A0A087YED3_POEFO Loading...

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

AlphaFold DB , UniProt , Accession A0A087YED3, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 101 aa.

						>A0A087YED3_POEFO|A0A087YED3
MSSFGRAIGVLRAGTGLLRHGPGRITSRKASGGPHIEPQYRQYPQLTKKQKFESEFISGAMWFWILWHCWHDPDAILGHFPWPDASKWTDEELGIPPDDEE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.9	Very low	52.6	Low	244 Å²	244	136.6 Å²	136.6	100%	1.202	79%	0.789	S	S	*	*				0	146.1	0	-72.3	179.1	162.2	0	0	108.6
2	S	46.4	Very low	52.6	Low	129 Å²	129	143.7 Å²	143.7	90%	0.902	79%	0.793	S	S	*	*			trans	86.5	68.6	179.3	-67.3	0	0	0	0	118.4
3	S	54.1	Low	52.7	Low	120 Å²	120	138.2 Å²	138.2	84%	0.839	78%	0.778	S	S	*	*			trans	-125.9	42.6	158.8	176.4	0	0	0	0	111.1
4	F	54.3	Low	52.7	Low	191 Å²	191	131.4 Å²	131.4	84%	0.838	75%	0.754	S	S	*	*			trans	-117.9	4.1	-178.9	-106	-86.2	0	0	0	114.6
5	G	53.9	Low	52.8	Low	75 Å²	75	128.9 Å²	128.9	77%	0.773	74%	0.743	S	S	*	*	S	Bend	trans	-89.4	-8.7	-173.7	0	0	0	0	0	116.8
6	R	53.8	Low	52.9	Low	238 Å²	238	123.8 Å²	123.8	90%	0.898	73%	0.726	S	S	*	*	S	Bend	trans	-104.8	-9.7	-171.5	-87.4	-174	156.7	162.4	-4.5	116.1
7	A	53	Low	53.1	Low	71 Å²	71	125.2 Å²	125.2	59%	0.587	73%	0.729	S	S	*	*	S	Bend	trans	-86.6	-20.5	-177.7	0	0	0	0	0	114.3
8	I	54.4	Low	53.2	Low	134 Å²	134	126.9 Å²	126.9	69%	0.687	73%	0.734	S	S	*	*	H	α-helix	trans	-84	-26	-175.1	-63.9	175.2	0	0	0	112.4	V10	I8-V10 VanDerWaalsContact C-N 3.35Å; I8-V10 PolarHBondContact O-N 2.75Å
9	G	50	Low	53.3	Low	57 Å²	57	132.2 Å²	132.2	59%	0.588	74%	0.74	S	S	*	*	H	α-helix	trans	-70.3	-26.6	-179.5	0	0	0	0	0	114.5
10	V	54.9	Low	53.4	Low	109 Å²	109	134.1 Å²	134.1	66%	0.661	74%	0.742	S	S	*	*	H	α-helix	trans	-82.5	-26.7	-176.2	-176.6	0	0	0	0	112	I8 R12 G14	I8-V10 VanDerWaalsContact C-N 3.35Å; I8-V10 PolarHBondContact O-N 2.75Å; V10-R12 VanDerWaalsContact C-N 3.32Å; V10-R12 PolarHBondContact O-N 2.85Å; V10-G14 PolarHBondContact O-N 2.92Å
11	L	54.6	Low	53.9	Low	135 Å²	135	130 Å²	130	71%	0.707	73%	0.731	S	S	*	*	H	α-helix	trans	-72.6	-23.5	177.8	-75.8	167.4	0	0	0	113.4	T15	L11-T15 PolarHBondContact O-OG1 3.21Å
12	R	52.4	Low	54.6	Low	221 Å²	221	124.7 Å²	124.7	83%	0.834	72%	0.715	S	S	*	*	H	α-helix	trans	-88	-22	179	-152.5	173.8	-173	169.3	1.3	113.7	V10	V10-R12 VanDerWaalsContact C-N 3.32Å; V10-R12 PolarHBondContact O-N 2.85Å
13	A	53.8	Low	55.3	Low	73 Å²	73	121.5 Å²	121.5	60%	0.603	70%	0.702	S	S	*	*	H	α-helix	trans	-84	-27.8	175.5	0	0	0	0	0	112.9
14	G	52.8	Low	55.6	Low	43 Å²	43	126.4 Å²	126.4	44%	0.443	70%	0.702	S	S	.	*	H	α-helix	trans	-74.9	-23	-178.9	0	0	0	0	0	115.2	V10	V10-G14 PolarHBondContact O-N 2.92Å
15	T	54.9	Low	56	Low	94 Å²	94	124.9 Å²	124.9	58%	0.577	70%	0.701	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.8	-14.4	-177.2	32.3	0	0	0	0	114.1	L11	L11-T15 PolarHBondContact O-OG1 3.21Å
16	G	54.6	Low	56.5	Low	46 Å²	46	125.5 Å²	125.5	47%	0.474	69%	0.69	S	S	.	*	T	Hydrogen-bonded Turn	trans	-74.8	-32.1	177.2	0	0	0	0	0	113.7
17	L	55	Low	56.8	Low	149 Å²	149	118.7 Å²	118.7	78%	0.78	68%	0.679	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.9	-21.5	-177.9	-87.7	155.4	0	0	0	113.5	R19	L17-R19 VanDerWaalsContact C-N 3.34Å
18	L	56.4	Low	57.3	Low	155 Å²	155	125.8 Å²	125.8	81%	0.812	69%	0.69	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.9	-10.5	176.9	-69.7	168.7	0	0	0	113.5
19	R	54.6	Low	57.3	Low	228 Å²	228	127.8 Å²	127.8	86%	0.86	69%	0.694	S	S	*	*	S	Bend	trans	-94.2	-14.2	-178.5	-160.9	172.1	175.3	-179	-1.8	113.8	L17 G21	L17-R19 VanDerWaalsContact C-N 3.34Å; R19-G21 PolarHBondContact O-N 3.07Å
20	H	54.7	Low	57.6	Low	169 Å²	169	129.7 Å²	129.7	78%	0.782	71%	0.705	S	S	*	*			trans	-93.1	82.9	170.4	-86.3	-53.1	0	0	0	109.8
21	G	64.8	Low	57.7	Low	49 Å²	49	130.2 Å²	130.2	51%	0.505	71%	0.713	S	S	.	*			trans	-53.4	157.1	156.6	0	0	0	0	0	109.8	R19 G23	R19-G21 PolarHBondContact O-N 3.07Å; G21-G23 PolarHBondContact O-N 3.44Å
22	P	62.3	Low	57.8	Low	132 Å²	132	127 Å²	127	86%	0.857	71%	0.713	S	S	*	*			trans	-51.4	108.9	-175	22.1	-32.8	0	0	0	108.1	R24	P22-R24 VanDerWaalsContact C-N 3.31Å; P22-R24 PolarHBondContact O-N 2.79Å
23	G	62	Low	58.3	Low	62 Å²	62	118.9 Å²	118.9	64%	0.639	70%	0.698	S	S	*	*			trans	-55.8	105.8	175.8	0	0	0	0	0	105	G21 I25	G21-G23 PolarHBondContact O-N 3.44Å; G23-I25 VanDerWaalsContact C-N 3.27Å; G23-I25 PolarHBondContact O-N 3.38Å
24	R	60.5	Low	58.9	Low	223 Å²	223	122.4 Å²	122.4	84%	0.842	71%	0.714	S	S	*	*			trans	-59.3	101.1	-179.2	-177.9	174.7	166	-179	-8.6	104.4	P22 T26	P22-R24 VanDerWaalsContact C-N 3.31Å; P22-R24 PolarHBondContact O-N 2.79Å; R24-T26 HydrophobicContact CG-CG2 4.29Å; R24-T26 PolarHBondContact O-N 2.79Å
25	I	63.2	Low	59.7	Low	160 Å²	160	128.5 Å²	128.5	82%	0.821	73%	0.731	S	S	*	*			trans	-66	87.1	175.1	-59.6	174.6	0	0	0	103.6	G23 S27	G23-I25 VanDerWaalsContact C-N 3.27Å; G23-I25 PolarHBondContact O-N 3.38Å; I25-S27 PolarHBondContact O-N 3.36Å
26	T	63.6	Low	60.9	Low	87 Å²	87	127.1 Å²	127.1	53%	0.534	72%	0.719	S	S	.	*			trans	-66.6	94.5	166.5	58.6	0	0	0	0	103.6	R24 R28	R24-T26 HydrophobicContact CG-CG2 4.29Å; R24-T26 PolarHBondContact O-N 2.79Å; T26-R28 PolarHBondContact O-N 2.77Å
27	S	61.3	Low	62.2	Low	95 Å²	95	131.1 Å²	131.1	66%	0.664	73%	0.726	S	S	*	*			trans	-57.4	93.3	158.4	173.2	0	0	0	0	105	I25 K29	I25-S27 PolarHBondContact O-N 3.36Å; S27-K29 PolarHBondContact O-N 2.7Å
28	R	61.8	Low	63.6	Low	220 Å²	220	130.3 Å²	130.3	83%	0.83	73%	0.73	S	S	*	*			trans	-67.4	96.8	169.8	-70.8	-172.4	-178.1	-169.3	1	104	T26 A30	T26-R28 PolarHBondContact O-N 2.77Å; R28-A30 PolarHBondContact O-N 3.29Å
29	K	54.8	Low	64.9	Low	176 Å²	176	125.8 Å²	125.8	77%	0.765	70%	0.704	S	S	*	*			trans	-61.6	86.6	167.5	-66	-174.1	-176	-176.3	0	106.9	S27 S31	S27-K29 PolarHBondContact O-N 2.7Å; K29-S31 PolarHBondContact O-N 2.76Å
30	A	56.6	Low	66.7	Low	98 Å²	98	123.3 Å²	123.3	81%	0.81	70%	0.696	S	S	*	*	G	3₁₀ helix	trans	-72.4	-7.3	178.8	0	0	0	0	0	112.1	R28 G32	R28-A30 PolarHBondContact O-N 3.29Å; A30-G32 VanDerWaalsContact C-N 3.33Å; A30-G32 PolarHBondContact O-N 3.46Å
31	S	56.4	Low	68.4	Low	120 Å²	120	125.6 Å²	125.6	84%	0.839	70%	0.698	S	S	*	*	G	3₁₀ helix	trans	-84.7	3	-176.2	65.5	0	0	0	0	114.8	K29	K29-S31 PolarHBondContact O-N 2.76Å
32	G	56.5	Low	69.7	Low	68 Å²	68	130.1 Å²	130.1	70%	0.701	71%	0.706	S	S	*	*	G	3₁₀ helix	trans	-121.5	21.5	-174.1	0	0	0	0	0	114.8	A30	A30-G32 VanDerWaalsContact C-N 3.33Å; A30-G32 PolarHBondContact O-N 3.46Å
33	G	64.5	Low	70.9	Confident	50 Å²	50	132.1 Å²	132.1	52%	0.515	70%	0.698	S	S	.	*	S	Bend	trans	-75.1	168	173.3	0	0	0	0	0	112.4	H35	G33-H35 PolarHBondContact O-N 2.73Å
34	P	65.5	Low	72.2	Confident	146 Å²	146	132.5 Å²	132.5	95%	0.948	69%	0.688	S	S	*	*			trans	-70.1	73.9	179.9	30.4	-34	0	0	0	110.3
35	H	70.7	Confident	73.4	Confident	171 Å²	171	126.9 Å²	126.9	79%	0.792	67%	0.672	S	S	*	*	P	Polyproline II helix	trans	-85.7	145.6	177.4	-154.7	71.5	0	0	0	109.2	G33 E37	G33-H35 PolarHBondContact O-N 2.73Å; H35-E37 PolarHBondContact O-N 3.2Å
36	I	78.8	Confident	74.6	Confident	66 Å²	66	122.8 Å²	122.8	34%	0.338	65%	0.651	S	S	.	*	P	Polyproline II helix	trans	-62.2	120.8	175.2	-66	166	0	0	0	107.4	Q45 T47	I36-Q45 HydrophobicContact CG2-CB 4.2Å; I36-Q45 WeakPolarHBondContact CG2-O 3.33Å; I36-T47 HydrophobicContact CD1-CG2 4.46Å
37	E	82.6	Confident	75.8	Confident	129 Å²	129	121.6 Å²	121.6	60%	0.603	64%	0.644	S	S	*	*	P	Polyproline II helix	trans	-66.5	137.4	-179.6	-70.9	-179.2	176.7	0	0	110.6	H35 Q39	H35-E37 PolarHBondContact O-N 3.2Å; E37-Q39 PolarHBondContact O-N 3.44Å
38	P	83.3	Confident	77.2	Confident	133 Å²	133	126.1 Å²	126.1	86%	0.864	65%	0.652	S	S	*	*	P	Polyproline II helix	trans	-65.9	119.4	174.9	26.8	-32.3	0	0	0	110
39	Q	85.5	Confident	78.5	Confident	60 Å²	60	123.3 Å²	123.3	28%	0.28	65%	0.646	S	S	.	*	P	Polyproline II helix	trans	-102.9	144.4	173	-90.4	115.7	26	0	0	111.5	E37 Q42 Q45	E37-Q39 PolarHBondContact O-N 3.44Å; Q39-Q42 HydrophobicContact CB-CB 4.27Å; Q39-Q45 VanDerWaalsContact OE1-N 3.09Å
40	Y	91.8	Very high	80.2	Confident	175 Å²	175	119.2 Å²	119.2	69%	0.686	63%	0.629	S	S	*	*	S	Bend	trans	-108.1	128.1	177.3	-176.5	-114.3	0	0	0	111.4	Q42	Y40-Q42 PolarHBondContact O-N 3.32Å; Y40-Q42 VanDerWaalsContact O-N 3.07Å
41	R	90.8	Very high	82	Confident	217 Å²	217	119.2 Å²	119.2	82%	0.819	61%	0.611	S	S	*	*	S	Bend	trans	54.2	21.8	-179.7	-61.9	179.3	-179.1	-116.5	1.1	114.9
42	Q	92	Very high	83.9	Confident	144 Å²	144	120.1 Å²	120.1	67%	0.673	60%	0.6	S	S	*	*	S	Bend	trans	-127.6	159.8	179.1	-68	177.2	-14.2	0	0	109.9	Q39 Y40	Q39-Q42 HydrophobicContact CB-CB 4.27Å; Y40-Q42 PolarHBondContact O-N 3.32Å; Y40-Q42 VanDerWaalsContact O-N 3.07Å
43	Y	87.8	Confident	85.7	Confident	175 Å²	175	122.1 Å²	122.1	69%	0.686	59%	0.591	S	S	*	*	P	Polyproline II helix	trans	-66.2	135.3	175.7	-166.2	-91.7	0	0	0	110	L46	Y43-L46 HydrophobicContact CE1-CD1 3.83Å; Y43-L46 HydrophobicContact CE1-CG 4.21Å; Y43-L46 WeakPolarHBondContact OH-CD1 3.48Å
44	P	88.1	Confident	87.2	Confident	69 Å²	69	123.1 Å²	123.1	45%	0.448	59%	0.59	S	S	.	*	P	Polyproline II helix	trans	-67.9	148.2	-176.3	28	-35.7	0	0	0	111.9	L46	P44-L46 PolarHBondContact O-N 3.2Å
45	Q	86.8	Confident	88.7	Confident	105 Å²	105	122.3 Å²	122.3	49%	0.491	57%	0.573	S	S	.	*	P	Polyproline II helix	trans	-67	117.1	170.4	-71.4	179.6	21.6	0	0	110.6	I36 Q39	I36-Q45 HydrophobicContact CG2-CB 4.2Å; I36-Q45 WeakPolarHBondContact CG2-O 3.33Å; Q39-Q45 VanDerWaalsContact OE1-N 3.09Å
46	L	86.9	Confident	90	Very high	75 Å²	75	120.7 Å²	120.7	39%	0.393	56%	0.564	S	S	.	*	P	Polyproline II helix	trans	-98.7	134.6	173.1	-71	176.5	0	0	0	110	Y43 P44 K51	Y43-L46 HydrophobicContact CE1-CD1 3.83Å; Y43-L46 HydrophobicContact CE1-CG 4.21Å; Y43-L46 WeakPolarHBondContact OH-CD1 3.48Å; P44-L46 PolarHBondContact O-N 3.2Å; L46-K51 HydrophobicContact CB-CD 4.42Å; L46-K51 HydrophobicContact CB-CG 4.23Å; L46-K51 HydrophobicContact CD1-CG 4.36Å
47	T	89.6	Confident	90.8	Very high	61 Å²	61	123 Å²	123	37%	0.374	58%	0.577	S	S	.	*	P	Polyproline II helix	trans	-72.4	143.7	173.4	68.6	0	0	0	0	110.1	I36 K49 Q50 K51	I36-T47 HydrophobicContact CD1-CG2 4.46Å; T47-K49 PolarHBondContact O-N 3.34Å; T47-Q50 PolarHBondContact O-N 2.96Å; T47-Q50 WeakPolarHBondContact OG1-CB 3.13Å; T47-Q50 WeakPolarHBondContact OG1-CG 3.34Å; T47-Q50 PolarHBondContact OG1-N 3.47Å; T47-Q50 PolarHBondContact OG1-OE1 3.39Å; T47-K51 PolarHBondContact O-N 2.79Å
48	K	89.9	Confident	91.5	Very high	190 Å²	190	119.6 Å²	119.6	83%	0.826	57%	0.567	S	S	*	*	H	α-helix	trans	-60.2	-33.2	179.4	-65.5	-176.5	-179.4	-178.8	0	112.4	F52	K48-F52 WeakPolarHBondContact O-CB 3.28Å; K48-F52 PolarHBondContact O-N 2.95Å; K48-F52 VanDerWaalsContact O-N 3.09Å
49	K	90.8	Very high	92.2	Very high	162 Å²	162	115.2 Å²	115.2	70%	0.704	55%	0.545	S	S	*	.	H	α-helix	trans	-64.6	-46.9	177.2	-66.9	-170.7	176	-172	0	111.9	T47 K51 F52 E53	T47-K49 PolarHBondContact O-N 3.34Å; K49-K51 VanDerWaalsContact C-N 3.33Å; K49-K51 PolarHBondContact O-N 3.24Å; K49-F52 PolarHBondContact O-N 3.27Å; K49-E53 WeakPolarHBondContact O-CB 3.43Å; K49-E53 WeakPolarHBondContact O-CG 3.33Å; K49-E53 PolarHBondContact O-N 3.43Å
50	Q	89.9	Confident	92.8	Very high	89 Å²	89	114.6 Å²	114.6	42%	0.416	55%	0.55	S	S	.	*	H	α-helix	trans	-59.8	-42.5	177.6	-76.9	165.6	-30.3	0	0	112.3	T47 S54	T47-Q50 PolarHBondContact O-N 2.96Å; T47-Q50 WeakPolarHBondContact OG1-CB 3.13Å; T47-Q50 WeakPolarHBondContact OG1-CG 3.34Å; T47-Q50 PolarHBondContact OG1-N 3.47Å; T47-Q50 PolarHBondContact OG1-OE1 3.39Å; Q50-S54 WeakPolarHBondContact O-CB 3.37Å; Q50-S54 PolarHBondContact O-N 3.39Å; Q50-S54 PolarHBondContact O-OG 3.19Å
51	K	93.3	Very high	93	Very high	99 Å²	99	110.9 Å²	110.9	43%	0.43	54%	0.541	S	S	.	.	H	α-helix	trans	-61	-50.4	176	-66.4	-170.8	-177.2	-169.9	0	111.2	L46 T47 K49 E53 S54 E55	L46-K51 HydrophobicContact CB-CD 4.42Å; L46-K51 HydrophobicContact CB-CG 4.23Å; L46-K51 HydrophobicContact CD1-CG 4.36Å; T47-K51 PolarHBondContact O-N 2.79Å; K49-K51 VanDerWaalsContact C-N 3.33Å; K49-K51 PolarHBondContact O-N 3.24Å; K51-E53 PolarHBondContact O-N 2.85Å; K51-S54 PolarHBondContact O-N 3.26Å; K51-S54 PolarHBondContact O-OG 3.37Å; K51-E55 WeakPolarHBondContact O-CG 3.49Å; K51-E55 PolarHBondContact O-N 2.68Å
52	F	95.9	Very high	93.2	Very high	138 Å²	138	107.5 Å²	107.5	61%	0.605	53%	0.528	S	S	*	.	H	α-helix	trans	-60.3	-44.4	179.5	179.9	-99.9	0	0	0	112.6	K48 K49 S54 E55 F56	K48-F52 WeakPolarHBondContact O-CB 3.28Å; K48-F52 PolarHBondContact O-N 2.95Å; K48-F52 VanDerWaalsContact O-N 3.09Å; K49-F52 PolarHBondContact O-N 3.27Å; F52-S54 VanDerWaalsContact C-N 3.33Å; F52-S54 PolarHBondContact O-N 2.98Å; F52-E55 PolarHBondContact O-N 3.09Å; F52-F56 VanDerWaalsContact O-CB 3.25Å; F52-F56 WeakPolarHBondContact O-CB 3.44Å; F52-F56 PolarHBondContact O-N 3.29Å
53	E	96.1	Very high	93.4	Very high	110 Å²	110	106.9 Å²	106.9	51%	0.514	52%	0.523	S	S	.	.	H	α-helix	trans	-62.7	-40.5	176.7	-73.5	169.5	-177	0	0	111.4	K49 K51 F56 I57	K49-E53 WeakPolarHBondContact O-CB 3.43Å; K49-E53 WeakPolarHBondContact O-CG 3.33Å; K49-E53 PolarHBondContact O-N 3.43Å; K51-E53 PolarHBondContact O-N 2.85Å; E53-F56 PolarHBondContact O-N 3.34Å; E53-I57 VanDerWaalsContact O-CG1 3.28Å; E53-I57 WeakPolarHBondContact O-CG1 3.38Å; E53-I57 PolarHBondContact O-N 3.24Å
54	S	94.7	Very high	93.8	Very high	71 Å²	71	105.6 Å²	105.6	50%	0.497	52%	0.517	S	S	.	.	H	α-helix	trans	-64.8	-42.9	177.2	72.1	0	0	0	0	112.5	Q50 K51 F52 S58	Q50-S54 WeakPolarHBondContact O-CB 3.37Å; Q50-S54 PolarHBondContact O-N 3.39Å; Q50-S54 PolarHBondContact O-OG 3.19Å; K51-S54 PolarHBondContact O-N 3.26Å; K51-S54 PolarHBondContact O-OG 3.37Å; F52-S54 VanDerWaalsContact C-N 3.33Å; F52-S54 PolarHBondContact O-N 2.98Å; S54-S58 WeakPolarHBondContact O-CB 3.43Å; S54-S58 PolarHBondContact O-N 2.96Å
55	E	96.8	Very high	93.9	Very high	129 Å²	129	106.1 Å²	106.1	60%	0.603	52%	0.515	S	S	*	.	H	α-helix	trans	-67.3	-39.7	176.9	-71.4	170.5	-173.3	0	0	111	K51 F52 S58 G59	K51-E55 WeakPolarHBondContact O-CG 3.49Å; K51-E55 PolarHBondContact O-N 2.68Å; F52-E55 PolarHBondContact O-N 3.09Å; E55-S58 PolarHBondContact O-N 3.14Å; E55-G59 PolarHBondContact O-N 2.85Å
56	F	97.7	Very high	94.3	Very high	137 Å²	137	106.7 Å²	106.7	60%	0.601	52%	0.521	S	S	*	.	H	α-helix	trans	-63.5	-45.9	177.5	-177.4	-98.5	0	0	0	112	F52 E53 G59 A60	F52-F56 VanDerWaalsContact O-CB 3.25Å; F52-F56 WeakPolarHBondContact O-CB 3.44Å; F52-F56 PolarHBondContact O-N 3.29Å; E53-F56 PolarHBondContact O-N 3.34Å; F56-G59 PolarHBondContact O-N 3.44Å; F56-A60 WeakPolarHBondContact O-CB 3.36Å; F56-A60 PolarHBondContact O-N 2.89Å
57	I	97.4	Very high	94.6	Very high	116 Å²	116	107.7 Å²	107.7	60%	0.595	52%	0.52	S	S	*	.	H	α-helix	trans	-66.7	-42.6	177.9	-66.9	167.2	0	0	0	110.6	E53 G59 A60 M61	E53-I57 VanDerWaalsContact O-CG1 3.28Å; E53-I57 WeakPolarHBondContact O-CG1 3.38Å; E53-I57 PolarHBondContact O-N 3.24Å; I57-G59 VanDerWaalsContact C-N 3.3Å; I57-G59 PolarHBondContact O-N 2.83Å; I57-A60 PolarHBondContact O-N 3.33Å; I57-M61 WeakPolarHBondContact O-CB 3.25Å; I57-M61 PolarHBondContact O-N 2.82Å
58	S	96.6	Very high	94.7	Very high	57 Å²	57	108.1 Å²	108.1	40%	0.399	52%	0.518	S	S	.	.	H	α-helix	trans	-60.6	-41.7	174.9	-177.4	0	0	0	0	111.5	S54 E55 M61 W62	S54-S58 WeakPolarHBondContact O-CB 3.43Å; S54-S58 PolarHBondContact O-N 2.96Å; E55-S58 PolarHBondContact O-N 3.14Å; S58-M61 PolarHBondContact O-N 3.44Å; S58-W62 VanDerWaalsContact O-CD1 3.3Å; S58-W62 PolarHBondContact O-N 3.44Å; S58-W62 VanDerWaalsContact O-N 3.14Å
59	G	97.4	Very high	94.7	Very high	40 Å²	40	101.9 Å²	101.9	41%	0.412	50%	0.497	S	S	.	.	H	α-helix	trans	-64.9	-43.8	175.5	0	0	0	0	0	112.3	E55 F56 I57 M61 W62 F63	E55-G59 PolarHBondContact O-N 2.85Å; F56-G59 PolarHBondContact O-N 3.44Å; I57-G59 VanDerWaalsContact C-N 3.3Å; I57-G59 PolarHBondContact O-N 2.83Å; G59-M61 VanDerWaalsContact C-N 3.34Å; G59-M61 PolarHBondContact O-N 2.88Å; G59-W62 PolarHBondContact O-N 3.42Å; G59-F63 WeakPolarHBondContact O-CB 3.48Å; G59-F63 PolarHBondContact O-N 3.48Å
60	A	97.6	Very high	94.7	Very high	47 Å²	47	103.5 Å²	103.5	39%	0.388	50%	0.499	S	S	.	.	H	α-helix	trans	-63	-39.7	176.7	0	0	0	0	0	112.2	F56 I57 W64	F56-A60 WeakPolarHBondContact O-CB 3.36Å; F56-A60 PolarHBondContact O-N 2.89Å; I57-A60 PolarHBondContact O-N 3.33Å; A60-W64 VanDerWaalsContact O-CB 3.3Å; A60-W64 WeakPolarHBondContact O-CB 3.37Å; A60-W64 PolarHBondContact O-N 3.48Å
61	M	96.6	Very high	94.8	Very high	98 Å²	98	103.3 Å²	103.3	48%	0.483	50%	0.498	S	S	.	.	H	α-helix	trans	-60	-52.2	174.7	179.3	-172.5	70.7	0	0	111.3	I57 S58 G59 W64 I65	I57-M61 WeakPolarHBondContact O-CB 3.25Å; I57-M61 PolarHBondContact O-N 2.82Å; S58-M61 PolarHBondContact O-N 3.44Å; G59-M61 VanDerWaalsContact C-N 3.34Å; G59-M61 PolarHBondContact O-N 2.88Å; M61-W64 WeakPolarHBondContact O-CB 3.37Å; M61-W64 PolarHBondContact O-N 3.49Å; M61-I65 HydrophobicContact CG-CD1 4.19Å; M61-I65 WeakPolarHBondContact O-CG1 3.2Å; M61-I65 PolarHBondContact O-N 2.99Å
62	W	95.9	Very high	94.4	Very high	145 Å²	145	102.7 Å²	102.7	55%	0.549	50%	0.499	S	S	.	.	H	α-helix	trans	-67.5	-39.6	179.8	-80.7	111.4	0	0	0	112.9	S58 G59 W64 I65 L66	S58-W62 VanDerWaalsContact O-CD1 3.3Å; S58-W62 PolarHBondContact O-N 3.44Å; S58-W62 VanDerWaalsContact O-N 3.14Å; G59-W62 PolarHBondContact O-N 3.42Å; W62-W64 VanDerWaalsContact C-N 3.28Å; W62-W64 PolarHBondContact O-N 3.32Å; W62-I65 HydrophobicContact CE3-CD1 4.09Å; W62-I65 HydrophobicContact CZ3-CD1 4.31Å; W62-I65 PolarHBondContact O-N 3.38Å; W62-L66 WeakPolarHBondContact O-CG 3.3Å; W62-L66 PolarHBondContact O-N 3.25Å
63	F	95.7	Very high	93.9	Very high	131 Å²	131	98.3 Å²	98.3	58%	0.575	49%	0.485	S	S	*	.	H	α-helix	trans	-56.2	-46	171.8	171.7	-102.2	0	0	0	110.6	G59 I65 L66 W67	G59-F63 WeakPolarHBondContact O-CB 3.48Å; G59-F63 PolarHBondContact O-N 3.48Å; F63-I65 PolarHBondContact O-N 3.38Å; F63-L66 PolarHBondContact O-N 3.3Å; F63-W67 HydrophobicContact CZ-CB 4.45Å; F63-W67 AromaticContact CZ-CD1 3.94Å; F63-W67 HydrophobicContact CZ-CG 4.36Å; F63-W67 WeakPolarHBondContact O-CB 3.19Å; F63-W67 PolarHBondContact O-N 2.86Å
64	W	95.1	Very high	93.1	Very high	148 Å²	148	97.1 Å²	97.1	56%	0.561	48%	0.482	S	S	*	.	H	α-helix	trans	-62.1	-44.4	178.9	-171.9	-100.3	0	0	0	112.6	A60 M61 W62 W67 H68	A60-W64 VanDerWaalsContact O-CB 3.3Å; A60-W64 WeakPolarHBondContact O-CB 3.37Å; A60-W64 PolarHBondContact O-N 3.48Å; M61-W64 WeakPolarHBondContact O-CB 3.37Å; M61-W64 PolarHBondContact O-N 3.49Å; W62-W64 VanDerWaalsContact C-N 3.28Å; W62-W64 PolarHBondContact O-N 3.32Å; W64-W67 HydrophobicContact CZ3-CE3 4.46Å; W64-W67 PolarHBondContact O-N 3.04Å; W64-H68 AromaticContact CD2-ND1 3.98Å; W64-H68 AromaticContact CE2-CE1 3.51Å; W64-H68 AromaticContact CE2-ND1 3.36Å; W64-H68 AromaticContact CH2-CE1 3.9Å; W64-H68 AromaticContact CZ2-CE1 3.19Å; W64-H68 WeakPolarHBondContact CZ2-CE1 3.08Å; W64-H68 AromaticContact CZ2-ND1 3.52Å; W64-H68 AromaticContact NE1-CE1 3.73Å; W64-H68 AromaticContact NE1-ND1 3.44Å; W64-H68 PolarHBondContact NE1-ND1 2.82Å; W64-H68 WeakPolarHBondContact O-CB 3.39Å; W64-H68 PolarHBondContact O-N 3.45Å
65	I	91.9	Very high	92.4	Very high	80 Å²	80	97.3 Å²	97.3	41%	0.41	49%	0.488	S	S	.	.	H	α-helix	trans	-60.8	-49.2	177.8	-66.9	164.5	0	0	0	110.7	M61 W62 F63 H68 C69	M61-I65 HydrophobicContact CG-CD1 4.19Å; M61-I65 WeakPolarHBondContact O-CG1 3.2Å; M61-I65 PolarHBondContact O-N 2.99Å; W62-I65 HydrophobicContact CE3-CD1 4.09Å; W62-I65 HydrophobicContact CZ3-CD1 4.31Å; W62-I65 PolarHBondContact O-N 3.38Å; F63-I65 PolarHBondContact O-N 3.38Å; I65-H68 PolarHBondContact O-N 3.43Å; I65-C69 VanDerWaalsContact O-CB 3.26Å; I65-C69 WeakPolarHBondContact O-CB 3.26Å; I65-C69 PolarHBondContact O-N 2.88Å
66	L	93.4	Very high	91.6	Very high	117 Å²	117	96.6 Å²	96.6	61%	0.613	49%	0.487	S	S	*	.	H	α-helix	trans	-67.8	-38.6	-179	-67.3	174.8	0	0	0	111.8	W62 F63 C69 W70	W62-L66 WeakPolarHBondContact O-CG 3.3Å; W62-L66 PolarHBondContact O-N 3.25Å; F63-L66 PolarHBondContact O-N 3.3Å; L66-C69 PolarHBondContact O-N 3.5Å; L66-W70 PolarHBondContact O-N 2.84Å
67	W	95	Very high	90.9	Very high	96 Å²	96	97.1 Å²	97.1	36%	0.364	50%	0.495	S	S	.	.	H	α-helix	trans	-62.9	-47.9	175.7	-175.3	90.5	0	0	0	111.1	F63 W64 C69 W70 H71	F63-W67 HydrophobicContact CZ-CB 4.45Å; F63-W67 AromaticContact CZ-CD1 3.94Å; F63-W67 HydrophobicContact CZ-CG 4.36Å; F63-W67 WeakPolarHBondContact O-CB 3.19Å; F63-W67 PolarHBondContact O-N 2.86Å; W64-W67 HydrophobicContact CZ3-CE3 4.46Å; W64-W67 PolarHBondContact O-N 3.04Å; W67-C69 PolarHBondContact O-N 3.06Å; W67-W70 PolarHBondContact O-N 3.4Å; W67-H71 AromaticContact CD1-CD2 3.66Å; W67-H71 AromaticContact CD1-NE2 3.78Å; W67-H71 AromaticContact CD2-CD2 3.43Å; W67-H71 VanDerWaalsContact CD2-CD2 3.43Å; W67-H71 AromaticContact CE2-CD2 3.05Å; W67-H71 AromaticContact CE2-CG 3.99Å; W67-H71 AromaticContact CE2-NE2 3.28Å; W67-H71 VanDerWaalsContact CE2-NE2 3.28Å; W67-H71 AromaticContact CG-CD2 3.82Å; W67-H71 HydrophobicContact CH2-CB 4.33Å; W67-H71 AromaticContact CH2-CD2 3.91Å; W67-H71 AromaticContact CZ2-CD2 3.33Å; W67-H71 WeakPolarHBondContact CZ2-CD2 3.48Å; W67-H71 AromaticContact CZ2-CG 3.86Å; W67-H71 AromaticContact CZ2-NE2 3.48Å; W67-H71 WeakPolarHBondContact CZ2-NE2 3.33Å; W67-H71 HydrophobicContact CZ3-CB 4.32Å; W67-H71 AromaticContact NE1-CD2 3.21Å; W67-H71 PolarHBondContact NE1-CD2 3.25Å; W67-H71 AromaticContact NE1-NE2 3.05Å; W67-H71 PolarHBondContact NE1-NE2 3.29Å; W67-H71 WeakPolarHBondContact O-CB 3.23Å; W67-H71 PolarHBondContact O-CD2 3.42Å; W67-H71 PolarHBondContact O-N 2.82Å
68	H	91.4	Very high	90.3	Very high	70 Å²	70	93.8 Å²	93.8	32%	0.324	49%	0.489	S	S	.	.	H	α-helix	trans	-64.5	-39.7	176.2	-106.8	74.3	0	0	0	112.1	W64 I65 W70 H71 D72	W64-H68 AromaticContact CD2-ND1 3.98Å; W64-H68 AromaticContact CE2-CE1 3.51Å; W64-H68 AromaticContact CE2-ND1 3.36Å; W64-H68 AromaticContact CH2-CE1 3.9Å; W64-H68 AromaticContact CZ2-CE1 3.19Å; W64-H68 WeakPolarHBondContact CZ2-CE1 3.08Å; W64-H68 AromaticContact CZ2-ND1 3.52Å; W64-H68 AromaticContact NE1-CE1 3.73Å; W64-H68 AromaticContact NE1-ND1 3.44Å; W64-H68 PolarHBondContact NE1-ND1 2.82Å; W64-H68 WeakPolarHBondContact O-CB 3.39Å; W64-H68 PolarHBondContact O-N 3.45Å; I65-H68 PolarHBondContact O-N 3.43Å; H68-W70 PolarHBondContact O-N 2.89Å; H68-H71 PolarHBondContact O-N 3.01Å; H68-D72 CarbonylContact O-C 3.52Å; H68-D72 PolarHBondContact O-N 3.43Å
69	C	90.2	Very high	89.6	Confident	59 Å²	59	96.9 Å²	96.9	40%	0.399	50%	0.497	S	S	.	.	H	α-helix	trans	-62.7	-30.3	177	-172	0	0	0	0	112.4	I65 L66 W67 I76	I65-C69 VanDerWaalsContact O-CB 3.26Å; I65-C69 WeakPolarHBondContact O-CB 3.26Å; I65-C69 PolarHBondContact O-N 2.88Å; L66-C69 PolarHBondContact O-N 3.5Å; W67-C69 PolarHBondContact O-N 3.06Å; C69-I76 HydrophobicContact CB-CD1 4.02Å
70	W	90.8	Very high	89	Confident	197 Å²	197	103.6 Å²	103.6	75%	0.746	52%	0.515	S	S	*	.	H	α-helix	trans	-82.6	-40.8	176.4	-173.9	73.6	0	0	0	112.8	L66 W67 H68	L66-W70 PolarHBondContact O-N 2.84Å; W67-W70 PolarHBondContact O-N 3.4Å; H68-W70 PolarHBondContact O-N 2.89Å
71	H	90.5	Very high	88.4	Confident	84 Å²	84	107 Å²	107	39%	0.389	53%	0.533	S	S	.	.	H	α-helix	trans	-79.7	-38.5	-176.8	-82.9	-76.3	0	0	0	113.8	W67 H68 P73	W67-H71 AromaticContact CD1-CD2 3.66Å; W67-H71 AromaticContact CD1-NE2 3.78Å; W67-H71 AromaticContact CD2-CD2 3.43Å; W67-H71 VanDerWaalsContact CD2-CD2 3.43Å; W67-H71 AromaticContact CE2-CD2 3.05Å; W67-H71 AromaticContact CE2-CG 3.99Å; W67-H71 AromaticContact CE2-NE2 3.28Å; W67-H71 VanDerWaalsContact CE2-NE2 3.28Å; W67-H71 AromaticContact CG-CD2 3.82Å; W67-H71 HydrophobicContact CH2-CB 4.33Å; W67-H71 AromaticContact CH2-CD2 3.91Å; W67-H71 AromaticContact CZ2-CD2 3.33Å; W67-H71 WeakPolarHBondContact CZ2-CD2 3.48Å; W67-H71 AromaticContact CZ2-CG 3.86Å; W67-H71 AromaticContact CZ2-NE2 3.48Å; W67-H71 WeakPolarHBondContact CZ2-NE2 3.33Å; W67-H71 HydrophobicContact CZ3-CB 4.32Å; W67-H71 AromaticContact NE1-CD2 3.21Å; W67-H71 PolarHBondContact NE1-CD2 3.25Å; W67-H71 AromaticContact NE1-NE2 3.05Å; W67-H71 PolarHBondContact NE1-NE2 3.29Å; W67-H71 WeakPolarHBondContact O-CB 3.23Å; W67-H71 PolarHBondContact O-CD2 3.42Å; W67-H71 PolarHBondContact O-N 2.82Å; H68-H71 PolarHBondContact O-N 3.01Å; H71-P73 VanDerWaalsContact C-CD 3.43Å; H71-P73 WeakPolarHBondContact O-CD 3.18Å
72	D	86.1	Confident	87.9	Confident	86 Å²	86	113.5 Å²	113.5	46%	0.46	55%	0.553	S	S	.	*			trans	-128	62.9	-177.7	-64.5	-54.7	0	0	0	110.8	H68 D74 A75	H68-D72 CarbonylContact O-C 3.52Å; H68-D72 PolarHBondContact O-N 3.43Å; D72-D74 PolarHBondContact O-N 3.4Å; D72-A75 PolarHBondContact O-N 3.26Å
73	P	84.4	Confident	87.4	Confident	46 Å²	46	109.9 Å²	109.9	30%	0.299	55%	0.548	S	S	.	.	T	Hydrogen-bonded Turn	trans	-64.4	-25.8	179.9	28.4	-35.3	0	0	0	112.2	H71 A75 I76 L77	H71-P73 VanDerWaalsContact C-CD 3.43Å; H71-P73 WeakPolarHBondContact O-CD 3.18Å; P73-A75 PolarHBondContact O-N 3.33Å; P73-I76 PolarHBondContact O-N 3.21Å; P73-L77 HydrophobicContact CB-CD1 4.39Å; P73-L77 PolarHBondContact O-N 3.05Å
74	D	79.3	Confident	86.9	Confident	86 Å²	86	107.3 Å²	107.3	46%	0.46	54%	0.54	S	S	.	.	H	α-helix	trans	-64.4	-28.4	-177	-60	-11.6	0	0	0	112.7	D72 I76 G78 H79	D72-D74 PolarHBondContact O-N 3.4Å; D74-I76 PolarHBondContact O-N 3.36Å; D74-G78 CarbonylContact O-C 3.11Å; D74-G78 WeakPolarHBondContact O-CA 3.5Å; D74-G78 PolarHBondContact O-N 2.86Å; D74-H79 WeakPolarHBondContact CB-ND1 3.48Å; D74-H79 PolarHBondContact O-N 3.45Å
75	A	80.1	Confident	86.3	Confident	74 Å²	74	103.1 Å²	103.1	61%	0.612	54%	0.537	S	S	*	.	H	α-helix	trans	-68.8	-23.1	175.4	0	0	0	0	0	112.4	D72 P73	D72-A75 PolarHBondContact O-N 3.26Å; P73-A75 PolarHBondContact O-N 3.33Å
76	I	81.3	Confident	85.7	Confident	115 Å²	115	104 Å²	104	59%	0.59	55%	0.55	S	S	*	*	H	α-helix	trans	-97.3	-43.5	179.9	-59	173.2	0	0	0	110.6	C69 P73 D74	C69-I76 HydrophobicContact CB-CD1 4.02Å; P73-I76 PolarHBondContact O-N 3.21Å; D74-I76 PolarHBondContact O-N 3.36Å
77	L	81.6	Confident	85.1	Confident	148 Å²	148	106 Å²	106	78%	0.775	55%	0.554	S	S	*	*	H	α-helix	trans	-88.9	-12.9	-175	-64	175.5	0	0	0	113.4	P73	P73-L77 HydrophobicContact CB-CD1 4.39Å; P73-L77 PolarHBondContact O-N 3.05Å
78	G	84.6	Confident	84.6	Confident	45 Å²	45	107.5 Å²	107.5	46%	0.464	56%	0.56	S	S	.	*			trans	97	130.6	-174.8	0	0	0	0	0	111.3	D74 F80	D74-G78 CarbonylContact O-C 3.11Å; D74-G78 WeakPolarHBondContact O-CA 3.5Å; D74-G78 PolarHBondContact O-N 2.86Å; G78-F80 VanDerWaalsContact C-N 3.28Å; G78-F80 PolarHBondContact O-N 3.47Å
79	H	83.4	Confident	84.2	Confident	123 Å²	123	107.5 Å²	107.5	57%	0.569	57%	0.565	S	S	*	*	S	Bend	trans	-69	-25.9	179.2	-67.6	-79	0	0	0	113.5	D74	D74-H79 WeakPolarHBondContact CB-ND1 3.48Å; D74-H79 PolarHBondContact O-N 3.45Å
80	F	83.9	Confident	83.9	Confident	180 Å²	180	109.5 Å²	109.5	79%	0.789	57%	0.572	S	S	*	*	S	Bend	trans	-127.7	139	-175.1	-65.5	-77.8	0	0	0	110.8	G78 W82	G78-F80 VanDerWaalsContact C-N 3.28Å; G78-F80 PolarHBondContact O-N 3.47Å; F80-W82 PolarHBondContact O-N 2.94Å
81	P	86.1	Confident	83.3	Confident	118 Å²	118	108.8 Å²	108.8	77%	0.766	58%	0.577	S	S	*	*	P	Polyproline II helix	trans	-63.9	136.9	173	28.5	-33.8	0	0	0	109.4
82	W	84.5	Confident	82.9	Confident	236 Å²	236	112.1 Å²	112.1	89%	0.894	59%	0.592	S	S	*	*	P	Polyproline II helix	trans	-68.1	124.4	175.2	-172.1	-97.4	0	0	0	109.9	F80	F80-W82 PolarHBondContact O-N 2.94Å
83	P	85.4	Confident	82.8	Confident	69 Å²	69	112 Å²	112	45%	0.448	59%	0.591	S	S	.	*	P	Polyproline II helix	trans	-68.8	138.2	-179.5	27.9	-33.2	0	0	0	110.7	A85 W88	P83-A85 PolarHBondContact O-N 3.22Å; P83-W88 HydrophobicContact CB-CZ2 4.2Å; P83-W88 HydrophobicContact CG-CZ2 4.34Å
84	D	85.3	Confident	82.7	Confident	77 Å²	77	112.8 Å²	112.8	41%	0.412	61%	0.607	S	S	.	*			trans	-85.5	107	173.5	-177.2	-1.4	0	0	0	109	S86 K87	D84-S86 VanDerWaalsContact CG-OG 3.28Å; D84-S86 PolarHBondContact O-N 2.71Å; D84-S86 VanDerWaalsContact O-N 3.13Å; D84-S86 PolarHBondContact OD1-N 3.37Å; D84-S86 PolarHBondContact OD1-OG 3.24Å; D84-S86 PolarHBondContact OD2-OG 3.13Å; D84-K87 HydrophobicContact CB-CD 4.09Å; D84-K87 HydrophobicContact CB-CG 4.26Å; D84-K87 PolarHBondContact O-N 3.36Å; D84-K87 VanDerWaalsContact O-N 3.13Å; D84-K87 VanDerWaalsContact OD2-CE 3.29Å; D84-K87 WeakPolarHBondContact OD2-CE 3.28Å; D84-K87 IonicContact OD2-NZ 3.78Å
85	A	82.3	Confident	83	Confident	60 Å²	60	113 Å²	113	50%	0.496	61%	0.607	S	S	.	*	G	3₁₀ helix	trans	-61	-21.3	-175.5	0	0	0	0	0	113.5	P83 K87 W88	P83-A85 PolarHBondContact O-N 3.22Å; A85-K87 VanDerWaalsContact C-N 3.27Å; A85-K87 PolarHBondContact O-N 3.43Å; A85-W88 HydrophobicContact CB-CE3 4.17Å; A85-W88 HydrophobicContact CB-CZ3 4.12Å
86	S	79.8	Confident	83.1	Confident	99 Å²	99	113.9 Å²	113.9	69%	0.692	61%	0.607	S	S	*	*	G	3₁₀ helix	trans	-76	-12.6	179.1	67.9	0	0	0	0	114.2	D84	D84-S86 VanDerWaalsContact CG-OG 3.28Å; D84-S86 PolarHBondContact O-N 2.71Å; D84-S86 VanDerWaalsContact O-N 3.13Å; D84-S86 PolarHBondContact OD1-N 3.37Å; D84-S86 PolarHBondContact OD1-OG 3.24Å; D84-S86 PolarHBondContact OD2-OG 3.13Å
87	K	82.1	Confident	83	Confident	159 Å²	159	113.1 Å²	113.1	69%	0.691	61%	0.61	S	S	*	*	G	3₁₀ helix	trans	-91.6	-8.7	178.5	-65.5	-179.8	-175.9	163.5	0	113.2	D84 A85 T89	D84-K87 HydrophobicContact CB-CD 4.09Å; D84-K87 HydrophobicContact CB-CG 4.26Å; D84-K87 PolarHBondContact O-N 3.36Å; D84-K87 VanDerWaalsContact O-N 3.13Å; D84-K87 VanDerWaalsContact OD2-CE 3.29Å; D84-K87 WeakPolarHBondContact OD2-CE 3.28Å; D84-K87 IonicContact OD2-NZ 3.78Å; A85-K87 VanDerWaalsContact C-N 3.27Å; A85-K87 PolarHBondContact O-N 3.43Å; K87-T89 PolarHBondContact O-N 2.93Å
88	W	84.5	Confident	82.8	Confident	126 Å²	126	113.2 Å²	113.2	48%	0.477	61%	0.611	S	S	.	*	S	Bend	trans	-70.1	129.4	174.5	-63.4	-22.3	0	0	0	108.7	P83 A85 L93	P83-W88 HydrophobicContact CB-CZ2 4.2Å; P83-W88 HydrophobicContact CG-CZ2 4.34Å; A85-W88 HydrophobicContact CB-CE3 4.17Å; A85-W88 HydrophobicContact CB-CZ3 4.12Å; W88-L93 HydrophobicContact CB-CD1 3.43Å; W88-L93 VanDerWaalsContact CB-CD1 3.43Å; W88-L93 HydrophobicContact CB-CG 4.17Å; W88-L93 HydrophobicContact CE3-CD2 4.3Å
89	T	83.1	Confident	82	Confident	71 Å²	71	118.2 Å²	118.2	44%	0.436	63%	0.627	S	S	.	*			trans	-78.5	146.4	-178.8	56	0	0	0	0	109.8	K87 E91 E92 L93	K87-T89 PolarHBondContact O-N 2.93Å; T89-E91 PolarHBondContact O-N 3.38Å; T89-E91 VanDerWaalsContact O-N 3.08Å; T89-E92 PolarHBondContact O-N 3.46Å; T89-E92 WeakPolarHBondContact OG1-CG 3.29Å; T89-L93 WeakPolarHBondContact O-CD1 3.44Å; T89-L93 PolarHBondContact O-N 3.04Å
90	D	82.9	Confident	81	Confident	101 Å²	101	120.9 Å²	120.9	54%	0.54	64%	0.64	S	S	.	*	H	α-helix	trans	-57.1	-26.9	178.4	-63.5	-40.1	0	0	0	112.2	L93 G94 I95	D90-L93 CarbonylContact O-C 3.57Å; D90-L93 PolarHBondContact O-N 2.84Å; D90-G94 PolarHBondContact O-N 2.86Å; D90-I95 HydrophobicContact CB-CB 4.12Å; D90-I95 PolarHBondContact O-N 3.49Å
91	E	77.7	Confident	79.5	Confident	182 Å²	182	125.4 Å²	125.4	85%	0.85	66%	0.663	S	S	*	*	H	α-helix	trans	-64.5	-42.9	171.4	-171.6	-177.6	179	0	0	113.1	T89 G94	T89-E91 PolarHBondContact O-N 3.38Å; T89-E91 VanDerWaalsContact O-N 3.08Å; E91-G94 PolarHBondContact O-N 3.08Å
92	E	82.6	Confident	79.2	Confident	153 Å²	153	125.8 Å²	125.8	72%	0.715	66%	0.658	S	S	*	*	H	α-helix	trans	-72.5	-31.6	176.3	-72.3	178.6	177.9	0	0	112.1	T89 G94	T89-E92 PolarHBondContact O-N 3.46Å; T89-E92 WeakPolarHBondContact OG1-CG 3.29Å; E92-G94 VanDerWaalsContact C-N 3.28Å
93	L	83.3	Confident	78.9	Confident	85 Å²	85	119.9 Å²	119.9	45%	0.445	65%	0.646	S	S	.	*	H	α-helix	trans	-80.2	-9.6	175.4	-78.1	136.7	0	0	0	113.1	W88 T89 D90 I95	W88-L93 HydrophobicContact CB-CD1 3.43Å; W88-L93 VanDerWaalsContact CB-CD1 3.43Å; W88-L93 HydrophobicContact CB-CG 4.17Å; W88-L93 HydrophobicContact CE3-CD2 4.3Å; T89-L93 WeakPolarHBondContact O-CD1 3.44Å; T89-L93 PolarHBondContact O-N 3.04Å; D90-L93 CarbonylContact O-C 3.57Å; D90-L93 PolarHBondContact O-N 2.84Å; L93-I95 HydrophobicContact CB-CD1 3.87Å; L93-I95 HydrophobicContact CB-CG1 3.9Å; L93-I95 PolarHBondContact O-N 3.32Å
94	G	83.9	Confident	78.6	Confident	61 Å²	61	122.8 Å²	122.8	63%	0.629	66%	0.657	S	S	*	*	T	Hydrogen-bonded Turn	trans	64.3	27.2	-177.4	0	0	0	0	0	113.3	D90 E91 E92 P96	D90-G94 PolarHBondContact O-N 2.86Å; E91-G94 PolarHBondContact O-N 3.08Å; E92-G94 VanDerWaalsContact C-N 3.28Å; G94-P96 VanDerWaalsContact O-CD 3.28Å; G94-P96 WeakPolarHBondContact O-CD 3.39Å
95	I	84.5	Confident	78.2	Confident	90 Å²	90	125.5 Å²	125.5	46%	0.462	67%	0.671	S	S	.	*			trans	-84	109.9	175.9	-59.2	171.2	0	0	0	106.4	D90 L93	D90-I95 HydrophobicContact CB-CB 4.12Å; D90-I95 PolarHBondContact O-N 3.49Å; L93-I95 HydrophobicContact CB-CD1 3.87Å; L93-I95 HydrophobicContact CB-CG1 3.9Å; L93-I95 PolarHBondContact O-N 3.32Å
96	P	82.1	Confident	77.9	Confident	94 Å²	94	129.6 Å²	129.6	61%	0.61	68%	0.682	S	S	*	*			trans	-62.4	143.5	176.7	25.6	-31.3	0	0	0	109.5	G94 D98	G94-P96 VanDerWaalsContact O-CD 3.28Å; G94-P96 WeakPolarHBondContact O-CD 3.39Å; P96-D98 PolarHBondContact O-N 2.92Å
97	P	80.4	Confident	77.8	Confident	99 Å²	99	131.6 Å²	131.6	64%	0.643	68%	0.681	S	S	*	*			trans	-59.6	131.6	169.2	26.3	-32	0	0	0	108.3	D99	P97-D99 PolarHBondContact O-N 3.13Å
98	D	75.9	Confident	77.5	Confident	149 Å²	149	129.6 Å²	129.6	80%	0.797	68%	0.681	S	S	*	*			trans	-70.1	85.3	171.1	-72.9	-26.3	0	0	0	107.6	P96 E100	P96-D98 PolarHBondContact O-N 2.92Å; D98-E100 PolarHBondContact O-N 2.91Å
99	D	67.4	Low	76.9	Confident	151 Å²	151	129.9 Å²	129.9	81%	0.807	70%	0.696	S	S	*	*			trans	-70.9	80	168.7	-70.2	-27.3	0	0	0	108.4	P97	P97-D99 PolarHBondContact O-N 3.13Å
100	E	62.8	Low	76.4	Confident	179 Å²	179	134.8 Å²	134.8	84%	0.836	72%	0.718	S	S	*	*			trans	-109	99	164.5	-70	-167.5	172	0	0	110.2	D98	D98-E100 PolarHBondContact O-N 2.91Å
101	E	53.5	Low	75.8	Confident	274 Å²	274	137.9 Å²	137.9	100%	1.28	73%	0.734	S	S	*	*			trans	65.6	0	157.3	-155.9	158.1	-160	0	0	120.9

Retrieved 101 of 101 residues in 71.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).