A0A087YEF6_POEFO Loading...

Kinetochore localized astrin (SPAG5) binding protein

AlphaFold DB , UniProt , Accession A0A087YEF6, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 142 aa.

						>A0A087YEF6_POEFO|A0A087YEF6
NLLCFRKNVAPKVHKGVSTRYGQQVELKEQNQNLVAAKEELQKNLSEKQQRVEELELQLDELQKENVEFQKNLQDCHRLLVSAKIDPVLGERVGDAARQKEDERKEVMSVSTDLLRELKAFGDIASQQRTQLQASHRLLSPL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	N	40.4	Very low	44	Very low	212 Å²	212	154.4 Å²	154.4	100%	1.134	81%	0.811	S	S	*	*				0	135.5	0	-86.9	-26.7	0	0	0	109.3
2	L	44.6	Very low	44.5	Very low	157 Å²	157	156.7 Å²	156.7	82%	0.822	81%	0.809	S	S	*	*			trans	76.6	86.1	-177.4	-86	68.8	0	0	0	115.8
3	L	40.8	Very low	44.6	Very low	165 Å²	165	151.8 Å²	151.8	86%	0.864	79%	0.791	S	S	*	*				67.8	108.7	77.1	-82.7	143.6	0	0	0	115.2
4	C	39.9	Very low	44.7	Very low	110 Å²	110	152.6 Å²	152.6	74%	0.743	79%	0.788	S	S	*	*			trans	-20.9	139.5	159.3	-56.5	0	0	0	0	118.3
5	F	38.6	Very low	45.2	Very low	188 Å²	188	154.5 Å²	154.5	83%	0.825	79%	0.788	S	S	*	*			trans	-155.8	78.6	132.2	-112.8	-78	0	0	0	110.1	K7	F5-K7 HydrophobicContact CD1-CG 4.21Å; F5-K7 PolarHBondContact O-N 3.47Å
6	R	46.5	Very low	45.6	Very low	233 Å²	233	148.8 Å²	148.8	88%	0.879	78%	0.779	S	S	*	*			trans	-78.4	98.5	159.3	-83.9	-165.7	179	-165.2	1.7	107.5	N8	R6-N8 PolarHBondContact O-N 3.2Å; R6-N8 VanDerWaalsContact O-N 3.1Å
7	K	48.4	Very low	46	Very low	168 Å²	168	148 Å²	148	73%	0.73	78%	0.782	S	S	*	*			trans	-69.5	98.3	165.9	-78.4	179.3	174.9	175.3	0	108.1	F5 V9	F5-K7 HydrophobicContact CD1-CG 4.21Å; F5-K7 PolarHBondContact O-N 3.47Å; K7-V9 VanDerWaalsContact C-N 3.31Å; K7-V9 PolarHBondContact O-N 3.22Å
8	N	45.7	Very low	46.7	Very low	152 Å²	152	142.6 Å²	142.6	81%	0.813	76%	0.758	S	S	*	*			trans	-69.7	92.3	162.3	-76	-32.1	0	0	0	107.8	R6 A10	R6-N8 PolarHBondContact O-N 3.2Å; R6-N8 VanDerWaalsContact O-N 3.1Å; N8-A10 PolarHBondContact O-N 2.93Å
9	V	47.5	Very low	48.1	Very low	128 Å²	128	139.6 Å²	139.6	78%	0.776	75%	0.746	S	S	*	*			trans	-77	98.7	164.4	179	0	0	0	0	106	K7	K7-V9 VanDerWaalsContact C-N 3.31Å; K7-V9 PolarHBondContact O-N 3.22Å
10	A	46.5	Very low	49.2	Very low	76 Å²	76	144 Å²	144	63%	0.628	75%	0.751	S	S	*	*			trans	-56.9	124.8	166.8	0	0	0	0	0	108	N8 K12	N8-A10 PolarHBondContact O-N 2.93Å; A10-K12 PolarHBondContact O-N 3.21Å
11	P	44.6	Very low	50.3	Low	109 Å²	109	145 Å²	145	71%	0.708	75%	0.746	S	S	*	*			trans	-67.5	107.2	167.4	18.9	-12.6	0	0	0	105.8	V13	P11-V13 HydrophobicContact CB-CG2 4.14Å; P11-V13 PolarHBondContact O-N 3.43Å
12	K	50.7	Low	52.2	Low	182 Å²	182	136 Å²	136	79%	0.791	70%	0.703	S	S	*	*			trans	-63.3	77.9	164.9	-87	-178.6	172	-177.8	0	107.6	A10 H14	A10-K12 PolarHBondContact O-N 3.21Å; K12-H14 PolarHBondContact O-N 3.47Å
13	V	45.3	Very low	54.1	Low	94 Å²	94	133.4 Å²	133.4	57%	0.57	69%	0.687	S	S	*	*			trans	-74.4	84.7	165.5	-177.7	0	0	0	0	105.6	P11 K15	P11-V13 HydrophobicContact CB-CG2 4.14Å; P11-V13 PolarHBondContact O-N 3.43Å; V13-K15 HydrophobicContact CG1-CB 3.92Å; V13-K15 HydrophobicContact CG1-CD 3.6Å; V13-K15 HydrophobicContact CG1-CG 3.41Å; V13-K15 VanDerWaalsContact CG1-CG 3.41Å; V13-K15 PolarHBondContact O-N 3.42Å
14	H	46.6	Very low	56.2	Low	163 Å²	163	130.2 Å²	130.2	76%	0.755	67%	0.668	S	S	*	*			trans	-69.3	71.9	156.4	-73.8	77.2	0	0	0	106.8	K12 G16	K12-H14 PolarHBondContact O-N 3.47Å; H14-G16 VanDerWaalsContact C-N 3.25Å; H14-G16 PolarHBondContact O-N 2.96Å; H14-G16 VanDerWaalsContact O-N 3.09Å
15	K	52	Low	58.4	Low	181 Å²	181	128.2 Å²	128.2	79%	0.787	65%	0.652	S	S	*	*			trans	-71.5	97.9	155.8	-89.7	170.9	-174.4	-169.3	0	104	V13 V17	V13-K15 HydrophobicContact CG1-CB 3.92Å; V13-K15 HydrophobicContact CG1-CD 3.6Å; V13-K15 HydrophobicContact CG1-CG 3.41Å; V13-K15 VanDerWaalsContact CG1-CG 3.41Å; V13-K15 PolarHBondContact O-N 3.42Å; K15-V17 PolarHBondContact O-N 3.44Å
16	G	52.2	Low	60.8	Low	62 Å²	62	124.3 Å²	124.3	64%	0.639	64%	0.636	S	S	*	*			trans	-44	138.4	164.1	0	0	0	0	0	108	H14 S18	H14-G16 VanDerWaalsContact C-N 3.25Å; H14-G16 PolarHBondContact O-N 2.96Å; H14-G16 VanDerWaalsContact O-N 3.09Å; G16-S18 VanDerWaalsContact C-N 3.33Å; G16-S18 PolarHBondContact O-N 2.83Å
17	V	52.5	Low	62.9	Low	136 Å²	136	117.9 Å²	117.9	82%	0.824	62%	0.619	S	S	*	*			trans	-46.9	100.4	-178.8	179	0	0	0	0	107.9	K15 T19	K15-V17 PolarHBondContact O-N 3.44Å; V17-T19 VanDerWaalsContact C-N 3.34Å; V17-T19 PolarHBondContact O-N 3.42Å
18	S	58.5	Low	65	Low	50 Å²	50	115.8 Å²	115.8	35%	0.35	61%	0.61	S	S	.	*			trans	-64.7	105.4	176.5	-178.3	0	0	0	0	104.4	G16 Q23	G16-S18 VanDerWaalsContact C-N 3.33Å; G16-S18 PolarHBondContact O-N 2.83Å; S18-Q23 WeakPolarHBondContact OG-CG 3.42Å
19	T	72.5	Confident	67.2	Low	86 Å²	86	113.8 Å²	113.8	53%	0.528	60%	0.596	S	S	.	*			trans	-59	145.3	-176.7	57.9	0	0	0	0	107.2	V17 Y21 G22 Q23	V17-T19 VanDerWaalsContact C-N 3.34Å; V17-T19 PolarHBondContact O-N 3.42Å; T19-Y21 CarbonylContact O-C 3.6Å; T19-Y21 PolarHBondContact O-N 2.94Å; T19-G22 WeakPolarHBondContact O-CA 3.36Å; T19-G22 PolarHBondContact O-N 3.29Å; T19-G22 PolarHBondContact OG1-N 2.94Å; T19-Q23 PolarHBondContact O-N 2.84Å
20	R	70.8	Confident	69.5	Low	227 Å²	227	113.1 Å²	113.1	86%	0.857	58%	0.584	S	S	*	*	H	α-helix	trans	-47.7	-30.4	179.3	-175.2	-179.5	178.4	-170.2	0.3	112.8	Q24	R20-Q24 PolarHBondContact O-N 2.99Å
21	Y	72.7	Confident	71.8	Confident	167 Å²	167	114.1 Å²	114.1	66%	0.655	58%	0.579	S	S	*	*	H	α-helix	trans	-72.2	-41.2	175	-170.4	-101.7	0	0	0	113.7	T19 Q24 V25	T19-Y21 CarbonylContact O-C 3.6Å; T19-Y21 PolarHBondContact O-N 2.94Å; Y21-Q24 WeakPolarHBondContact O-CB 3.32Å; Y21-Q24 PolarHBondContact O-N 3.22Å; Y21-V25 HydrophobicContact CD1-CG2 4.43Å; Y21-V25 HydrophobicContact CE1-CG2 4.1Å; Y21-V25 WeakPolarHBondContact O-CG2 3.22Å; Y21-V25 PolarHBondContact O-N 3.46Å; Y21-V25 VanDerWaalsContact O-N 3.11Å
22	G	80.1	Confident	74.3	Confident	22 Å²	22	115.4 Å²	115.4	23%	0.227	58%	0.575	C	S	.	*	H	α-helix	trans	-62.3	-44.5	175.6	0	0	0	0	0	112.7	T19 Q24 V25 E26	T19-G22 WeakPolarHBondContact O-CA 3.36Å; T19-G22 PolarHBondContact O-N 3.29Å; T19-G22 PolarHBondContact OG1-N 2.94Å; G22-Q24 PolarHBondContact O-N 3.41Å; G22-V25 PolarHBondContact O-N 3.41Å; G22-E26 PolarHBondContact O-N 2.92Å
23	Q	84.3	Confident	76.5	Confident	103 Å²	103	111.4 Å²	111.4	48%	0.481	56%	0.562	S	S	.	*	H	α-helix	trans	-60.3	-36.2	174.3	-63.1	-178.2	-23.7	0	0	112.2	S18 T19 L27	S18-Q23 WeakPolarHBondContact OG-CG 3.42Å; T19-Q23 PolarHBondContact O-N 2.84Å; Q23-L27 WeakPolarHBondContact O-CB 3.32Å; Q23-L27 VanDerWaalsContact O-CG 3.28Å; Q23-L27 WeakPolarHBondContact O-CG 3.49Å; Q23-L27 PolarHBondContact O-N 2.9Å
24	Q	84.8	Confident	78.9	Confident	97 Å²	97	112.3 Å²	112.3	45%	0.453	56%	0.564	S	S	.	*	H	α-helix	trans	-68.4	-36.4	178.3	-172.1	-179.6	16.3	0	0	112.3	R20 Y21 G22 K28	R20-Q24 PolarHBondContact O-N 2.99Å; Y21-Q24 WeakPolarHBondContact O-CB 3.32Å; Y21-Q24 PolarHBondContact O-N 3.22Å; G22-Q24 PolarHBondContact O-N 3.41Å; Q24-K28 WeakPolarHBondContact O-CG 3.43Å; Q24-K28 PolarHBondContact O-N 2.85Å
25	V	85.9	Confident	81.4	Confident	69 Å²	69	108.2 Å²	108.2	42%	0.418	55%	0.55	S	S	.	.	H	α-helix	trans	-70.8	-46.4	176.8	175.2	0	0	0	0	110.6	Y21 G22 L27 K28 E29	Y21-V25 HydrophobicContact CD1-CG2 4.43Å; Y21-V25 HydrophobicContact CE1-CG2 4.1Å; Y21-V25 WeakPolarHBondContact O-CG2 3.22Å; Y21-V25 PolarHBondContact O-N 3.46Å; Y21-V25 VanDerWaalsContact O-N 3.11Å; G22-V25 PolarHBondContact O-N 3.41Å; V25-L27 VanDerWaalsContact C-N 3.33Å; V25-L27 PolarHBondContact O-N 3.28Å; V25-K28 WeakPolarHBondContact O-CB 3.49Å; V25-K28 PolarHBondContact O-N 3.18Å; V25-K28 VanDerWaalsContact O-N 3.09Å; V25-E29 PolarHBondContact O-N 3.19Å
26	E	88.6	Confident	83.5	Confident	106 Å²	106	102.1 Å²	102.1	50%	0.495	53%	0.534	S	S	.	.	H	α-helix	trans	-58.5	-42.9	176.8	-72.3	173.5	-165.3	0	0	112	G22 K28 E29 Q30	G22-E26 PolarHBondContact O-N 2.92Å; E26-K28 VanDerWaalsContact C-N 3.33Å; E26-K28 PolarHBondContact O-N 2.95Å; E26-E29 PolarHBondContact O-N 3.38Å; E26-Q30 WeakPolarHBondContact O-CB 3.49Å; E26-Q30 WeakPolarHBondContact O-CG 3.43Å; E26-Q30 PolarHBondContact O-N 2.95Å
27	L	91.1	Very high	85.6	Confident	98 Å²	98	101.3 Å²	101.3	51%	0.513	52%	0.52	S	S	.	.	H	α-helix	trans	-65.4	-34.2	176.1	-76.4	170.1	0	0	0	113	Q23 V25 N31	Q23-L27 WeakPolarHBondContact O-CB 3.32Å; Q23-L27 VanDerWaalsContact O-CG 3.28Å; Q23-L27 WeakPolarHBondContact O-CG 3.49Å; Q23-L27 PolarHBondContact O-N 2.9Å; V25-L27 VanDerWaalsContact C-N 3.33Å; V25-L27 PolarHBondContact O-N 3.28Å; L27-N31 WeakPolarHBondContact O-CB 3.4Å; L27-N31 PolarHBondContact O-N 3.49Å; L27-N31 PolarHBondContact O-ND2 3.41Å
28	K	92	Very high	87.8	Confident	124 Å²	124	101.7 Å²	101.7	54%	0.539	51%	0.511	S	S	.	.	H	α-helix	trans	-68.2	-43.9	175.4	-79.3	178	178.5	-176.3	0	111.1	Q24 V25 E26 N31 Q32	Q24-K28 WeakPolarHBondContact O-CG 3.43Å; Q24-K28 PolarHBondContact O-N 2.85Å; V25-K28 WeakPolarHBondContact O-CB 3.49Å; V25-K28 PolarHBondContact O-N 3.18Å; V25-K28 VanDerWaalsContact O-N 3.09Å; E26-K28 VanDerWaalsContact C-N 3.33Å; E26-K28 PolarHBondContact O-N 2.95Å; K28-N31 PolarHBondContact O-N 2.86Å; K28-Q32 WeakPolarHBondContact O-CG 3.37Å; K28-Q32 PolarHBondContact O-N 2.9Å
29	E	93	Very high	89.6	Confident	110 Å²	110	105.2 Å²	105.2	51%	0.514	52%	0.522	S	S	.	.	H	α-helix	trans	-63.4	-44.6	177.3	-173.7	177.8	-174.9	0	0	111.4	V25 E26 N31 Q32 N33	V25-E29 PolarHBondContact O-N 3.19Å; E26-E29 PolarHBondContact O-N 3.38Å; E29-N31 VanDerWaalsContact C-N 3.34Å; E29-N31 PolarHBondContact O-N 3.45Å; E29-Q32 PolarHBondContact O-N 3.35Å; E29-N33 PolarHBondContact O-N 3.37Å; E29-N33 PolarHBondContact O-ND2 2.79Å
30	Q	95.2	Very high	90.8	Very high	113 Å²	113	107.3 Å²	107.3	53%	0.528	53%	0.526	S	S	.	.	H	α-helix	trans	-60	-43	174	-73.9	178.1	1.6	0	0	112.2	E26 Q32 N33 L34	E26-Q30 WeakPolarHBondContact O-CB 3.49Å; E26-Q30 WeakPolarHBondContact O-CG 3.43Å; E26-Q30 PolarHBondContact O-N 2.95Å; Q30-Q32 VanDerWaalsContact C-N 3.34Å; Q30-Q32 PolarHBondContact O-N 3.1Å; Q30-N33 PolarHBondContact O-N 2.94Å; Q30-L34 WeakPolarHBondContact O-CB 3.49Å; Q30-L34 VanDerWaalsContact O-CG 3.29Å; Q30-L34 WeakPolarHBondContact O-CG 3.24Å; Q30-L34 PolarHBondContact O-N 3.46Å
31	N	95.4	Very high	92.1	Very high	98 Å²	98	102.1 Å²	102.1	52%	0.524	51%	0.514	S	S	.	.	H	α-helix	trans	-62.7	-40	175.7	-84.4	-49.3	0	0	0	112.2	L27 K28 E29 L34 V35	L27-N31 WeakPolarHBondContact O-CB 3.4Å; L27-N31 PolarHBondContact O-N 3.49Å; L27-N31 PolarHBondContact O-ND2 3.41Å; K28-N31 PolarHBondContact O-N 2.86Å; E29-N31 VanDerWaalsContact C-N 3.34Å; E29-N31 PolarHBondContact O-N 3.45Å; N31-L34 PolarHBondContact O-N 3.34Å; N31-V35 VanDerWaalsContact O-CG2 3.29Å; N31-V35 WeakPolarHBondContact O-CG2 3.29Å; N31-V35 PolarHBondContact O-N 3.32Å
32	Q	96	Very high	93.4	Very high	135 Å²	135	100.3 Å²	100.3	63%	0.631	51%	0.512	S	S	*	.	H	α-helix	trans	-63	-45.3	175.5	-74.4	174.1	-15.2	0	0	111.5	K28 E29 Q30 L34 V35 A36	K28-Q32 WeakPolarHBondContact O-CG 3.37Å; K28-Q32 PolarHBondContact O-N 2.9Å; E29-Q32 PolarHBondContact O-N 3.35Å; Q30-Q32 VanDerWaalsContact C-N 3.34Å; Q30-Q32 PolarHBondContact O-N 3.1Å; Q32-L34 VanDerWaalsContact C-N 3.31Å; Q32-L34 PolarHBondContact O-N 2.91Å; Q32-V35 PolarHBondContact O-N 3.14Å; Q32-A36 PolarHBondContact O-N 3.33Å
33	N	96.4	Very high	94.2	Very high	98 Å²	98	105.4 Å²	105.4	52%	0.524	53%	0.528	S	S	.	.	H	α-helix	trans	-62.1	-39.5	176.3	-68.7	-23.3	0	0	0	111.9	E29 Q30 A36 A37	E29-N33 PolarHBondContact O-N 3.37Å; E29-N33 PolarHBondContact O-ND2 2.79Å; Q30-N33 PolarHBondContact O-N 2.94Å; N33-A36 PolarHBondContact O-N 3.23Å; N33-A37 WeakPolarHBondContact O-CB 3.46Å; N33-A37 PolarHBondContact O-N 3.39Å
34	L	97.3	Very high	94.9	Very high	114 Å²	114	103.7 Å²	103.7	60%	0.597	52%	0.522	S	S	*	.	H	α-helix	trans	-65.9	-38.7	175.3	-74.6	172.3	0	0	0	112.3	Q30 N31 Q32 K38	Q30-L34 WeakPolarHBondContact O-CB 3.49Å; Q30-L34 VanDerWaalsContact O-CG 3.29Å; Q30-L34 WeakPolarHBondContact O-CG 3.24Å; Q30-L34 PolarHBondContact O-N 3.46Å; N31-L34 PolarHBondContact O-N 3.34Å; Q32-L34 VanDerWaalsContact C-N 3.31Å; Q32-L34 PolarHBondContact O-N 2.91Å; L34-K38 VanDerWaalsContact O-CB 3.23Å; L34-K38 WeakPolarHBondContact O-CB 3.36Å; L34-K38 PolarHBondContact O-N 2.77Å
35	V	97.3	Very high	95.5	Very high	76 Å²	76	103.8 Å²	103.8	46%	0.461	53%	0.525	S	S	.	.	H	α-helix	trans	-64.9	-47.5	175.4	169.8	0	0	0	0	110.4	N31 Q32 A37 K38 E39	N31-V35 VanDerWaalsContact O-CG2 3.29Å; N31-V35 WeakPolarHBondContact O-CG2 3.29Å; N31-V35 PolarHBondContact O-N 3.32Å; Q32-V35 PolarHBondContact O-N 3.14Å; V35-A37 PolarHBondContact O-N 2.91Å; V35-K38 WeakPolarHBondContact O-CB 3.41Å; V35-K38 PolarHBondContact O-N 3.33Å; V35-E39 WeakPolarHBondContact O-CG 3.31Å; V35-E39 PolarHBondContact O-N 2.79Å
36	A	96.8	Very high	96.1	Very high	54 Å²	54	103.4 Å²	103.4	45%	0.446	53%	0.525	S	S	.	.	H	α-helix	trans	-60.1	-46.2	177.5	0	0	0	0	0	111.9	Q32 N33 K38 E39 E40	Q32-A36 PolarHBondContact O-N 3.33Å; N33-A36 PolarHBondContact O-N 3.23Å; A36-K38 VanDerWaalsContact C-N 3.31Å; A36-K38 PolarHBondContact O-N 2.95Å; A36-E39 PolarHBondContact O-N 3.01Å; A36-E40 PolarHBondContact O-N 2.94Å
37	A	97.1	Very high	96.5	Very high	44 Å²	44	102.6 Å²	102.6	36%	0.364	52%	0.522	S	S	.	.	H	α-helix	trans	-62.9	-37.9	176.4	0	0	0	0	0	112.1	N33 V35 L41	N33-A37 WeakPolarHBondContact O-CB 3.46Å; N33-A37 PolarHBondContact O-N 3.39Å; V35-A37 PolarHBondContact O-N 2.91Å; A37-L41 WeakPolarHBondContact O-CB 3.44Å; A37-L41 VanDerWaalsContact O-CG 3.25Å; A37-L41 WeakPolarHBondContact O-CG 3.33Å; A37-L41 PolarHBondContact O-N 3.2Å
38	K	97.4	Very high	96.9	Very high	144 Å²	144	104.8 Å²	104.8	63%	0.626	53%	0.527	S	S	*	.	H	α-helix	trans	-63.9	-44.9	175.6	179.2	-174.7	172.8	-173	0	111.5	L34 V35 A36 L41 Q42	L34-K38 VanDerWaalsContact O-CB 3.23Å; L34-K38 WeakPolarHBondContact O-CB 3.36Å; L34-K38 PolarHBondContact O-N 2.77Å; V35-K38 WeakPolarHBondContact O-CB 3.41Å; V35-K38 PolarHBondContact O-N 3.33Å; A36-K38 VanDerWaalsContact C-N 3.31Å; A36-K38 PolarHBondContact O-N 2.95Å; K38-L41 PolarHBondContact O-N 2.94Å; K38-Q42 WeakPolarHBondContact O-CB 3.32Å; K38-Q42 PolarHBondContact O-N 3.32Å
39	E	97.8	Very high	97.2	Very high	125 Å²	125	104.1 Å²	104.1	58%	0.584	53%	0.526	S	S	*	.	H	α-helix	trans	-63.2	-43.3	178	-72.8	174.3	178.2	0	0	111.4	V35 A36 Q42 K43	V35-E39 WeakPolarHBondContact O-CG 3.31Å; V35-E39 PolarHBondContact O-N 2.79Å; A36-E39 PolarHBondContact O-N 3.01Å; E39-Q42 PolarHBondContact O-N 2.92Å; E39-K43 WeakPolarHBondContact O-CB 3.3Å; E39-K43 PolarHBondContact O-N 2.68Å
40	E	97.9	Very high	97.4	Very high	129 Å²	129	104.1 Å²	104.1	60%	0.603	53%	0.526	S	S	*	.	H	α-helix	trans	-63.7	-43.6	175.9	-177.3	171.7	-164.1	0	0	112.2	A36 Q42 K43 N44	A36-E40 PolarHBondContact O-N 2.94Å; E40-Q42 VanDerWaalsContact C-N 3.33Å; E40-Q42 PolarHBondContact O-N 3.43Å; E40-K43 PolarHBondContact O-N 2.93Å; E40-N44 WeakPolarHBondContact O-CB 3.35Å; E40-N44 PolarHBondContact O-N 3.08Å; E40-N44 PolarHBondContact O-ND2 3.34Å; E40-N44 VanDerWaalsContact O-ND2 3.12Å
41	L	98.1	Very high	97.6	Very high	118 Å²	118	104.2 Å²	104.2	62%	0.618	52%	0.521	S	S	*	.	H	α-helix	trans	-62	-41.1	174.6	-75.8	172.6	0	0	0	111.8	A37 K38 N44 L45	A37-L41 WeakPolarHBondContact O-CB 3.44Å; A37-L41 VanDerWaalsContact O-CG 3.25Å; A37-L41 WeakPolarHBondContact O-CG 3.33Å; A37-L41 PolarHBondContact O-N 3.2Å; K38-L41 PolarHBondContact O-N 2.94Å; L41-N44 PolarHBondContact O-N 3.33Å; L41-L45 VanDerWaalsContact O-CB 3.26Å; L41-L45 WeakPolarHBondContact O-CB 3.36Å; L41-L45 PolarHBondContact O-N 2.91Å
42	Q	98.1	Very high	97.7	Very high	130 Å²	130	103.1 Å²	103.1	61%	0.607	52%	0.518	S	S	*	.	H	α-helix	trans	-64.9	-42.6	178.1	-175.2	173.6	-12.2	0	0	111.4	K38 E39 E40 L45 S46	K38-Q42 WeakPolarHBondContact O-CB 3.32Å; K38-Q42 PolarHBondContact O-N 3.32Å; E39-Q42 PolarHBondContact O-N 2.92Å; E40-Q42 VanDerWaalsContact C-N 3.33Å; E40-Q42 PolarHBondContact O-N 3.43Å; Q42-L45 PolarHBondContact O-N 3.06Å; Q42-S46 PolarHBondContact O-N 3.36Å; Q42-S46 PolarHBondContact O-OG 2.93Å
43	K	98.1	Very high	97.8	Very high	129 Å²	129	102.8 Å²	102.8	56%	0.561	52%	0.517	S	S	*	.	H	α-helix	trans	-60.5	-52.1	174.2	179.3	180	169.6	-175.5	0	111.2	E39 E40 L45 S46 E47	E39-K43 WeakPolarHBondContact O-CB 3.3Å; E39-K43 PolarHBondContact O-N 2.68Å; E40-K43 PolarHBondContact O-N 2.93Å; K43-L45 VanDerWaalsContact C-N 3.26Å; K43-L45 PolarHBondContact O-N 3.08Å; K43-S46 PolarHBondContact O-N 3.49Å; K43-S46 VanDerWaalsContact O-N 3.12Å; K43-S46 PolarHBondContact O-OG 3.14Å; K43-E47 WeakPolarHBondContact CE-OE1 3.3Å; K43-E47 IonicContact NZ-OE1 3.87Å; K43-E47 WeakPolarHBondContact O-CG 3.43Å; K43-E47 PolarHBondContact O-N 2.86Å
44	N	98.2	Very high	97.9	Very high	66 Å²	66	101.7 Å²	101.7	35%	0.353	51%	0.508	S	S	.	.	H	α-helix	trans	-56.6	-41.9	177.7	-79.2	-43.6	0	0	0	111.7	E40 L41 E47 K48	E40-N44 WeakPolarHBondContact O-CB 3.35Å; E40-N44 PolarHBondContact O-N 3.08Å; E40-N44 PolarHBondContact O-ND2 3.34Å; E40-N44 VanDerWaalsContact O-ND2 3.12Å; L41-N44 PolarHBondContact O-N 3.33Å; N44-E47 PolarHBondContact O-N 3.1Å; N44-K48 VanDerWaalsContact O-CG 3.26Å; N44-K48 WeakPolarHBondContact O-CG 3.22Å; N44-K48 PolarHBondContact O-N 3.42Å
45	L	98.2	Very high	98	Very high	100 Å²	100	99.7 Å²	99.7	52%	0.524	50%	0.498	S	S	.	.	H	α-helix	trans	-61.9	-45.3	177.8	-172.7	150.4	0	0	0	111.4	L41 Q42 K43 K48 Q49	L41-L45 VanDerWaalsContact O-CB 3.26Å; L41-L45 WeakPolarHBondContact O-CB 3.36Å; L41-L45 PolarHBondContact O-N 2.91Å; Q42-L45 PolarHBondContact O-N 3.06Å; K43-L45 VanDerWaalsContact C-N 3.26Å; K43-L45 PolarHBondContact O-N 3.08Å; L45-K48 PolarHBondContact O-N 2.98Å; L45-Q49 HydrophobicContact CD2-CG 4.17Å; L45-Q49 WeakPolarHBondContact O-CG 3.37Å; L45-Q49 PolarHBondContact O-N 3.28Å
46	S	98	Very high	98	Very high	60 Å²	60	101.6 Å²	101.6	42%	0.42	50%	0.501	S	S	.	.	H	α-helix	trans	-63.6	-41.5	176.7	60.6	0	0	0	0	113	Q42 K43 K48 Q49 Q50	Q42-S46 PolarHBondContact O-N 3.36Å; Q42-S46 PolarHBondContact O-OG 2.93Å; K43-S46 PolarHBondContact O-N 3.49Å; K43-S46 VanDerWaalsContact O-N 3.12Å; K43-S46 PolarHBondContact O-OG 3.14Å; S46-K48 VanDerWaalsContact C-N 3.35Å; S46-K48 PolarHBondContact O-N 3.37Å; S46-Q49 PolarHBondContact O-N 2.87Å; S46-Q50 PolarHBondContact O-N 3.12Å
47	E	98.2	Very high	98.1	Very high	89 Å²	89	104 Å²	104	42%	0.416	51%	0.506	S	S	.	.	H	α-helix	trans	-64.2	-40.2	177.1	-71.1	177.1	-177.7	0	0	111.7	K43 N44 R51	K43-E47 WeakPolarHBondContact CE-OE1 3.3Å; K43-E47 IonicContact NZ-OE1 3.87Å; K43-E47 WeakPolarHBondContact O-CG 3.43Å; K43-E47 PolarHBondContact O-N 2.86Å; N44-E47 PolarHBondContact O-N 3.1Å; E47-R51 WeakPolarHBondContact O-CB 3.46Å; E47-R51 PolarHBondContact O-N 3.42Å
48	K	97.9	Very high	98.1	Very high	145 Å²	145	106.2 Å²	106.2	63%	0.63	51%	0.509	S	S	*	.	H	α-helix	trans	-68.4	-39.1	176.1	-65.5	-57.3	177.5	-168.3	0	112.1	N44 L45 S46 R51 V52	N44-K48 VanDerWaalsContact O-CG 3.26Å; N44-K48 WeakPolarHBondContact O-CG 3.22Å; N44-K48 PolarHBondContact O-N 3.42Å; L45-K48 PolarHBondContact O-N 2.98Å; S46-K48 VanDerWaalsContact C-N 3.35Å; S46-K48 PolarHBondContact O-N 3.37Å; K48-R51 PolarHBondContact O-N 3.31Å; K48-V52 WeakPolarHBondContact O-CG2 3.38Å; K48-V52 PolarHBondContact O-N 2.88Å
49	Q	98.3	Very high	98.2	Very high	110 Å²	110	104.1 Å²	104.1	51%	0.514	50%	0.504	S	S	.	.	H	α-helix	trans	-60.8	-49.9	175.2	-77.5	176.2	-29.6	0	0	111.3	L45 S46 R51 V52 E53	L45-Q49 HydrophobicContact CD2-CG 4.17Å; L45-Q49 WeakPolarHBondContact O-CG 3.37Å; L45-Q49 PolarHBondContact O-N 3.28Å; S46-Q49 PolarHBondContact O-N 2.87Å; Q49-R51 VanDerWaalsContact C-N 3.26Å; Q49-R51 PolarHBondContact O-N 3.38Å; Q49-V52 WeakPolarHBondContact O-CB 3.47Å; Q49-V52 PolarHBondContact O-N 2.92Å; Q49-E53 PolarHBondContact O-N 3.32Å
50	Q	98.3	Very high	98.2	Very high	109 Å²	109	102.2 Å²	102.2	51%	0.509	50%	0.498	S	S	.	.	H	α-helix	trans	-57.4	-42.2	175.6	-175.8	-175.2	-21.3	0	0	111.4	S46 V52 E53 E54	S46-Q50 PolarHBondContact O-N 3.12Å; Q50-V52 VanDerWaalsContact C-N 3.29Å; Q50-V52 PolarHBondContact O-N 3.46Å; Q50-E53 PolarHBondContact O-N 3.3Å; Q50-E54 PolarHBondContact NE2-OE1 3.48Å; Q50-E54 WeakPolarHBondContact O-CG 3.34Å; Q50-E54 PolarHBondContact O-N 3.38Å
51	R	98.2	Very high	98.2	Very high	116 Å²	116	100.8 Å²	100.8	44%	0.438	49%	0.492	S	S	.	.	H	α-helix	trans	-64.4	-34.7	178.3	-175.5	56.3	-179.7	167.4	5.8	112.9	E47 K48 Q49 E54 L55	E47-R51 WeakPolarHBondContact O-CB 3.46Å; E47-R51 PolarHBondContact O-N 3.42Å; K48-R51 PolarHBondContact O-N 3.31Å; Q49-R51 VanDerWaalsContact C-N 3.26Å; Q49-R51 PolarHBondContact O-N 3.38Å; R51-E54 IonicContact CZ-OE2 3.36Å; R51-E54 IonicContact NH1-OE2 2.89Å; R51-E54 PolarHBondContact NH1-OE2 2.9Å; R51-L55 HydrophobicContact CG-CD1 4.27Å; R51-L55 VanDerWaalsContact O-CG 3.27Å; R51-L55 WeakPolarHBondContact O-CG 3.46Å; R51-L55 PolarHBondContact O-N 3.28Å; R51-L55 VanDerWaalsContact O-N 3.15Å
52	V	98.4	Very high	98.2	Very high	75 Å²	75	100 Å²	100	46%	0.455	49%	0.487	S	S	.	.	H	α-helix	trans	-66	-46.9	174.7	168.9	0	0	0	0	110	K48 Q49 Q50 E54 L55 E56	K48-V52 WeakPolarHBondContact O-CG2 3.38Å; K48-V52 PolarHBondContact O-N 2.88Å; Q49-V52 WeakPolarHBondContact O-CB 3.47Å; Q49-V52 PolarHBondContact O-N 2.92Å; Q50-V52 VanDerWaalsContact C-N 3.29Å; Q50-V52 PolarHBondContact O-N 3.46Å; V52-E54 VanDerWaalsContact C-N 3.32Å; V52-E54 PolarHBondContact O-N 3.07Å; V52-L55 PolarHBondContact O-N 2.95Å; V52-L55 VanDerWaalsContact O-N 3.09Å; V52-E56 HydrophobicContact CG1-CG 4.3Å; V52-E56 WeakPolarHBondContact O-CG 3.38Å; V52-E56 PolarHBondContact O-N 3.04Å
53	E	98.2	Very high	98.2	Very high	128 Å²	128	99.6 Å²	99.6	60%	0.598	49%	0.485	S	S	*	.	H	α-helix	trans	-58.4	-42.5	177.5	-67.9	172.5	-171.9	0	0	112	Q49 Q50 L55 E56 L57	Q49-E53 PolarHBondContact O-N 3.32Å; Q50-E53 PolarHBondContact O-N 3.3Å; E53-L55 VanDerWaalsContact C-N 3.35Å; E53-L55 PolarHBondContact O-N 3.06Å; E53-E56 PolarHBondContact O-N 2.94Å; E53-L57 PolarHBondContact O-N 2.92Å
54	E	98.3	Very high	98.2	Very high	74 Å²	74	100.3 Å²	100.3	35%	0.346	49%	0.489	S	S	.	.	H	α-helix	trans	-61	-41.7	174.8	-73.2	172	-171.3	0	0	112.6	Q50 R51 V52 L57 Q58	Q50-E54 PolarHBondContact NE2-OE1 3.48Å; Q50-E54 WeakPolarHBondContact O-CG 3.34Å; Q50-E54 PolarHBondContact O-N 3.38Å; R51-E54 IonicContact CZ-OE2 3.36Å; R51-E54 IonicContact NH1-OE2 2.89Å; R51-E54 PolarHBondContact NH1-OE2 2.9Å; V52-E54 VanDerWaalsContact C-N 3.32Å; V52-E54 PolarHBondContact O-N 3.07Å; E54-L57 PolarHBondContact O-N 3.33Å; E54-Q58 WeakPolarHBondContact O-CG 3.45Å; E54-Q58 PolarHBondContact O-N 3.39Å; E54-Q58 VanDerWaalsContact O-N 3.12Å
55	L	98.4	Very high	98.2	Very high	73 Å²	73	101.9 Å²	101.9	38%	0.382	49%	0.494	S	S	.	.	H	α-helix	trans	-71.6	-35.9	-179.9	-74	170.7	0	0	0	112.1	R51 V52 E53 Q58 L59	R51-L55 HydrophobicContact CG-CD1 4.27Å; R51-L55 VanDerWaalsContact O-CG 3.27Å; R51-L55 WeakPolarHBondContact O-CG 3.46Å; R51-L55 PolarHBondContact O-N 3.28Å; R51-L55 VanDerWaalsContact O-N 3.15Å; V52-L55 PolarHBondContact O-N 2.95Å; V52-L55 VanDerWaalsContact O-N 3.09Å; E53-L55 VanDerWaalsContact C-N 3.35Å; E53-L55 PolarHBondContact O-N 3.06Å; L55-Q58 PolarHBondContact O-N 2.86Å; L55-L59 WeakPolarHBondContact O-CB 3.49Å; L55-L59 PolarHBondContact O-N 3.37Å
56	E	98.2	Very high	98.2	Very high	115 Å²	115	101.2 Å²	101.2	54%	0.537	49%	0.491	S	S	.	.	H	α-helix	trans	-62.3	-44.2	173.8	-73.3	176.2	166.1	0	0	110.7	V52 E53 Q58 L59 D60	V52-E56 HydrophobicContact CG1-CG 4.3Å; V52-E56 WeakPolarHBondContact O-CG 3.38Å; V52-E56 PolarHBondContact O-N 3.04Å; E53-E56 PolarHBondContact O-N 2.94Å; E56-Q58 PolarHBondContact O-N 2.94Å; E56-L59 WeakPolarHBondContact O-CB 3.33Å; E56-L59 PolarHBondContact O-N 3.31Å; E56-D60 PolarHBondContact O-N 3.4Å
57	L	98.2	Very high	98.2	Very high	104 Å²	104	103 Å²	103	55%	0.545	50%	0.499	S	S	.	.	H	α-helix	trans	-59.2	-46.5	174.5	-168.9	91.3	0	0	0	112	E53 E54 L59 D60 E61	E53-L57 PolarHBondContact O-N 2.92Å; E54-L57 PolarHBondContact O-N 3.33Å; L57-L59 VanDerWaalsContact C-N 3.31Å; L57-L59 PolarHBondContact O-N 3.16Å; L57-D60 PolarHBondContact O-N 3.13Å; L57-E61 WeakPolarHBondContact O-CG 3.44Å; L57-E61 PolarHBondContact O-N 2.92Å
58	Q	98.3	Very high	98.2	Very high	92 Å²	92	104.5 Å²	104.5	43%	0.43	51%	0.506	S	S	.	.	H	α-helix	trans	-62.8	-38.1	177.9	-73.1	179.6	-3	0	0	112.2	E54 L55 E56 E61 L62	E54-Q58 WeakPolarHBondContact O-CG 3.45Å; E54-Q58 PolarHBondContact O-N 3.39Å; E54-Q58 VanDerWaalsContact O-N 3.12Å; L55-Q58 PolarHBondContact O-N 2.86Å; E56-Q58 PolarHBondContact O-N 2.94Å; Q58-E61 PolarHBondContact O-N 3.16Å; Q58-L62 WeakPolarHBondContact O-CB 3.46Å; Q58-L62 VanDerWaalsContact O-CG 3.28Å; Q58-L62 WeakPolarHBondContact O-CG 3.32Å; Q58-L62 PolarHBondContact O-N 3.24Å
59	L	98.2	Very high	98.2	Very high	100 Å²	100	103.8 Å²	103.8	52%	0.524	50%	0.503	S	S	.	.	H	α-helix	trans	-62.9	-43.1	174.8	-88	170.7	0	0	0	111.5	L55 E56 L57 E61 L62 Q63	L55-L59 WeakPolarHBondContact O-CB 3.49Å; L55-L59 PolarHBondContact O-N 3.37Å; E56-L59 WeakPolarHBondContact O-CB 3.33Å; E56-L59 PolarHBondContact O-N 3.31Å; L57-L59 VanDerWaalsContact C-N 3.31Å; L57-L59 PolarHBondContact O-N 3.16Å; L59-E61 VanDerWaalsContact C-N 3.35Å; L59-E61 PolarHBondContact O-N 3.28Å; L59-L62 PolarHBondContact O-N 2.99Å; L59-Q63 WeakPolarHBondContact O-CB 3.46Å; L59-Q63 VanDerWaalsContact O-CG 3.28Å; L59-Q63 WeakPolarHBondContact O-CG 3.25Å; L59-Q63 PolarHBondContact O-N 2.95Å
60	D	98.2	Very high	98.2	Very high	84 Å²	84	103.4 Å²	103.4	45%	0.449	50%	0.501	S	S	.	.	H	α-helix	trans	-63.4	-40.5	177.8	-75.4	-10.5	0	0	0	112.1	E56 L57 Q63 K64	E56-D60 PolarHBondContact O-N 3.4Å; L57-D60 PolarHBondContact O-N 3.13Å; D60-Q63 PolarHBondContact O-N 3.36Å; D60-K64 WeakPolarHBondContact O-CG 3.46Å; D60-K64 PolarHBondContact O-N 3.48Å; D60-K64 VanDerWaalsContact O-N 3.12Å
61	E	98.1	Very high	98.1	Very high	100 Å²	100	104.1 Å²	104.1	47%	0.467	50%	0.503	S	S	.	.	H	α-helix	trans	-62.7	-49.7	174.2	-71.8	177.3	172.8	0	0	111.5	L57 Q58 L59 Q63 K64 E65	L57-E61 WeakPolarHBondContact O-CG 3.44Å; L57-E61 PolarHBondContact O-N 2.92Å; Q58-E61 PolarHBondContact O-N 3.16Å; L59-E61 VanDerWaalsContact C-N 3.35Å; L59-E61 PolarHBondContact O-N 3.28Å; E61-Q63 VanDerWaalsContact C-N 3.29Å; E61-Q63 PolarHBondContact O-N 3.05Å; E61-K64 WeakPolarHBondContact O-CB 3.33Å; E61-K64 PolarHBondContact O-N 3.05Å; E61-K64 VanDerWaalsContact O-N 3.1Å; E61-E65 PolarHBondContact O-N 3.25Å
62	L	98.3	Very high	98	Very high	101 Å²	101	102 Å²	102	53%	0.529	50%	0.5	S	S	.	.	H	α-helix	trans	-61.4	-36.2	177.9	-74	171.5	0	0	0	112.5	Q58 L59 E65 N66	Q58-L62 WeakPolarHBondContact O-CB 3.46Å; Q58-L62 VanDerWaalsContact O-CG 3.28Å; Q58-L62 WeakPolarHBondContact O-CG 3.32Å; Q58-L62 PolarHBondContact O-N 3.24Å; L59-L62 PolarHBondContact O-N 2.99Å; L62-E65 PolarHBondContact O-N 2.94Å; L62-N66 VanDerWaalsContact O-CB 3.29Å; L62-N66 WeakPolarHBondContact O-CB 3.49Å; L62-N66 PolarHBondContact O-N 3Å
63	Q	98.3	Very high	97.9	Very high	121 Å²	121	104.4 Å²	104.4	57%	0.565	51%	0.51	S	S	*	.	H	α-helix	trans	-64.5	-42	174.7	-77.7	179	11.7	0	0	111.7	L59 D60 E61 N66 V67	L59-Q63 WeakPolarHBondContact O-CB 3.46Å; L59-Q63 VanDerWaalsContact O-CG 3.28Å; L59-Q63 WeakPolarHBondContact O-CG 3.25Å; L59-Q63 PolarHBondContact O-N 2.95Å; D60-Q63 PolarHBondContact O-N 3.36Å; E61-Q63 VanDerWaalsContact C-N 3.29Å; E61-Q63 PolarHBondContact O-N 3.05Å; Q63-N66 PolarHBondContact O-N 3.42Å; Q63-V67 WeakPolarHBondContact O-CG2 3.34Å; Q63-V67 PolarHBondContact O-N 3.44Å; Q63-V67 VanDerWaalsContact O-N 3.07Å
64	K	98.1	Very high	97.7	Very high	145 Å²	145	104.1 Å²	104.1	63%	0.63	51%	0.508	S	S	*	.	H	α-helix	trans	-62.7	-47.3	175.5	-70.1	167.3	-171.7	167	0	111.4	D60 E61 N66 V67 E68	D60-K64 WeakPolarHBondContact O-CG 3.46Å; D60-K64 PolarHBondContact O-N 3.48Å; D60-K64 VanDerWaalsContact O-N 3.12Å; E61-K64 WeakPolarHBondContact O-CB 3.33Å; E61-K64 PolarHBondContact O-N 3.05Å; E61-K64 VanDerWaalsContact O-N 3.1Å; K64-N66 VanDerWaalsContact C-N 3.32Å; K64-N66 PolarHBondContact O-N 2.97Å; K64-V67 PolarHBondContact O-N 3.25Å; K64-E68 PolarHBondContact O-N 3.39Å
65	E	98.1	Very high	97.5	Very high	98 Å²	98	103.6 Å²	103.6	46%	0.458	51%	0.508	S	S	.	.	H	α-helix	trans	-60	-41.6	176.7	-71.6	-175.4	178	0	0	111.8	E61 L62 V67 E68 F69	E61-E65 PolarHBondContact O-N 3.25Å; L62-E65 PolarHBondContact O-N 2.94Å; E65-V67 PolarHBondContact O-N 2.89Å; E65-E68 PolarHBondContact O-N 2.88Å; E65-F69 HydrophobicContact CB-CD2 4.41Å; E65-F69 HydrophobicContact CB-CE2 4.23Å; E65-F69 WeakPolarHBondContact O-CD2 3.29Å; E65-F69 WeakPolarHBondContact O-CG 3.26Å; E65-F69 PolarHBondContact O-N 2.95Å
66	N	98.1	Very high	97.1	Very high	87 Å²	87	103.4 Å²	103.4	47%	0.465	51%	0.512	S	S	.	.	H	α-helix	trans	-61.5	-44.7	177.6	-168.3	-28.8	0	0	0	111.6	L62 Q63 K64 E68 F69 Q70	L62-N66 VanDerWaalsContact O-CB 3.29Å; L62-N66 WeakPolarHBondContact O-CB 3.49Å; L62-N66 PolarHBondContact O-N 3Å; Q63-N66 PolarHBondContact O-N 3.42Å; K64-N66 VanDerWaalsContact C-N 3.32Å; K64-N66 PolarHBondContact O-N 2.97Å; N66-E68 VanDerWaalsContact C-N 3.31Å; N66-E68 PolarHBondContact O-N 3.46Å; N66-F69 PolarHBondContact O-N 2.93Å; N66-Q70 VanDerWaalsContact O-CG 3.3Å; N66-Q70 WeakPolarHBondContact O-CG 3.42Å; N66-Q70 PolarHBondContact O-N 3.31Å; N66-Q70 PolarHBondContact OD1-NE2 3.39Å
67	V	98.2	Very high	96.6	Very high	98 Å²	98	103.2 Å²	103.2	59%	0.594	51%	0.511	S	S	*	.	H	α-helix	trans	-60.4	-42.3	174.6	171.9	0	0	0	0	111.1	Q63 K64 E65 Q70 K71	Q63-V67 WeakPolarHBondContact O-CG2 3.34Å; Q63-V67 PolarHBondContact O-N 3.44Å; Q63-V67 VanDerWaalsContact O-N 3.07Å; K64-V67 PolarHBondContact O-N 3.25Å; E65-V67 PolarHBondContact O-N 2.89Å; V67-Q70 PolarHBondContact O-N 2.94Å; V67-K71 PolarHBondContact O-N 2.99Å
68	E	98.1	Very high	96.2	Very high	120 Å²	120	106.6 Å²	106.6	56%	0.561	52%	0.516	S	S	*	.	H	α-helix	trans	-63.9	-45.2	176.7	-173.2	172.9	-177.7	0	0	112.1	K64 E65 N66 Q70 K71 N72	K64-E68 PolarHBondContact O-N 3.39Å; E65-E68 PolarHBondContact O-N 2.88Å; N66-E68 VanDerWaalsContact C-N 3.31Å; N66-E68 PolarHBondContact O-N 3.46Å; E68-Q70 VanDerWaalsContact C-N 3.35Å; E68-Q70 PolarHBondContact O-N 2.69Å; E68-K71 WeakPolarHBondContact O-CB 3.49Å; E68-K71 PolarHBondContact O-N 3.12Å; E68-N72 WeakPolarHBondContact O-CB 3.35Å; E68-N72 VanDerWaalsContact O-CG 3.26Å; E68-N72 PolarHBondContact O-N 3.38Å; E68-N72 PolarHBondContact O-ND2 3.23Å
69	F	97.7	Very high	95.7	Very high	129 Å²	129	107.8 Å²	107.8	57%	0.566	53%	0.525	S	S	*	.	H	α-helix	trans	-61.1	-42	175.7	-76.5	-52.4	0	0	0	112.4	E65 N66 K71 N72 L73	E65-F69 HydrophobicContact CB-CD2 4.41Å; E65-F69 HydrophobicContact CB-CE2 4.23Å; E65-F69 WeakPolarHBondContact O-CD2 3.29Å; E65-F69 WeakPolarHBondContact O-CG 3.26Å; E65-F69 PolarHBondContact O-N 2.95Å; N66-F69 PolarHBondContact O-N 2.93Å; F69-K71 VanDerWaalsContact C-N 3.33Å; F69-K71 PolarHBondContact O-N 3.47Å; F69-N72 PolarHBondContact O-N 2.88Å; F69-L73 WeakPolarHBondContact O-CB 3.47Å; F69-L73 WeakPolarHBondContact O-CG 3.36Å; F69-L73 PolarHBondContact O-N 3.49Å
70	Q	97.6	Very high	95.1	Very high	102 Å²	102	105.7 Å²	105.7	48%	0.477	51%	0.514	S	S	.	.	H	α-helix	trans	-61.5	-42.9	176	-73.6	177.7	16	0	0	111.7	N66 V67 E68 L73 Q74	N66-Q70 VanDerWaalsContact O-CG 3.3Å; N66-Q70 WeakPolarHBondContact O-CG 3.42Å; N66-Q70 PolarHBondContact O-N 3.31Å; N66-Q70 PolarHBondContact OD1-NE2 3.39Å; V67-Q70 PolarHBondContact O-N 2.94Å; E68-Q70 VanDerWaalsContact C-N 3.35Å; E68-Q70 PolarHBondContact O-N 2.69Å; Q70-L73 PolarHBondContact O-N 2.89Å; Q70-Q74 WeakPolarHBondContact O-CG 3.27Å; Q70-Q74 PolarHBondContact O-N 3.39Å
71	K	97.6	Very high	94.3	Very high	125 Å²	125	105.7 Å²	105.7	54%	0.543	52%	0.517	S	S	.	.	H	α-helix	trans	-61.4	-48.5	175.2	-176.1	-174	173	-169.5	0	111.1	V67 E68 F69 L73 Q74 D75	V67-K71 PolarHBondContact O-N 2.99Å; E68-K71 WeakPolarHBondContact O-CB 3.49Å; E68-K71 PolarHBondContact O-N 3.12Å; F69-K71 VanDerWaalsContact C-N 3.33Å; F69-K71 PolarHBondContact O-N 3.47Å; K71-L73 VanDerWaalsContact C-N 3.29Å; K71-L73 PolarHBondContact O-N 2.99Å; K71-Q74 WeakPolarHBondContact O-CB 3.48Å; K71-Q74 PolarHBondContact O-N 2.89Å; K71-Q74 VanDerWaalsContact O-N 3.12Å; K71-D75 PolarHBondContact O-N 2.86Å
72	N	96.4	Very high	93.5	Very high	72 Å²	72	105.2 Å²	105.2	39%	0.385	52%	0.524	S	S	.	.	H	α-helix	trans	-60.2	-40.2	178.6	-69.5	-17.1	0	0	0	111.7	E68 F69 D75 C76	E68-N72 WeakPolarHBondContact O-CB 3.35Å; E68-N72 VanDerWaalsContact O-CG 3.26Å; E68-N72 PolarHBondContact O-N 3.38Å; E68-N72 PolarHBondContact O-ND2 3.23Å; F69-N72 PolarHBondContact O-N 2.88Å; N72-D75 PolarHBondContact O-N 3.32Å; N72-C76 WeakPolarHBondContact O-CB 3.47Å; N72-C76 PolarHBondContact O-N 2.93Å; N72-C76 PolarHBondContact O-SG 3.22Å
73	L	94.8	Very high	92.7	Very high	124 Å²	124	103 Å²	103	65%	0.649	52%	0.521	S	S	*	.	H	α-helix	trans	-63.2	-42.8	174.5	-76.9	170.5	0	0	0	112.3	F69 Q70 K71 C76 H77	F69-L73 WeakPolarHBondContact O-CB 3.47Å; F69-L73 WeakPolarHBondContact O-CG 3.36Å; F69-L73 PolarHBondContact O-N 3.49Å; Q70-L73 PolarHBondContact O-N 2.89Å; K71-L73 VanDerWaalsContact C-N 3.29Å; K71-L73 PolarHBondContact O-N 2.99Å; L73-C76 PolarHBondContact O-N 3.38Å; L73-H77 WeakPolarHBondContact O-CB 3.43Å; L73-H77 PolarHBondContact O-N 3.36Å
74	Q	94.4	Very high	91.8	Very high	123 Å²	123	106.6 Å²	106.6	58%	0.575	54%	0.535	S	S	*	.	H	α-helix	trans	-64.1	-41.5	175.9	-73.2	178.4	2.8	0	0	112	Q70 K71 H77 R78	Q70-Q74 WeakPolarHBondContact O-CG 3.27Å; Q70-Q74 PolarHBondContact O-N 3.39Å; K71-Q74 WeakPolarHBondContact O-CB 3.48Å; K71-Q74 PolarHBondContact O-N 2.89Å; K71-Q74 VanDerWaalsContact O-N 3.12Å; Q74-H77 PolarHBondContact O-N 2.9Å; Q74-R78 WeakPolarHBondContact O-CB 3.3Å; Q74-R78 PolarHBondContact O-N 3.42Å
75	D	94.4	Very high	90.4	Very high	63 Å²	63	102.8 Å²	102.8	34%	0.337	52%	0.521	S	S	.	.	H	α-helix	trans	-65.3	-45.7	177.7	-73	-20	0	0	0	110.9	K71 N72 H77 R78 L79	K71-D75 PolarHBondContact O-N 2.86Å; N72-D75 PolarHBondContact O-N 3.32Å; D75-H77 PolarHBondContact O-N 3.32Å; D75-R78 WeakPolarHBondContact O-CB 3.48Å; D75-R78 PolarHBondContact O-N 3.44Å; D75-L79 WeakPolarHBondContact O-CG 3.43Å; D75-L79 PolarHBondContact O-N 3.44Å
76	C	89.9	Confident	88.9	Confident	69 Å²	69	100.3 Å²	100.3	47%	0.466	51%	0.51	S	S	.	.	H	α-helix	trans	-58.1	-47.2	172.6	-75.4	0	0	0	0	111.8	N72 L73 R78 L79 L80	N72-C76 WeakPolarHBondContact O-CB 3.47Å; N72-C76 PolarHBondContact O-N 2.93Å; N72-C76 PolarHBondContact O-SG 3.22Å; L73-C76 PolarHBondContact O-N 3.38Å; C76-R78 VanDerWaalsContact C-N 3.31Å; C76-R78 PolarHBondContact O-N 3.29Å; C76-L79 PolarHBondContact O-N 2.87Å; C76-L80 VanDerWaalsContact O-CG 3.27Å; C76-L80 WeakPolarHBondContact O-CG 3.33Å; C76-L80 PolarHBondContact O-N 3.42Å
77	H	87.7	Confident	87.3	Confident	111 Å²	111	100 Å²	100	51%	0.514	51%	0.513	S	S	.	.	H	α-helix	trans	-58	-44.6	177.3	179.6	70.3	0	0	0	111.6	L73 Q74 D75 L79 L80 V81	L73-H77 WeakPolarHBondContact O-CB 3.43Å; L73-H77 PolarHBondContact O-N 3.36Å; Q74-H77 PolarHBondContact O-N 2.9Å; D75-H77 PolarHBondContact O-N 3.32Å; H77-L79 PolarHBondContact O-N 3.04Å; H77-L80 PolarHBondContact O-N 3.23Å; H77-V81 WeakPolarHBondContact O-CG2 3.38Å; H77-V81 PolarHBondContact O-N 3.47Å
78	R	89.3	Confident	85.7	Confident	174 Å²	174	101.4 Å²	101.4	66%	0.657	52%	0.522	S	S	*	.	H	α-helix	trans	-60.1	-44.8	176.9	-169.8	-171.1	-56.2	-121.5	0.1	111.9	Q74 D75 C76 S82	Q74-R78 WeakPolarHBondContact O-CB 3.3Å; Q74-R78 PolarHBondContact O-N 3.42Å; D75-R78 WeakPolarHBondContact O-CB 3.48Å; D75-R78 PolarHBondContact O-N 3.44Å; C76-R78 VanDerWaalsContact C-N 3.31Å; C76-R78 PolarHBondContact O-N 3.29Å; R78-S82 VanDerWaalsContact O-CB 3.29Å; R78-S82 WeakPolarHBondContact O-CB 3.28Å; R78-S82 PolarHBondContact O-N 3.19Å; R78-S82 PolarHBondContact O-OG 3.26Å
79	L	88.8	Confident	83.8	Confident	117 Å²	117	99.4 Å²	99.4	61%	0.613	52%	0.515	S	S	*	.	H	α-helix	trans	-61.2	-47	177	-70.9	174.3	0	0	0	111.3	D75 C76 H77 S82 A83	D75-L79 WeakPolarHBondContact O-CG 3.43Å; D75-L79 PolarHBondContact O-N 3.44Å; C76-L79 PolarHBondContact O-N 2.87Å; H77-L79 PolarHBondContact O-N 3.04Å; L79-S82 WeakPolarHBondContact CA-OG 3.44Å; L79-S82 PolarHBondContact O-N 2.92Å; L79-S82 PolarHBondContact O-OG 3.07Å; L79-A83 WeakPolarHBondContact O-CB 3.36Å; L79-A83 PolarHBondContact O-N 3.47Å
80	L	84.3	Confident	81.8	Confident	57 Å²	57	96.2 Å²	96.2	30%	0.298	52%	0.518	S	S	.	.	H	α-helix	trans	-62.1	-47.1	179.9	-66.8	169.5	0	0	0	111.8	C76 H77 S82 A83 K84 I85 P87	C76-L80 VanDerWaalsContact O-CG 3.27Å; C76-L80 WeakPolarHBondContact O-CG 3.33Å; C76-L80 PolarHBondContact O-N 3.42Å; H77-L80 PolarHBondContact O-N 3.23Å; L80-S82 VanDerWaalsContact C-N 3.34Å; L80-S82 PolarHBondContact O-N 3.49Å; L80-A83 CarbonylContact O-C 3.58Å; L80-A83 PolarHBondContact O-N 2.99Å; L80-K84 PolarHBondContact O-N 2.88Å; L80-K84 VanDerWaalsContact O-N 3.13Å; L80-I85 HydrophobicContact CD2-CB 4.04Å; L80-I85 HydrophobicContact CD2-CG2 3.7Å; L80-I85 PolarHBondContact O-N 3.39Å; L80-P87 HydrophobicContact CD1-CB 4Å
81	V	83.2	Confident	79.8	Confident	84 Å²	84	98.9 Å²	98.9	51%	0.509	53%	0.53	S	S	.	.	H	α-helix	trans	-61	-43.2	175.1	172.4	0	0	0	0	111.3	H77 A83 K84	H77-V81 WeakPolarHBondContact O-CG2 3.38Å; H77-V81 PolarHBondContact O-N 3.47Å; V81-A83 VanDerWaalsContact C-N 3.27Å; V81-A83 PolarHBondContact O-N 2.82Å; V81-K84 PolarHBondContact O-N 3.46Å
82	S	81.3	Confident	77.9	Confident	89 Å²	89	100.2 Å²	100.2	62%	0.622	53%	0.532	S	S	*	.	H	α-helix	trans	-62.4	-36.2	178.5	76.3	0	0	0	0	112.6	R78 L79 L80 K84	R78-S82 VanDerWaalsContact O-CB 3.29Å; R78-S82 WeakPolarHBondContact O-CB 3.28Å; R78-S82 PolarHBondContact O-N 3.19Å; R78-S82 PolarHBondContact O-OG 3.26Å; L79-S82 WeakPolarHBondContact CA-OG 3.44Å; L79-S82 PolarHBondContact O-N 2.92Å; L79-S82 PolarHBondContact O-OG 3.07Å; L80-S82 VanDerWaalsContact C-N 3.34Å; L80-S82 PolarHBondContact O-N 3.49Å; S82-K84 PolarHBondContact O-N 3.33Å
83	A	81.4	Confident	76	Confident	56 Å²	56	100 Å²	100	46%	0.463	53%	0.533	S	S	.	.	T	Hydrogen-bonded Turn	trans	-80.6	-0.2	176	0	0	0	0	0	113.1	L79 L80 V81 I85	L79-A83 WeakPolarHBondContact O-CB 3.36Å; L79-A83 PolarHBondContact O-N 3.47Å; L80-A83 CarbonylContact O-C 3.58Å; L80-A83 PolarHBondContact O-N 2.99Å; V81-A83 VanDerWaalsContact C-N 3.27Å; V81-A83 PolarHBondContact O-N 2.82Å; A83-I85 HydrophobicContact CB-CB 4.34Å; A83-I85 HydrophobicContact CB-CD1 3.56Å; A83-I85 HydrophobicContact CB-CG1 3.65Å; A83-I85 PolarHBondContact O-N 3.5Å; A83-I85 VanDerWaalsContact O-N 3.16Å
84	K	78.3	Confident	74.4	Confident	196 Å²	196	95.7 Å²	95.7	85%	0.852	52%	0.519	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.8	28.3	-170.6	-55.4	-178.9	-179.5	-179.6	0	112.6	L80 V81 S82	L80-K84 PolarHBondContact O-N 2.88Å; L80-K84 VanDerWaalsContact O-N 3.13Å; V81-K84 PolarHBondContact O-N 3.46Å; S82-K84 PolarHBondContact O-N 3.33Å
85	I	69.3	Low	73.2	Confident	64 Å²	64	93.8 Å²	93.8	33%	0.328	51%	0.513	S	S	.	.			trans	-86.1	119.8	176.4	-65.5	174.8	0	0	0	106.9	L80 A83 P87 V93	L80-I85 HydrophobicContact CD2-CB 4.04Å; L80-I85 HydrophobicContact CD2-CG2 3.7Å; L80-I85 PolarHBondContact O-N 3.39Å; A83-I85 HydrophobicContact CB-CB 4.34Å; A83-I85 HydrophobicContact CB-CD1 3.56Å; A83-I85 HydrophobicContact CB-CG1 3.65Å; A83-I85 PolarHBondContact O-N 3.5Å; A83-I85 VanDerWaalsContact O-N 3.16Å; I85-P87 VanDerWaalsContact O-CD 3.26Å; I85-P87 WeakPolarHBondContact O-CD 3.13Å; I85-V93 HydrophobicContact CG2-CG2 3.77Å
86	D	66.4	Low	72	Confident	46 Å²	46	93.5 Å²	93.5	25%	0.246	52%	0.519	C	S	.	.			trans	-77.5	113.1	175	-171	-24.4	0	0	0	109.4	V88 L89 R92	D86-V88 PolarHBondContact O-N 3.12Å; D86-V88 WeakPolarHBondContact OD1-CB 3.29Å; D86-V88 PolarHBondContact OD1-N 3.03Å; D86-L89 HydrophobicContact CB-CB 4.36Å; D86-L89 PolarHBondContact OD1-N 3.44Å; D86-L89 WeakPolarHBondContact OD2-CD1 3.5Å; D86-R92 IonicContact OD2-NH1 2.86Å
87	P	63.9	Low	71.2	Confident	80 Å²	80	93.1 Å²	93.1	52%	0.519	52%	0.521	S	S	.	.	S	Bend	trans	-67.5	-17.9	-179.6	24	-30.4	0	0	0	113.8	L80 I85	L80-P87 HydrophobicContact CD1-CB 4Å; I85-P87 VanDerWaalsContact O-CD 3.26Å; I85-P87 WeakPolarHBondContact O-CD 3.13Å
88	V	64.6	Low	70.8	Confident	128 Å²	128	95.9 Å²	95.9	78%	0.776	53%	0.527	S	S	*	.	S	Bend	trans	-94.2	-23.9	-174.2	-173.5	0	0	0	0	111.5	D86	D86-V88 PolarHBondContact O-N 3.12Å; D86-V88 WeakPolarHBondContact OD1-CB 3.29Å; D86-V88 PolarHBondContact OD1-N 3.03Å
89	L	57.6	Low	70.5	Confident	79 Å²	79	93.3 Å²	93.3	41%	0.414	52%	0.523	S	S	.	.			trans	-116.4	78.3	-178.4	-65.4	172.5	0	0	0	110.1	D86 E91 R92	D86-L89 HydrophobicContact CB-CB 4.36Å; D86-L89 PolarHBondContact OD1-N 3.44Å; D86-L89 WeakPolarHBondContact OD2-CD1 3.5Å; L89-E91 PolarHBondContact O-N 3.22Å; L89-R92 HydrophobicContact CB-CB 4.31Å; L89-R92 HydrophobicContact CB-CG 3.88Å; L89-R92 HydrophobicContact CD1-CG 4.21Å; L89-R92 PolarHBondContact O-N 2.99Å
90	G	56.2	Low	70.3	Confident	62 Å²	62	95.1 Å²	95.1	64%	0.639	53%	0.526	S	S	*	.	H	α-helix	trans	-53.1	-22.6	173.6	0	0	0	0	0	113.8
91	E	55.8	Low	70.5	Confident	157 Å²	157	96.3 Å²	96.3	73%	0.734	53%	0.53	S	S	*	.	H	α-helix	trans	-67	-38.4	174.6	-160.9	169	-151.1	0	0	112.8	L89 V93 G94 D95	L89-E91 PolarHBondContact O-N 3.22Å; E91-V93 PolarHBondContact O-N 3.5Å; E91-G94 PolarHBondContact O-N 3.37Å; E91-G94 VanDerWaalsContact O-N 3.16Å; E91-D95 PolarHBondContact O-N 2.96Å
92	R	57.4	Low	70.9	Confident	153 Å²	153	96.4 Å²	96.4	58%	0.577	53%	0.527	S	S	*	.	H	α-helix	trans	-69.7	-20.1	-179.7	-65.5	-173.9	76.1	-156.5	4.3	113.4	D86 L89 A96	D86-R92 IonicContact OD2-NH1 2.86Å; L89-R92 HydrophobicContact CB-CB 4.31Å; L89-R92 HydrophobicContact CB-CG 3.88Å; L89-R92 HydrophobicContact CD1-CG 4.21Å; L89-R92 PolarHBondContact O-N 2.99Å; R92-A96 PolarHBondContact O-N 3.1Å; R92-A96 VanDerWaalsContact O-N 3.14Å
93	V	56.6	Low	71.5	Confident	67 Å²	67	96.8 Å²	96.8	41%	0.406	52%	0.519	S	S	.	.	H	α-helix	trans	-69.9	-37.3	175.1	-172.7	0	0	0	0	110.8	I85 E91 A97	I85-V93 HydrophobicContact CG2-CG2 3.77Å; E91-V93 PolarHBondContact O-N 3.5Å; V93-A97 PolarHBondContact O-N 3.1Å
94	G	61.8	Low	72	Confident	35 Å²	35	101.3 Å²	101.3	36%	0.361	52%	0.524	S	S	.	.	H	α-helix	trans	-66.5	-41.3	174.2	0	0	0	0	0	112.2	E91 A97 R98	E91-G94 PolarHBondContact O-N 3.37Å; E91-G94 VanDerWaalsContact O-N 3.16Å; G94-A97 PolarHBondContact O-N 3.49Å; G94-R98 VanDerWaalsContact O-CG 3.32Å; G94-R98 WeakPolarHBondContact O-CG 3.48Å; G94-R98 PolarHBondContact O-N 2.92Å
95	D	68.1	Low	72.8	Confident	82 Å²	82	97.1 Å²	97.1	44%	0.439	51%	0.506	S	S	.	.	H	α-helix	trans	-70.7	-41.3	-176.6	-64.5	-27	0	0	0	112.9	E91 A97 R98 Q99	E91-D95 PolarHBondContact O-N 2.96Å; D95-A97 VanDerWaalsContact C-N 3.31Å; D95-A97 PolarHBondContact O-N 2.96Å; D95-R98 PolarHBondContact O-N 3.25Å; D95-Q99 WeakPolarHBondContact O-CB 3.48Å; D95-Q99 PolarHBondContact O-N 3.23Å
96	A	70.6	Confident	74.1	Confident	57 Å²	57	100.6 Å²	100.6	47%	0.471	52%	0.521	S	S	.	.	H	α-helix	trans	-64.3	-36.3	175.6	0	0	0	0	0	112.3	R92 K100	R92-A96 PolarHBondContact O-N 3.1Å; R92-A96 VanDerWaalsContact O-N 3.14Å; A96-K100 PolarHBondContact O-N 3.07Å; A96-K100 VanDerWaalsContact O-N 3.1Å
97	A	73.1	Confident	75.5	Confident	62 Å²	62	103.3 Å²	103.3	51%	0.512	54%	0.539	S	S	.	.	H	α-helix	trans	-68.3	-42.9	175.2	0	0	0	0	0	111.8	V93 G94 D95 K100 E101	V93-A97 PolarHBondContact O-N 3.1Å; G94-A97 PolarHBondContact O-N 3.49Å; D95-A97 VanDerWaalsContact C-N 3.31Å; D95-A97 PolarHBondContact O-N 2.96Å; A97-K100 PolarHBondContact O-N 3.36Å; A97-E101 PolarHBondContact O-N 3.45Å
98	R	79.3	Confident	77	Confident	168 Å²	168	105 Å²	105	63%	0.634	54%	0.541	S	S	*	.	H	α-helix	trans	-61	-48.5	174.4	-75.9	173.7	177.8	173.7	-0.7	111.5	G94 D95 K100 E101 D102	G94-R98 VanDerWaalsContact O-CG 3.32Å; G94-R98 WeakPolarHBondContact O-CG 3.48Å; G94-R98 PolarHBondContact O-N 2.92Å; D95-R98 PolarHBondContact O-N 3.25Å; R98-K100 PolarHBondContact O-N 2.89Å; R98-E101 WeakPolarHBondContact O-CB 3.49Å; R98-E101 PolarHBondContact O-N 3.09Å; R98-D102 PolarHBondContact O-N 3.38Å
99	Q	83.5	Confident	78.6	Confident	120 Å²	120	101.5 Å²	101.5	56%	0.561	52%	0.523	S	S	*	.	H	α-helix	trans	-60	-43.6	179.6	-170.4	174.3	7.5	0	0	112	D95 E101 D102 E103	D95-Q99 WeakPolarHBondContact O-CB 3.48Å; D95-Q99 PolarHBondContact O-N 3.23Å; Q99-E101 VanDerWaalsContact C-N 3.31Å; Q99-E101 PolarHBondContact O-N 3.43Å; Q99-D102 PolarHBondContact O-N 3.12Å; Q99-E103 WeakPolarHBondContact O-CB 3.39Å; Q99-E103 WeakPolarHBondContact O-CG 3.5Å; Q99-E103 PolarHBondContact O-N 3.15Å
100	K	84.1	Confident	80.5	Confident	155 Å²	155	102.2 Å²	102.2	67%	0.674	53%	0.53	S	S	*	.	H	α-helix	trans	-64	-35	174.4	-82.8	-147.7	177.1	-170	0	113.4	A96 A97 R98 R104	A96-K100 PolarHBondContact O-N 3.07Å; A96-K100 VanDerWaalsContact O-N 3.1Å; A97-K100 PolarHBondContact O-N 3.36Å; R98-K100 PolarHBondContact O-N 2.89Å; K100-R104 WeakPolarHBondContact O-CB 3.34Å; K100-R104 PolarHBondContact O-N 3.18Å
101	E	88.3	Confident	82.4	Confident	82 Å²	82	102.1 Å²	102.1	38%	0.383	52%	0.519	S	S	.	.	H	α-helix	trans	-69.2	-40	175.9	-175	174.8	158.9	0	0	111.6	A97 R98 Q99 R104 K105	A97-E101 PolarHBondContact O-N 3.45Å; R98-E101 WeakPolarHBondContact O-CB 3.49Å; R98-E101 PolarHBondContact O-N 3.09Å; Q99-E101 VanDerWaalsContact C-N 3.31Å; Q99-E101 PolarHBondContact O-N 3.43Å; E101-R104 WeakPolarHBondContact O-CB 3.44Å; E101-R104 PolarHBondContact O-N 3.41Å; E101-K105 WeakPolarHBondContact O-CG 3.28Å; E101-K105 PolarHBondContact O-N 2.94Å; E101-K105 VanDerWaalsContact OE1-CE 3.25Å; E101-K105 WeakPolarHBondContact OE1-CE 3.47Å; E101-K105 IonicContact OE1-NZ 3.66Å; E101-K105 PolarHBondContact OE1-NZ 3.26Å
102	D	91.4	Very high	84.4	Confident	86 Å²	86	97.7 Å²	97.7	46%	0.46	50%	0.504	S	S	.	.	H	α-helix	trans	-67.6	-45.1	177.4	-66.4	-24.3	0	0	0	111.4	R98 Q99 R104 K105 E106	R98-D102 PolarHBondContact O-N 3.38Å; Q99-D102 PolarHBondContact O-N 3.12Å; D102-R104 VanDerWaalsContact C-N 3.27Å; D102-R104 PolarHBondContact O-N 3.46Å; D102-K105 WeakPolarHBondContact O-CB 3.42Å; D102-K105 PolarHBondContact O-N 2.97Å; D102-K105 VanDerWaalsContact O-N 3.07Å; D102-K105 IonicContact OD1-NZ 3.93Å; D102-E106 PolarHBondContact O-N 3.03Å
103	E	93	Very high	86.3	Confident	98 Å²	98	93.8 Å²	93.8	46%	0.458	49%	0.494	S	S	.	.	H	α-helix	trans	-55.5	-42.9	170.7	-74.8	172.8	-173.8	0	0	111.3	Q99 K105 E106 V107	Q99-E103 WeakPolarHBondContact O-CB 3.39Å; Q99-E103 WeakPolarHBondContact O-CG 3.5Å; Q99-E103 PolarHBondContact O-N 3.15Å; E103-K105 VanDerWaalsContact C-N 3.33Å; E103-K105 PolarHBondContact O-N 3.29Å; E103-E106 PolarHBondContact O-N 3.39Å; E103-V107 VanDerWaalsContact O-CG2 3.3Å; E103-V107 WeakPolarHBondContact O-CG2 3.27Å; E103-V107 PolarHBondContact O-N 3.03Å
104	R	93.1	Very high	88.3	Confident	151 Å²	151	95.1 Å²	95.1	57%	0.57	50%	0.498	S	S	*	.	H	α-helix	trans	-64	-39.1	177.5	-166.5	-177.5	82.4	-121.3	3	111.8	K100 E101 D102 M108	K100-R104 WeakPolarHBondContact O-CB 3.34Å; K100-R104 PolarHBondContact O-N 3.18Å; E101-R104 WeakPolarHBondContact O-CB 3.44Å; E101-R104 PolarHBondContact O-N 3.41Å; D102-R104 VanDerWaalsContact C-N 3.27Å; D102-R104 PolarHBondContact O-N 3.46Å; R104-M108 WeakPolarHBondContact O-CB 3.36Å; R104-M108 PolarHBondContact O-N 3.31Å
105	K	95.4	Very high	90	Very high	108 Å²	108	99 Å²	99	47%	0.47	51%	0.51	S	S	.	.	H	α-helix	trans	-66.2	-44	177	-75.1	170.1	-174.6	155.8	0	111.2	E101 D102 E103 M108 S109	E101-K105 WeakPolarHBondContact O-CG 3.28Å; E101-K105 PolarHBondContact O-N 2.94Å; E101-K105 VanDerWaalsContact OE1-CE 3.25Å; E101-K105 WeakPolarHBondContact OE1-CE 3.47Å; E101-K105 IonicContact OE1-NZ 3.66Å; E101-K105 PolarHBondContact OE1-NZ 3.26Å; D102-K105 WeakPolarHBondContact O-CB 3.42Å; D102-K105 PolarHBondContact O-N 2.97Å; D102-K105 VanDerWaalsContact O-N 3.07Å; D102-K105 IonicContact OD1-NZ 3.93Å; E103-K105 VanDerWaalsContact C-N 3.33Å; E103-K105 PolarHBondContact O-N 3.29Å; K105-M108 WeakPolarHBondContact O-CB 3.38Å; K105-M108 PolarHBondContact O-N 2.99Å; K105-S109 PolarHBondContact O-N 2.96Å
106	E	96.3	Very high	91.4	Very high	136 Å²	136	103 Å²	103	64%	0.636	52%	0.519	S	S	*	.	H	α-helix	trans	-63.2	-45.8	176.6	-73.3	-166	159.5	0	0	112.1	D102 E103 M108 S109 V110	D102-E106 PolarHBondContact O-N 3.03Å; E103-E106 PolarHBondContact O-N 3.39Å; E106-M108 VanDerWaalsContact C-N 3.25Å; E106-M108 PolarHBondContact O-N 3.06Å; E106-S109 PolarHBondContact O-N 3.3Å; E106-S109 PolarHBondContact O-OG 3.12Å; E106-V110 WeakPolarHBondContact O-CG2 3.43Å; E106-V110 PolarHBondContact O-N 2.88Å
107	V	96.4	Very high	92.7	Very high	103 Å²	103	106.7 Å²	106.7	62%	0.624	53%	0.527	S	S	*	.	H	α-helix	trans	-59.4	-41.7	176	170.1	0	0	0	0	110.5	E103 S111	E103-V107 VanDerWaalsContact O-CG2 3.3Å; E103-V107 WeakPolarHBondContact O-CG2 3.27Å; E103-V107 PolarHBondContact O-N 3.03Å; V107-S111 WeakPolarHBondContact O-CB 3.26Å; V107-S111 PolarHBondContact O-N 3.02Å
108	M	95.3	Very high	93.9	Very high	115 Å²	115	108.8 Å²	108.8	57%	0.567	53%	0.529	S	S	*	.	H	α-helix	trans	-64	-45	177.3	-164.5	65.7	60.4	0	0	111.6	R104 K105 E106 S111 T112	R104-M108 WeakPolarHBondContact O-CB 3.36Å; R104-M108 PolarHBondContact O-N 3.31Å; K105-M108 WeakPolarHBondContact O-CB 3.38Å; K105-M108 PolarHBondContact O-N 2.99Å; E106-M108 VanDerWaalsContact C-N 3.25Å; E106-M108 PolarHBondContact O-N 3.06Å; M108-S111 PolarHBondContact O-N 3.45Å; M108-T112 WeakPolarHBondContact O-CG2 3.26Å; M108-T112 PolarHBondContact O-N 3.38Å; M108-T112 PolarHBondContact O-OG1 2.97Å
109	S	97.1	Very high	94.8	Very high	55 Å²	55	107.9 Å²	107.9	39%	0.385	53%	0.529	S	S	.	.	H	α-helix	trans	-63.7	-48.5	-179.6	68.7	0	0	0	0	111.3	K105 E106 S111 T112 D113	K105-S109 PolarHBondContact O-N 2.96Å; E106-S109 PolarHBondContact O-N 3.3Å; E106-S109 PolarHBondContact O-OG 3.12Å; S109-S111 VanDerWaalsContact C-N 3.29Å; S109-S111 PolarHBondContact O-N 2.89Å; S109-T112 WeakPolarHBondContact CA-OG1 3.33Å; S109-T112 PolarHBondContact O-N 2.95Å; S109-T112 VanDerWaalsContact O-N 3.08Å; S109-T112 PolarHBondContact O-OG1 3.02Å; S109-D113 PolarHBondContact O-N 3.46Å
110	V	97.3	Very high	95.4	Very high	94 Å²	94	104.3 Å²	104.3	57%	0.57	52%	0.52	S	S	*	.	H	α-helix	trans	-59.3	-42.3	177	173.9	0	0	0	0	110.7	E106 T112 D113 L114	E106-V110 WeakPolarHBondContact O-CG2 3.43Å; E106-V110 PolarHBondContact O-N 2.88Å; V110-T112 VanDerWaalsContact C-N 3.32Å; V110-T112 PolarHBondContact O-N 3.37Å; V110-D113 PolarHBondContact O-N 2.98Å; V110-L114 WeakPolarHBondContact O-CB 3.25Å; V110-L114 PolarHBondContact O-N 3.29Å
111	S	96.9	Very high	96.1	Very high	60 Å²	60	103.9 Å²	103.9	42%	0.42	52%	0.519	S	S	.	.	H	α-helix	trans	-65.6	-35.1	177.8	-160.1	0	0	0	0	112.4	V107 M108 S109 L115	V107-S111 WeakPolarHBondContact O-CB 3.26Å; V107-S111 PolarHBondContact O-N 3.02Å; M108-S111 PolarHBondContact O-N 3.45Å; S109-S111 VanDerWaalsContact C-N 3.29Å; S109-S111 PolarHBondContact O-N 2.89Å; S111-L115 WeakPolarHBondContact O-CB 3.44Å; S111-L115 PolarHBondContact O-N 3.36Å; S111-L115 VanDerWaalsContact O-N 3.12Å
112	T	97.4	Very high	96.5	Very high	65 Å²	65	101.4 Å²	101.4	40%	0.399	52%	0.515	S	S	.	.	H	α-helix	trans	-71.2	-36.5	175	56.9	0	0	0	0	113.1	M108 S109 V110 L115 R116	M108-T112 WeakPolarHBondContact O-CG2 3.26Å; M108-T112 PolarHBondContact O-N 3.38Å; M108-T112 PolarHBondContact O-OG1 2.97Å; S109-T112 WeakPolarHBondContact CA-OG1 3.33Å; S109-T112 PolarHBondContact O-N 2.95Å; S109-T112 VanDerWaalsContact O-N 3.08Å; S109-T112 PolarHBondContact O-OG1 3.02Å; V110-T112 VanDerWaalsContact C-N 3.32Å; V110-T112 PolarHBondContact O-N 3.37Å; T112-L115 PolarHBondContact O-N 3.2Å; T112-R116 PolarHBondContact O-N 2.96Å; T112-R116 VanDerWaalsContact O-N 3.08Å
113	D	97.8	Very high	96.8	Very high	71 Å²	71	102 Å²	102	38%	0.38	52%	0.518	S	S	.	.	H	α-helix	trans	-69.7	-43.7	177	-71.4	-27	0	0	0	110.8	S109 V110 L115 R116 E117	S109-D113 PolarHBondContact O-N 3.46Å; V110-D113 PolarHBondContact O-N 2.98Å; D113-L115 VanDerWaalsContact C-N 3.32Å; D113-L115 PolarHBondContact O-N 2.74Å; D113-R116 WeakPolarHBondContact O-CB 3.5Å; D113-R116 PolarHBondContact O-N 2.9Å; D113-R116 IonicContact OD1-CZ 3.67Å; D113-R116 IonicContact OD1-NH1 3.96Å; D113-R116 IonicContact OD1-NH2 3.78Å; D113-R116 PolarHBondContact OD1-NH2 3.36Å; D113-E117 PolarHBondContact O-N 3.29Å
114	L	97.7	Very high	97	Very high	95 Å²	95	101.6 Å²	101.6	50%	0.497	52%	0.518	S	S	.	.	H	α-helix	trans	-58.2	-43.7	173.7	179.5	62.4	0	0	0	111.8	V110 R116 E117 L118	V110-L114 WeakPolarHBondContact O-CB 3.25Å; V110-L114 PolarHBondContact O-N 3.29Å; L114-R116 VanDerWaalsContact C-N 3.29Å; L114-R116 PolarHBondContact O-N 2.93Å; L114-E117 PolarHBondContact O-N 3.12Å; L114-L118 HydrophobicContact CD1-CD1 4.33Å; L114-L118 HydrophobicContact CD1-CG 4.26Å; L114-L118 HydrophobicContact CG-CD1 4.1Å; L114-L118 HydrophobicContact CG-CG 4.46Å; L114-L118 WeakPolarHBondContact O-CB 3.37Å; L114-L118 VanDerWaalsContact O-CG 3.32Å; L114-L118 WeakPolarHBondContact O-CG 3.42Å; L114-L118 PolarHBondContact O-N 2.91Å
115	L	97.8	Very high	97.2	Very high	115 Å²	115	96.3 Å²	96.3	60%	0.602	51%	0.506	S	S	*	.	H	α-helix	trans	-59.8	-40.2	175.2	-97.7	162.1	0	0	0	112.2	S111 T112 D113 K119	S111-L115 WeakPolarHBondContact O-CB 3.44Å; S111-L115 PolarHBondContact O-N 3.36Å; S111-L115 VanDerWaalsContact O-N 3.12Å; T112-L115 PolarHBondContact O-N 3.2Å; D113-L115 VanDerWaalsContact C-N 3.32Å; D113-L115 PolarHBondContact O-N 2.74Å; L115-K119 WeakPolarHBondContact O-CB 2.88Å; L115-K119 PolarHBondContact O-N 2.69Å; L115-K119 VanDerWaalsContact O-N 3.1Å
116	R	97.9	Very high	97.3	Very high	167 Å²	167	94.6 Å²	94.6	63%	0.63	51%	0.508	S	S	*	.	H	α-helix	trans	-65.6	-44.9	177.5	-169.2	-173.1	-57	152.6	13.8	111.2	T112 D113 L114 K119 A120	T112-R116 PolarHBondContact O-N 2.96Å; T112-R116 VanDerWaalsContact O-N 3.08Å; D113-R116 WeakPolarHBondContact O-CB 3.5Å; D113-R116 PolarHBondContact O-N 2.9Å; D113-R116 IonicContact OD1-CZ 3.67Å; D113-R116 IonicContact OD1-NH1 3.96Å; D113-R116 IonicContact OD1-NH2 3.78Å; D113-R116 PolarHBondContact OD1-NH2 3.36Å; L114-R116 VanDerWaalsContact C-N 3.29Å; L114-R116 PolarHBondContact O-N 2.93Å; R116-K119 PolarHBondContact O-N 3.35Å; R116-A120 PolarHBondContact O-N 3.42Å
117	E	98.1	Very high	97.2	Very high	135 Å²	135	93.7 Å²	93.7	63%	0.631	50%	0.504	S	S	*	.	H	α-helix	trans	-63.8	-45.2	177.5	-74.3	-174.1	179.9	0	0	112.1	D113 L114 K119 A120 F121	D113-E117 PolarHBondContact O-N 3.29Å; L114-E117 PolarHBondContact O-N 3.12Å; E117-K119 VanDerWaalsContact C-N 3.27Å; E117-K119 PolarHBondContact O-N 2.89Å; E117-A120 PolarHBondContact O-N 3.47Å; E117-F121 WeakPolarHBondContact O-CB 3.44Å; E117-F121 PolarHBondContact O-N 3.41Å
118	L	97.9	Very high	97.2	Very high	106 Å²	106	94 Å²	94	56%	0.555	50%	0.499	S	S	*	.	H	α-helix	trans	-60.2	-39.1	177	-74.7	172.9	0	0	0	111.9	L114 G122	L114-L118 HydrophobicContact CD1-CD1 4.33Å; L114-L118 HydrophobicContact CD1-CG 4.26Å; L114-L118 HydrophobicContact CG-CD1 4.1Å; L114-L118 HydrophobicContact CG-CG 4.46Å; L114-L118 WeakPolarHBondContact O-CB 3.37Å; L114-L118 VanDerWaalsContact O-CG 3.32Å; L114-L118 WeakPolarHBondContact O-CG 3.42Å; L114-L118 PolarHBondContact O-N 2.91Å; L118-G122 PolarHBondContact O-N 3.41Å
119	K	97.7	Very high	97.2	Very high	149 Å²	149	96.5 Å²	96.5	65%	0.648	50%	0.502	S	S	*	.	H	α-helix	trans	-65.1	-49.2	175.4	-169.4	179.6	-178.7	-176.4	0	111.4	L115 R116 E117 F121 G122 D123	L115-K119 WeakPolarHBondContact O-CB 2.88Å; L115-K119 PolarHBondContact O-N 2.69Å; L115-K119 VanDerWaalsContact O-N 3.1Å; R116-K119 PolarHBondContact O-N 3.35Å; E117-K119 VanDerWaalsContact C-N 3.27Å; E117-K119 PolarHBondContact O-N 2.89Å; K119-F121 VanDerWaalsContact C-N 3.3Å; K119-F121 PolarHBondContact O-N 2.9Å; K119-G122 PolarHBondContact O-N 3.41Å; K119-G122 VanDerWaalsContact O-N 3.14Å; K119-D123 VanDerWaalsContact O-CG 3.29Å; K119-D123 PolarHBondContact O-N 2.93Å
120	A	97.6	Very high	97	Very high	45 Å²	45	98.2 Å²	98.2	37%	0.372	51%	0.51	S	S	.	.	H	α-helix	trans	-60	-41.2	177.4	0	0	0	0	0	111.9	R116 E117 D123 I124	R116-A120 PolarHBondContact O-N 3.42Å; E117-A120 PolarHBondContact O-N 3.47Å; A120-D123 PolarHBondContact O-N 3.46Å; A120-I124 WeakPolarHBondContact O-CD1 3.44Å; A120-I124 VanDerWaalsContact O-CG1 3.24Å; A120-I124 WeakPolarHBondContact O-CG1 3.29Å; A120-I124 PolarHBondContact O-N 2.98Å
121	F	97.9	Very high	96.8	Very high	146 Å²	146	99 Å²	99	64%	0.64	51%	0.507	S	S	*	.	H	α-helix	trans	-61.1	-45.5	174.3	179.4	-96.2	0	0	0	111.6	E117 K119 D123 I124 A125	E117-F121 WeakPolarHBondContact O-CB 3.44Å; E117-F121 PolarHBondContact O-N 3.41Å; K119-F121 VanDerWaalsContact C-N 3.3Å; K119-F121 PolarHBondContact O-N 2.9Å; F121-D123 VanDerWaalsContact C-N 3.34Å; F121-D123 PolarHBondContact O-N 3.47Å; F121-I124 PolarHBondContact O-N 3.18Å; F121-A125 VanDerWaalsContact O-CB 3.31Å; F121-A125 WeakPolarHBondContact O-CB 3.33Å; F121-A125 PolarHBondContact O-N 2.85Å
122	G	97.3	Very high	96.6	Very high	29 Å²	29	102 Å²	102	30%	0.299	52%	0.518	S	S	.	.	H	α-helix	trans	-60.5	-41.1	175.8	0	0	0	0	0	113.1	L118 K119 S126	L118-G122 PolarHBondContact O-N 3.41Å; K119-G122 PolarHBondContact O-N 3.41Å; K119-G122 VanDerWaalsContact O-N 3.14Å; G122-S126 VanDerWaalsContact O-CB 3.3Å; G122-S126 WeakPolarHBondContact O-CB 3.49Å; G122-S126 PolarHBondContact O-N 3.09Å; G122-S126 PolarHBondContact O-OG 3.04Å
123	D	97.4	Very high	96.3	Very high	99 Å²	99	103 Å²	103	53%	0.529	52%	0.518	S	S	.	.	H	α-helix	trans	-63.8	-46.9	176.2	-66.9	-24	0	0	0	110.8	K119 A120 F121 S126 Q127	K119-D123 VanDerWaalsContact O-CG 3.29Å; K119-D123 PolarHBondContact O-N 2.93Å; A120-D123 PolarHBondContact O-N 3.46Å; F121-D123 VanDerWaalsContact C-N 3.34Å; F121-D123 PolarHBondContact O-N 3.47Å; D123-S126 PolarHBondContact O-N 2.94Å; D123-Q127 WeakPolarHBondContact O-CB 3.23Å; D123-Q127 PolarHBondContact O-N 3.38Å
124	I	97.3	Very high	95.7	Very high	90 Å²	90	101.9 Å²	101.9	46%	0.462	52%	0.519	S	S	.	.	H	α-helix	trans	-63.2	-46.1	177.6	-67.7	164.5	0	0	0	111.1	A120 F121 S126 Q127 Q128	A120-I124 WeakPolarHBondContact O-CD1 3.44Å; A120-I124 VanDerWaalsContact O-CG1 3.24Å; A120-I124 WeakPolarHBondContact O-CG1 3.29Å; A120-I124 PolarHBondContact O-N 2.98Å; F121-I124 PolarHBondContact O-N 3.18Å; I124-S126 VanDerWaalsContact C-N 3.3Å; I124-S126 PolarHBondContact O-N 3.28Å; I124-Q127 WeakPolarHBondContact O-CB 3.36Å; I124-Q127 PolarHBondContact O-N 2.92Å; I124-Q128 HydrophobicContact CG2-CG 4.41Å; I124-Q128 WeakPolarHBondContact O-CB 3.2Å; I124-Q128 WeakPolarHBondContact O-CG 3.28Å; I124-Q128 PolarHBondContact O-N 2.91Å
125	A	96.9	Very high	95	Very high	39 Å²	39	100.3 Å²	100.3	32%	0.322	52%	0.516	S	S	.	.	H	α-helix	trans	-62.9	-38.6	178.8	0	0	0	0	0	111.6	F121 Q128 R129	F121-A125 VanDerWaalsContact O-CB 3.31Å; F121-A125 WeakPolarHBondContact O-CB 3.33Å; F121-A125 PolarHBondContact O-N 2.85Å; A125-Q128 PolarHBondContact O-N 2.93Å; A125-R129 WeakPolarHBondContact O-CB 3.4Å; A125-R129 PolarHBondContact O-N 2.93Å
126	S	96.4	Very high	94.1	Very high	72 Å²	72	101 Å²	101	50%	0.503	52%	0.516	S	S	.	.	H	α-helix	trans	-66	-42.1	175.2	-60.9	0	0	0	0	111.5	G122 D123 I124 R129 T130	G122-S126 VanDerWaalsContact O-CB 3.3Å; G122-S126 WeakPolarHBondContact O-CB 3.49Å; G122-S126 PolarHBondContact O-N 3.09Å; G122-S126 PolarHBondContact O-OG 3.04Å; D123-S126 PolarHBondContact O-N 2.94Å; I124-S126 VanDerWaalsContact C-N 3.3Å; I124-S126 PolarHBondContact O-N 3.28Å; S126-R129 PolarHBondContact O-N 3.3Å; S126-T130 PolarHBondContact O-N 3.21Å; S126-T130 PolarHBondContact O-OG1 2.73Å
127	Q	96.2	Very high	93.3	Very high	118 Å²	118	102.4 Å²	102.4	55%	0.551	52%	0.521	S	S	*	.	H	α-helix	trans	-62.2	-47.7	175.1	-174.9	177.5	-2	0	0	111.5	D123 I124 R129 T130 Q131	D123-Q127 WeakPolarHBondContact O-CB 3.23Å; D123-Q127 PolarHBondContact O-N 3.38Å; I124-Q127 WeakPolarHBondContact O-CB 3.36Å; I124-Q127 PolarHBondContact O-N 2.92Å; Q127-R129 PolarHBondContact O-N 3.42Å; Q127-T130 WeakPolarHBondContact O-CB 3.29Å; Q127-T130 PolarHBondContact O-N 3.02Å; Q127-Q131 PolarHBondContact O-N 3.34Å
128	Q	95.6	Very high	92.4	Very high	109 Å²	109	103.2 Å²	103.2	51%	0.509	53%	0.529	S	S	.	.	H	α-helix	trans	-59.8	-44	176.2	-75.5	-177.9	-15.1	0	0	111.8	I124 A125 T130 Q131 L132	I124-Q128 HydrophobicContact CG2-CG 4.41Å; I124-Q128 WeakPolarHBondContact O-CB 3.2Å; I124-Q128 WeakPolarHBondContact O-CG 3.28Å; I124-Q128 PolarHBondContact O-N 2.91Å; A125-Q128 PolarHBondContact O-N 2.93Å; Q128-T130 VanDerWaalsContact C-N 3.29Å; Q128-T130 PolarHBondContact O-N 3.48Å; Q128-Q131 PolarHBondContact O-N 2.96Å; Q128-L132 WeakPolarHBondContact O-CG 3.41Å; Q128-L132 PolarHBondContact O-N 3.19Å
129	R	94.4	Very high	91.3	Very high	168 Å²	168	105.1 Å²	105.1	63%	0.634	54%	0.539	S	S	*	.	H	α-helix	trans	-58.5	-42.8	175.4	-178.6	177.5	178.5	167.6	2.3	111.6	A125 S126 Q127 L132 Q133	A125-R129 WeakPolarHBondContact O-CB 3.4Å; A125-R129 PolarHBondContact O-N 2.93Å; S126-R129 PolarHBondContact O-N 3.3Å; Q127-R129 PolarHBondContact O-N 3.42Å; R129-L132 PolarHBondContact O-N 2.94Å; R129-Q133 WeakPolarHBondContact O-CB 3.33Å; R129-Q133 VanDerWaalsContact O-CG 3.29Å; R129-Q133 WeakPolarHBondContact O-CG 3.48Å; R129-Q133 PolarHBondContact O-N 3.41Å
130	T	94.2	Very high	89.2	Confident	90 Å²	90	101.1 Å²	101.1	55%	0.552	53%	0.53	S	S	*	.	H	α-helix	trans	-66.1	-43	179.8	-52.5	0	0	0	0	111	S126 Q127 Q128 Q133 A134	S126-T130 PolarHBondContact O-N 3.21Å; S126-T130 PolarHBondContact O-OG1 2.73Å; Q127-T130 WeakPolarHBondContact O-CB 3.29Å; Q127-T130 PolarHBondContact O-N 3.02Å; Q128-T130 VanDerWaalsContact C-N 3.29Å; Q128-T130 PolarHBondContact O-N 3.48Å; T130-Q133 PolarHBondContact O-N 3.33Å; T130-A134 WeakPolarHBondContact O-CB 3.43Å; T130-A134 PolarHBondContact O-N 3.31Å
131	Q	92.7	Very high	87.4	Confident	110 Å²	110	104.6 Å²	104.6	51%	0.514	55%	0.549	S	S	.	.	H	α-helix	trans	-60.8	-48.2	174.5	-75.3	178.5	-15.8	0	0	111.9	Q127 Q128 Q133 A134 S135	Q127-Q131 PolarHBondContact O-N 3.34Å; Q128-Q131 PolarHBondContact O-N 2.96Å; Q131-Q133 VanDerWaalsContact C-N 3.35Å; Q131-Q133 PolarHBondContact O-N 3.19Å; Q131-A134 PolarHBondContact O-N 3.21Å; Q131-S135 PolarHBondContact O-N 3.41Å; Q131-S135 PolarHBondContact O-OG 3.22Å
132	L	91.9	Very high	85.1	Confident	123 Å²	123	109.7 Å²	109.7	64%	0.644	58%	0.581	S	S	*	*	H	α-helix	trans	-61.9	-40.8	178.2	-73.8	171	0	0	0	112.3	Q128 R129 S135 H136	Q128-L132 WeakPolarHBondContact O-CG 3.41Å; Q128-L132 PolarHBondContact O-N 3.19Å; R129-L132 PolarHBondContact O-N 2.94Å; L132-S135 PolarHBondContact O-N 2.92Å; L132-H136 VanDerWaalsContact O-CB 3.32Å; L132-H136 WeakPolarHBondContact O-CB 3.4Å; L132-H136 PolarHBondContact O-N 3.36Å
133	Q	90.8	Very high	84.5	Confident	87 Å²	87	113.8 Å²	113.8	41%	0.407	60%	0.595	S	S	.	*	H	α-helix	trans	-64.5	-39.9	174.8	-74.8	178.6	-9.3	0	0	112.2	R129 T130 Q131 R137	R129-Q133 WeakPolarHBondContact O-CB 3.33Å; R129-Q133 VanDerWaalsContact O-CG 3.29Å; R129-Q133 WeakPolarHBondContact O-CG 3.48Å; R129-Q133 PolarHBondContact O-N 3.41Å; T130-Q133 PolarHBondContact O-N 3.33Å; Q131-Q133 VanDerWaalsContact C-N 3.35Å; Q131-Q133 PolarHBondContact O-N 3.19Å; Q133-R137 WeakPolarHBondContact O-CB 3.46Å; Q133-R137 VanDerWaalsContact O-CG 3.32Å; Q133-R137 WeakPolarHBondContact O-CG 3.34Å; Q133-R137 PolarHBondContact O-N 3.47Å
134	A	85.6	Confident	83.8	Confident	48 Å²	48	114.5 Å²	114.5	40%	0.397	60%	0.599	S	S	.	*	H	α-helix	trans	-65	-45.9	175.5	0	0	0	0	0	111.4	T130 Q131 R137 L138	T130-A134 WeakPolarHBondContact O-CB 3.43Å; T130-A134 PolarHBondContact O-N 3.31Å; Q131-A134 PolarHBondContact O-N 3.21Å; A134-R137 PolarHBondContact O-N 3.03Å; A134-L138 WeakPolarHBondContact O-CG 3.4Å; A134-L138 PolarHBondContact O-N 3.17Å
135	S	83.4	Confident	83.1	Confident	61 Å²	61	115.9 Å²	115.9	43%	0.427	61%	0.606	S	S	.	*	H	α-helix	trans	-62	-44.2	175.2	-64.1	0	0	0	0	112.1	Q131 L132 R137 L138 L139	Q131-S135 PolarHBondContact O-N 3.41Å; Q131-S135 PolarHBondContact O-OG 3.22Å; L132-S135 PolarHBondContact O-N 2.92Å; S135-R137 PolarHBondContact O-N 3.09Å; S135-L138 PolarHBondContact O-N 3.45Å; S135-L139 WeakPolarHBondContact O-CB 3.49Å; S135-L139 PolarHBondContact O-N 2.89Å
136	H	79.8	Confident	82.2	Confident	131 Å²	131	120.4 Å²	120.4	61%	0.606	62%	0.623	S	S	*	*	H	α-helix	trans	-60.9	-43.2	174.9	-178.2	-43.8	0	0	0	111.5	L132 L138 L139 S140	L132-H136 VanDerWaalsContact O-CB 3.32Å; L132-H136 WeakPolarHBondContact O-CB 3.4Å; L132-H136 PolarHBondContact O-N 3.36Å; H136-L138 VanDerWaalsContact C-N 3.28Å; H136-L138 PolarHBondContact O-N 3.11Å; H136-L139 CarbonylContact O-C 3.55Å; H136-L139 PolarHBondContact O-N 2.98Å; H136-S140 PolarHBondContact O-N 2.8Å; H136-S140 PolarHBondContact O-OG 2.9Å
137	R	80.1	Confident	81.4	Confident	195 Å²	195	123.4 Å²	123.4	74%	0.736	63%	0.631	S	S	*	*	H	α-helix	trans	-63.7	-33.5	176.4	-78	177.1	179.8	175.2	0.8	112.7	Q133 A134 S135	Q133-R137 WeakPolarHBondContact O-CB 3.46Å; Q133-R137 VanDerWaalsContact O-CG 3.32Å; Q133-R137 WeakPolarHBondContact O-CG 3.34Å; Q133-R137 PolarHBondContact O-N 3.47Å; A134-R137 PolarHBondContact O-N 3.03Å; S135-R137 PolarHBondContact O-N 3.09Å
138	L	78.5	Confident	80.4	Confident	152 Å²	152	123.8 Å²	123.8	80%	0.796	64%	0.636	S	S	*	*	H	α-helix	trans	-75.7	-26.4	175.6	-73.9	163.5	0	0	0	112.9	A134 S135 H136	A134-L138 WeakPolarHBondContact O-CG 3.4Å; A134-L138 PolarHBondContact O-N 3.17Å; S135-L138 PolarHBondContact O-N 3.45Å; H136-L138 VanDerWaalsContact C-N 3.28Å; H136-L138 PolarHBondContact O-N 3.11Å
139	L	75.6	Confident	79.3	Confident	146 Å²	146	124.9 Å²	124.9	76%	0.764	65%	0.645	S	S	*	*	H	α-helix	trans	-97.4	-6.7	-178.8	-85.4	150.3	0	0	0	114.4	S135 H136 P141	S135-L139 WeakPolarHBondContact O-CB 3.49Å; S135-L139 PolarHBondContact O-N 2.89Å; H136-L139 CarbonylContact O-C 3.55Å; H136-L139 PolarHBondContact O-N 2.98Å; L139-P141 VanDerWaalsContact O-CD 3.22Å; L139-P141 WeakPolarHBondContact O-CD 3.48Å
140	S	54	Low	78.1	Confident	65 Å²	65	121.5 Å²	121.5	46%	0.455	65%	0.646	S	S	.	*			trans	-93.7	103.6	170.5	69.2	0	0	0	0	110.4	H136	H136-S140 PolarHBondContact O-N 2.8Å; H136-S140 PolarHBondContact O-OG 2.9Å
141	P	60.2	Low	76.8	Confident	119 Å²	119	124.2 Å²	124.2	77%	0.773	65%	0.654	S	S	*	*			trans	-73.2	135.7	165.5	31.3	-28.2	0	0	0	108.6	L139	L139-P141 VanDerWaalsContact O-CD 3.22Å; L139-P141 WeakPolarHBondContact O-CD 3.48Å
142	L	49	Very low	75.3	Confident	253 Å²	253	125.5 Å²	125.5	100%	1.325	67%	0.666	S	S	*	*			trans	12.5	0	167.4	-77.1	158.1	0	0	0	117.4

Retrieved 142 of 142 residues in 60.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).