2-CG2 4.1Å; L10-V88 HydrophobicContact CD2-CB 4.48Å; L10-V88 HydrophobicContact CD2-CG2 3.84Å; K53-V88 PolarHBondContact NZ-O 2.88Å; L82-V88 HydrophobicContact CD2-CG2 4.35Å; D85-V88 HydrophobicContact CB-CB 4.29Å; D85-V88 HydrophobicContact CB-CG2 3.81Å; D85-V88 PolarHBondContact O-N 2.89Å; V86-V88 VanDerWaalsContact C-N 3.33Å; V88-P91 HydrophobicContact CG1-CB 4.15Å; V88-P91 HydrophobicContact CG1-CG 4.2Å
89	V	93	Very high	87.3	Confident	4 Å²	4	76 Å²	76	2%	0.024	36%	0.358	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.6	-44.2	174.2	179	0	0	0	0	110.5	I9 K11 I51 K53 H58	I9-V89 HydrophobicContact CB-CB 4.46Å; I9-V89 HydrophobicContact CG2-CB 4.08Å; I9-V89 HydrophobicContact CG2-CG1 4.43Å; I9-V89 WeakPolarHBondContact O-CA 3.47Å; I9-V89 WeakPolarHBondContact O-CB 3.44Å; I9-V89 PolarHBondContact O-N 2.97Å; K11-V89 HydrophobicContact CB-CG2 3.78Å; I51-V89 HydrophobicContact CB-CG1 3.97Å; I51-V89 HydrophobicContact CD1-CG1 4Å; I51-V89 HydrophobicContact CG2-CG1 3.74Å; K53-V89 WeakPolarHBondContact CD-O 3.43Å; H58-V89 HydrophobicContact CB-CG1 4.33Å; H58-V89 HydrophobicContact CB-CG2 4.25Å
90	R	91.9	Very high	85.2	Confident	112 Å²	112	82 Å²	82	42%	0.423	39%	0.385	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-155.2	115.3	178.7	-170.6	175.6	-179.4	170	1.3	111	I9 Y49	I9-R90 HydrophobicContact CB-CB 4.19Å; I9-R90 HydrophobicContact CD1-CB 4.17Å; I9-R90 HydrophobicContact CG1-CB 4.38Å; I9-R90 PolarHBondContact N-O 3.23Å; I9-R90 PolarHBondContact O-N 3.41Å; I9-R90 VanDerWaalsContact O-N 3.15Å; Y49-R90 PolarHBondContact OH-NH1 2.91Å
91	P	93.4	Very high	83.2	Confident	14 Å²	14	83.4 Å²	83.4	9%	0.091	40%	0.399	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.3	136.7	166.5	33.4	-28.6	0	0	0	109.7	L6 L82 V88	L6-P91 HydrophobicContact CD1-CB 4.39Å; L82-P91 HydrophobicContact CB-CB 3.82Å; L82-P91 HydrophobicContact CB-CG 3.94Å; L82-P91 HydrophobicContact CD1-CB 3.85Å; L82-P91 HydrophobicContact CG-CB 4.46Å; V88-P91 HydrophobicContact CG1-CB 4.15Å; V88-P91 HydrophobicContact CG1-CG 4.2Å
92	T	93	Very high	81.2	Confident	47 Å²	47	89.2 Å²	89.2	29%	0.288	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134	119	172	-54.5	0	0	0	0	108.6	L6 A7 L94	L6-T92 CarbonylContact C-O 3.59Å; L6-T92 WeakPolarHBondContact CA-O 3.49Å; A7-T92 PolarHBondContact N-O 3.4Å; A7-T92 PolarHBondContact O-N 2.96Å; T92-L94 HydrophobicContact CG2-CD2 4.12Å; T92-L94 HydrophobicContact CG2-CG 4.21Å
93	V	92.1	Very high	79.3	Confident	36 Å²	36	94.5 Å²	94.5	22%	0.218	46%	0.461	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.1	129.1	174	179.3	0	0	0	0	109	Y4 E5 L6 F68 L75 L79	Y4-V93 HydrophobicContact CD1-CG1 3.98Å; Y4-V93 HydrophobicContact CG-CG1 4.34Å; E5-V93 WeakPolarHBondContact O-CA 3.48Å; L6-V93 HydrophobicContact CD1-CG2 3.73Å; F68-V93 HydrophobicContact CZ-CG1 4.48Å; L75-V93 HydrophobicContact CD2-CG1 3.84Å; L79-V93 HydrophobicContact CD2-CG2 3.73Å; L79-V93 HydrophobicContact CG-CG2 4.39Å
94	L	91.5	Very high	77.7	Confident	87 Å²	87	95.6 Å²	95.6	46%	0.455	48%	0.478	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.9	139.7	177.5	-60.6	172.4	0	0	0	108.6	Y4 E5 T92 K96	Y4-L94 CarbonylContact C-O 3.6Å; Y4-L94 WeakPolarHBondContact CA-O 3.4Å; E5-L94 PolarHBondContact N-O 3.11Å; E5-L94 PolarHBondContact O-N 3.49Å; T92-L94 HydrophobicContact CG2-CD2 4.12Å; T92-L94 HydrophobicContact CG2-CG 4.21Å; L94-K96 PolarHBondContact O-N 2.98Å
95	K	89.1	Confident	75.7	Confident	160 Å²	160	89.1 Å²	89.1	70%	0.696	48%	0.476	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.8	124.5	169.1	-171.5	-179.3	178.5	-171.9	0	107.4	Y4 E97	Y4-K95 HydrophobicContact CD1-CB 4.27Å; Y4-K95 HydrophobicContact CD1-CG 4.5Å; Y4-K95 HydrophobicContact CE1-CB 4.16Å; Y4-K95 HydrophobicContact CE1-CG 4.17Å; K95-E97 PolarHBondContact O-N 2.91Å
96	K	84.3	Confident	74	Confident	52 Å²	52	94.4 Å²	94.4	23%	0.226	51%	0.512	C	S	.	.			trans	-86.6	112.7	176.4	-159.5	158.5	-176.6	152	0	107.3	R3 E5 D67 L94	R3-K96 HydrophobicContact CB-CB 4.28Å; R3-K96 HydrophobicContact CG-CB 4.03Å; R3-K96 HydrophobicContact CG-CD 4.4Å; R3-K96 PolarHBondContact O-N 2.99Å; E5-K96 HydrophobicContact CB-CD 4.36Å; E5-K96 IonicContact OE2-NZ 2.7Å; E5-K96 PolarHBondContact OE2-NZ 2.99Å; D67-K96 IonicContact OD1-NZ 3.03Å; D67-K96 PolarHBondContact OD1-NZ 2.82Å; D67-K96 IonicContact OD2-NZ 3.62Å; D67-K96 PolarHBondContact OD2-NZ 2.88Å; L94-K96 PolarHBondContact O-N 2.98Å
97	E	76.3	Confident	72.3	Confident	165 Å²	165	93.4 Å²	93.4	77%	0.771	52%	0.518	S	S	*	.			trans	-64.1	140.4	167.5	-63.8	-173.6	154	0	0	107.9	K95 Q99	K95-E97 PolarHBondContact O-N 2.91Å; E97-Q99 VanDerWaalsContact C-N 3.25Å; E97-Q99 PolarHBondContact O-N 2.7Å
98	E	63.5	Low	71.2	Confident	150 Å²	150	99 Å²	99	70%	0.701	56%	0.556	S	S	*	*			trans	-65.8	95	173.8	-159.1	108.3	81.8	0	0	105.7	E100	E98-E100 PolarHBondContact O-N 2.9Å
99	Q	52.3	Low	69.5	Low	155 Å²	155	108.5 Å²	108.5	72%	0.724	62%	0.622	S	S	*	*			trans	-58.5	113.6	169.3	-74.9	-173.4	26	0	0	105.6	E97	E97-Q99 VanDerWaalsContact C-N 3.25Å; E97-Q99 PolarHBondContact O-N 2.7Å
100	E	46.6	Very low	68.3	Low	170 Å²	170	113.7 Å²	113.7	79%	0.794	65%	0.652	S	S	*	*			trans	-46.2	134.7	167.2	-64.8	-174.1	117.3	0	0	107.3	E98 K102	E98-E100 PolarHBondContact O-N 2.9Å; E100-K102 PolarHBondContact O-N 2.7Å
101	P	49.9	Very low	67.1	Low	121 Å²	121	113.8 Å²	113.8	79%	0.786	66%	0.664	S	S	*	*			trans	-54.9	116.2	179	23.6	-31.6	0	0	0	106.4	S103	P101-S103 PolarHBondContact O-N 3.25Å
102	K	49.9	Very low	65.6	Low	187 Å²	187	119.3 Å²	119.3	81%	0.813	70%	0.696	S	S	*	*			trans	-57.6	96	172.1	-79.9	-177.6	177.3	177	0	106.5	E100 S104	E100-K102 PolarHBondContact O-N 2.7Å; K102-S104 VanDerWaalsContact C-N 3.28Å; K102-S104 PolarHBondContact O-N 3.23Å
103	S	49.3	Very low	64	Low	112 Å²	112	123.6 Å²	123.6	78%	0.783	72%	0.72	S	S	*	*			trans	-63.7	97.1	167.5	55.9	0	0	0	0	105.7	P101 G105	P101-S103 PolarHBondContact O-N 3.25Å; S103-G105 PolarHBondContact O-N 3.12Å
104	S	57.2	Low	62.2	Low	114 Å²	114	129.1 Å²	129.1	80%	0.797	75%	0.751	S	S	*	*			trans	-69.2	74.7	158.8	56.4	0	0	0	0	107.1	K102 C106	K102-S104 VanDerWaalsContact C-N 3.28Å; K102-S104 PolarHBondContact O-N 3.23Å; S104-C106 PolarHBondContact O-N 3.21Å; S104-C106 VanDerWaalsContact O-N 3.12Å
105	G	50	Low	60.3	Low	69 Å²	69	131.9 Å²	131.9	71%	0.711	77%	0.771	S	S	*	*			trans	-73.8	92.1	167.1	0	0	0	0	0	108	S103 G107	S103-G105 PolarHBondContact O-N 3.12Å; G105-G107 PolarHBondContact O-N 2.84Å
106	C	55.6	Low	58.2	Low	128 Å²	128	129.9 Å²	129.9	87%	0.865	78%	0.776	S	S	*	*			trans	-66.8	106.5	154.9	-83.7	0	0	0	0	106.7	S104	S104-C106 PolarHBondContact O-N 3.21Å; S104-C106 VanDerWaalsContact O-N 3.12Å
107	G	55.1	Low	56.2	Low	60 Å²	60	135.8 Å²	135.8	62%	0.619	82%	0.818	S	S	*	*			trans	-66.6	143.5	167.1	0	0	0	0	0	110.1	G105	G105-G107 PolarHBondContact O-N 2.84Å
108	P	68.4	Low	54.5	Low	137 Å²	137	133.4 Å²	133.4	89%	0.89	82%	0.822	S	S	*	*			trans	-76	130.9	173.9	31	-29.8	0	0	0	109.4
109	S	56.8	Low	53.7	Low	198 Å²	198	131.9 Å²	131.9	100%	1.385	83%	0.833	S	S	*	*			trans	-87.9	0	165.2	-54.4	0	0	0	0	110.5

Retrieved 109 of 109 residues in 129.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).