A0A087YEQ1_POEFO Loading...

Si:dkey-31g6.6

AlphaFold DB , UniProt , Accession A0A087YEQ1, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 91 aa.

						>A0A087YEQ1_POEFO|A0A087YEQ1
MKRELVMFLLCLVLLATETAANPVIREKFAKQLLRSKRQDRPVKAGHPDEPMREHQLRMQALDQRAQESNMEYWLNPHCPPRCDRNYGHPV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61.2	Low	84.3	Confident	194 Å²	194	131.7 Å²	131.7	96%	0.956	63%	0.634	S	S	*	*				0	-68	0	-55.2	-60.6	-104.3	0	0	112.6	L5	M1-L5 PolarHBondContact O-N 3.26Å
2	K	72.5	Confident	84.7	Confident	184 Å²	184	129.6 Å²	129.6	80%	0.8	63%	0.627	S	S	*	*	H	α-helix	trans	-66.9	-41.9	-176	-77.1	178.8	178.2	178.7	0	115.2	L5 V6	K2-L5 PolarHBondContact O-N 3.21Å; K2-V6 VanDerWaalsContact O-CG2 3.31Å; K2-V6 WeakPolarHBondContact O-CG2 3.31Å; K2-V6 PolarHBondContact O-N 3.46Å; K2-V6 VanDerWaalsContact O-N 3.13Å
3	R	79.8	Confident	85	Confident	218 Å²	218	126.6 Å²	126.6	82%	0.823	62%	0.621	S	S	*	*	H	α-helix	trans	-68.6	-42.2	-179	-66.4	-176.5	-179.2	177.5	-0.2	112.6	L5 V6 M7	R3-L5 VanDerWaalsContact C-N 3.35Å; R3-L5 PolarHBondContact O-N 2.95Å; R3-V6 PolarHBondContact O-N 3.13Å; R3-M7 PolarHBondContact O-N 3.49Å
4	E	84.1	Confident	85	Confident	127 Å²	127	124.3 Å²	124.3	59%	0.593	61%	0.612	S	S	*	*	H	α-helix	trans	-58.5	-44.7	174.3	-55.6	-52.8	139.5	0	0	112	V6 M7 F8	E4-V6 PolarHBondContact O-N 2.9Å; E4-M7 PolarHBondContact O-N 3.27Å; E4-F8 WeakPolarHBondContact O-CB 3.45Å; E4-F8 PolarHBondContact O-N 3.48Å
5	L	87.3	Confident	84.8	Confident	112 Å²	112	123.6 Å²	123.6	59%	0.586	61%	0.611	S	S	*	*	H	α-helix	trans	-62.1	-41	176	-89.1	158.6	0	0	0	112.4	M1 K2 R3 F8 L9	M1-L5 PolarHBondContact O-N 3.26Å; K2-L5 PolarHBondContact O-N 3.21Å; R3-L5 VanDerWaalsContact C-N 3.35Å; R3-L5 PolarHBondContact O-N 2.95Å; L5-F8 PolarHBondContact O-N 2.9Å; L5-L9 WeakPolarHBondContact O-CB 3.48Å; L5-L9 WeakPolarHBondContact O-CD1 3.37Å; L5-L9 WeakPolarHBondContact O-CG 3.32Å; L5-L9 PolarHBondContact O-N 3.41Å
6	V	89.4	Confident	84.5	Confident	91 Å²	91	119.3 Å²	119.3	55%	0.552	60%	0.601	S	S	*	*	H	α-helix	trans	-64.4	-42.8	176.2	172.2	0	0	0	0	110.6	K2 R3 E4 F8 L9 L10	K2-V6 VanDerWaalsContact O-CG2 3.31Å; K2-V6 WeakPolarHBondContact O-CG2 3.31Å; K2-V6 PolarHBondContact O-N 3.46Å; K2-V6 VanDerWaalsContact O-N 3.13Å; R3-V6 PolarHBondContact O-N 3.13Å; E4-V6 PolarHBondContact O-N 2.9Å; V6-F8 VanDerWaalsContact C-N 3.35Å; V6-L9 PolarHBondContact O-N 3.32Å; V6-L10 WeakPolarHBondContact O-CB 3.33Å; V6-L10 PolarHBondContact O-N 2.92Å
7	M	90.7	Very high	84.1	Confident	117 Å²	117	116.6 Å²	116.6	58%	0.576	59%	0.592	S	S	*	*	H	α-helix	trans	-64.6	-41.3	177.5	-135.2	-160.5	78.4	0	0	111.6	R3 E4 L10 C11	R3-M7 PolarHBondContact O-N 3.49Å; E4-M7 PolarHBondContact O-N 3.27Å; M7-L10 PolarHBondContact O-N 3.41Å; M7-C11 PolarHBondContact O-N 2.92Å
8	F	90.4	Very high	83.4	Confident	146 Å²	146	117.4 Å²	117.4	64%	0.64	59%	0.594	S	S	*	*	H	α-helix	trans	-62.9	-45.9	175.9	-122.9	-87.4	0	0	0	112.2	E4 L5 V6 L10 C11 L12	E4-F8 WeakPolarHBondContact O-CB 3.45Å; E4-F8 PolarHBondContact O-N 3.48Å; L5-F8 PolarHBondContact O-N 2.9Å; V6-F8 VanDerWaalsContact C-N 3.35Å; F8-L10 VanDerWaalsContact C-N 3.31Å; F8-L10 PolarHBondContact O-N 3.29Å; F8-C11 PolarHBondContact O-N 2.95Å; F8-L12 WeakPolarHBondContact O-CG 3.31Å; F8-L12 PolarHBondContact O-N 3.46Å
9	L	91.6	Very high	82.4	Confident	104 Å²	104	116.4 Å²	116.4	55%	0.545	59%	0.594	S	S	.	*	H	α-helix	trans	-61.5	-41.3	175.7	-79.1	162.6	0	0	0	111.2	L5 V6 L12 V13	L5-L9 WeakPolarHBondContact O-CB 3.48Å; L5-L9 WeakPolarHBondContact O-CD1 3.37Å; L5-L9 WeakPolarHBondContact O-CG 3.32Å; L5-L9 PolarHBondContact O-N 3.41Å; V6-L9 PolarHBondContact O-N 3.32Å; L9-L12 PolarHBondContact O-N 3.23Å; L9-V13 VanDerWaalsContact O-CG2 3.29Å; L9-V13 WeakPolarHBondContact O-CG2 3.29Å; L9-V13 PolarHBondContact O-N 3.04Å
10	L	91.1	Very high	81.4	Confident	102 Å²	102	114.5 Å²	114.5	53%	0.534	60%	0.597	S	S	.	*	H	α-helix	trans	-66	-41.8	178.7	-161.2	129.6	0	0	0	111.6	V6 M7 F8 V13 L14	V6-L10 WeakPolarHBondContact O-CB 3.33Å; V6-L10 PolarHBondContact O-N 2.92Å; M7-L10 PolarHBondContact O-N 3.41Å; F8-L10 VanDerWaalsContact C-N 3.31Å; F8-L10 PolarHBondContact O-N 3.29Å; L10-V13 PolarHBondContact O-N 3.4Å; L10-L14 HydrophobicContact CD2-CD1 3.84Å; L10-L14 VanDerWaalsContact O-CG 3.31Å; L10-L14 WeakPolarHBondContact O-CG 3.31Å; L10-L14 PolarHBondContact O-N 3.13Å
11	C	89.1	Confident	80.4	Confident	54 Å²	54	112.8 Å²	112.8	37%	0.365	60%	0.599	S	S	.	*	H	α-helix	trans	-59.7	-46.3	171.2	-79.6	0	0	0	0	112	M7 F8 V13 L14 L15	M7-C11 PolarHBondContact O-N 2.92Å; F8-C11 PolarHBondContact O-N 2.95Å; C11-V13 VanDerWaalsContact C-N 3.31Å; C11-V13 PolarHBondContact O-N 3.4Å; C11-L14 PolarHBondContact O-N 3.48Å; C11-L15 HydrophobicContact CB-CD1 4.49Å; C11-L15 WeakPolarHBondContact O-CD1 3.32Å; C11-L15 PolarHBondContact O-N 3.36Å
12	L	88.7	Confident	80.3	Confident	106 Å²	106	109.3 Å²	109.3	56%	0.555	59%	0.585	S	S	*	*	H	α-helix	trans	-61.7	-39.9	179.5	-73.1	170	0	0	0	112.4	F8 L9 A16	F8-L12 WeakPolarHBondContact O-CG 3.31Å; F8-L12 PolarHBondContact O-N 3.46Å; L9-L12 PolarHBondContact O-N 3.23Å; L12-A16 WeakPolarHBondContact O-CB 3.47Å; L12-A16 PolarHBondContact O-N 2.85Å
13	V	89.1	Confident	79.9	Confident	91 Å²	91	104.3 Å²	104.3	55%	0.552	57%	0.571	S	S	*	*	H	α-helix	trans	-63.6	-45.3	175.7	171.2	0	0	0	0	110.8	L9 L10 C11 A16 T17	L9-V13 VanDerWaalsContact O-CG2 3.29Å; L9-V13 WeakPolarHBondContact O-CG2 3.29Å; L9-V13 PolarHBondContact O-N 3.04Å; L10-V13 PolarHBondContact O-N 3.4Å; C11-V13 VanDerWaalsContact C-N 3.31Å; C11-V13 PolarHBondContact O-N 3.4Å; V13-A16 PolarHBondContact O-N 2.97Å; V13-T17 WeakPolarHBondContact O-CG2 3.11Å; V13-T17 PolarHBondContact O-N 2.94Å; V13-T17 PolarHBondContact O-OG1 3.12Å
14	L	84.8	Confident	79.4	Confident	94 Å²	94	101 Å²	101	49%	0.492	57%	0.574	S	S	.	*	H	α-helix	trans	-62.3	-45.2	177.9	-70.2	169.5	0	0	0	112	L10 C11 A16 T17 E18	L10-L14 HydrophobicContact CD2-CD1 3.84Å; L10-L14 VanDerWaalsContact O-CG 3.31Å; L10-L14 WeakPolarHBondContact O-CG 3.31Å; L10-L14 PolarHBondContact O-N 3.13Å; C11-L14 PolarHBondContact O-N 3.48Å; L14-A16 VanDerWaalsContact C-N 3.32Å; L14-A16 PolarHBondContact O-N 3.01Å; L14-T17 PolarHBondContact O-N 3.49Å; L14-T17 PolarHBondContact O-OG1 3.41Å; L14-E18 WeakPolarHBondContact O-CG 3.36Å; L14-E18 PolarHBondContact O-N 3.3Å; L14-E18 VanDerWaalsContact O-N 3.14Å
15	L	81.8	Confident	78.8	Confident	114 Å²	114	98.2 Å²	98.2	60%	0.597	56%	0.563	S	S	*	*	H	α-helix	trans	-62.2	-39.9	175.8	-85.9	110.1	0	0	0	112.1	C11 T17 E18 T19	C11-L15 HydrophobicContact CB-CD1 4.49Å; C11-L15 WeakPolarHBondContact O-CD1 3.32Å; C11-L15 PolarHBondContact O-N 3.36Å; L15-T17 PolarHBondContact O-N 3.2Å; L15-E18 PolarHBondContact O-N 2.98Å; L15-T19 VanDerWaalsContact O-CG2 3.31Å; L15-T19 WeakPolarHBondContact O-CG2 3.36Å; L15-T19 PolarHBondContact O-N 3.42Å; L15-T19 VanDerWaalsContact O-N 3.13Å; L15-T19 PolarHBondContact O-OG1 3.28Å
16	A	80.4	Confident	78.2	Confident	55 Å²	55	103.1 Å²	103.1	46%	0.455	57%	0.574	S	S	.	*	H	α-helix	trans	-64.1	-39.4	177.7	0	0	0	0	0	112.2	L12 V13 L14 T19 A20	L12-A16 WeakPolarHBondContact O-CB 3.47Å; L12-A16 PolarHBondContact O-N 2.85Å; V13-A16 PolarHBondContact O-N 2.97Å; L14-A16 VanDerWaalsContact C-N 3.32Å; L14-A16 PolarHBondContact O-N 3.01Å; A16-T19 PolarHBondContact O-OG1 3.27Å; A16-A20 PolarHBondContact O-N 3.1Å; A16-A20 VanDerWaalsContact O-N 3.14Å
17	T	77.7	Confident	77.7	Confident	73 Å²	73	105.1 Å²	105.1	45%	0.448	58%	0.577	S	S	.	*	H	α-helix	trans	-69.3	-38	178.5	51.2	0	0	0	0	113	V13 L14 L15 A20 A21	V13-T17 WeakPolarHBondContact O-CG2 3.11Å; V13-T17 PolarHBondContact O-N 2.94Å; V13-T17 PolarHBondContact O-OG1 3.12Å; L14-T17 PolarHBondContact O-N 3.49Å; L14-T17 PolarHBondContact O-OG1 3.41Å; L15-T17 PolarHBondContact O-N 3.2Å; T17-A20 PolarHBondContact O-N 3.25Å; T17-A21 PolarHBondContact O-N 3.14Å; T17-A21 VanDerWaalsContact O-N 3.12Å
18	E	71	Confident	77.3	Confident	132 Å²	132	108.3 Å²	108.3	62%	0.617	59%	0.588	S	S	*	*	H	α-helix	trans	-68.7	-37.8	177.7	-64.6	-57	141	0	0	112.2	L14 L15 A20 A21 N22	L14-E18 WeakPolarHBondContact O-CG 3.36Å; L14-E18 PolarHBondContact O-N 3.3Å; L14-E18 VanDerWaalsContact O-N 3.14Å; L15-E18 PolarHBondContact O-N 2.98Å; E18-A20 VanDerWaalsContact C-N 3.35Å; E18-A21 PolarHBondContact O-N 3.14Å; E18-N22 PolarHBondContact O-N 2.97Å; E18-N22 VanDerWaalsContact O-N 3.1Å
19	T	65	Low	77	Confident	97 Å²	97	106.9 Å²	106.9	60%	0.595	58%	0.581	S	S	*	*	H	α-helix	trans	-71	-29.6	176.3	59.4	0	0	0	0	113.1	L15 A16 A21 N22	L15-T19 VanDerWaalsContact O-CG2 3.31Å; L15-T19 WeakPolarHBondContact O-CG2 3.36Å; L15-T19 PolarHBondContact O-N 3.42Å; L15-T19 VanDerWaalsContact O-N 3.13Å; L15-T19 PolarHBondContact O-OG1 3.28Å; A16-T19 PolarHBondContact O-OG1 3.27Å; T19-A21 VanDerWaalsContact C-N 3.34Å; T19-N22 CarbonylContact O-C 3.47Å
20	A	61.6	Low	76.7	Confident	79 Å²	79	103.5 Å²	103.5	65%	0.653	57%	0.569	S	S	*	*	H	α-helix	trans	-70	-32.5	171.1	0	0	0	0	0	112	A16 T17 E18	A16-A20 PolarHBondContact O-N 3.1Å; A16-A20 VanDerWaalsContact O-N 3.14Å; T17-A20 PolarHBondContact O-N 3.25Å; E18-A20 VanDerWaalsContact C-N 3.35Å
21	A	60.5	Low	76.6	Confident	79 Å²	79	104.7 Å²	104.7	65%	0.653	57%	0.569	S	S	*	*	H	α-helix	trans	-75.6	-27.6	178.3	0	0	0	0	0	113.5	T17 E18 T19 P23	T17-A21 PolarHBondContact O-N 3.14Å; T17-A21 VanDerWaalsContact O-N 3.12Å; E18-A21 PolarHBondContact O-N 3.14Å; T19-A21 VanDerWaalsContact C-N 3.34Å; A21-P23 VanDerWaalsContact O-CD 3.3Å; A21-P23 WeakPolarHBondContact O-CD 3.19Å
22	N	59.8	Low	76.5	Confident	121 Å²	121	108.7 Å²	108.7	65%	0.647	58%	0.583	S	S	*	*	S	Bend	trans	-114.6	78.9	174	-167.5	13.6	0	0	0	110.2	E18 T19 V24	E18-N22 PolarHBondContact O-N 2.97Å; E18-N22 VanDerWaalsContact O-N 3.1Å; T19-N22 CarbonylContact O-C 3.47Å; N22-V24 PolarHBondContact O-N 3.18Å
23	P	64.4	Low	76.4	Confident	78 Å²	78	107.4 Å²	107.4	51%	0.506	58%	0.576	S	S	.	*			trans	-55.3	130.3	174.2	23.5	-31.8	0	0	0	107.9	A21 I25	A21-P23 VanDerWaalsContact O-CD 3.3Å; A21-P23 WeakPolarHBondContact O-CD 3.19Å; P23-I25 HydrophobicContact CB-CG1 4.48Å; P23-I25 HydrophobicContact CG-CG1 4.16Å; P23-I25 WeakPolarHBondContact O-CG1 3.3Å; P23-I25 PolarHBondContact O-N 3.48Å
24	V	68.5	Low	76.2	Confident	149 Å²	149	107.9 Å²	107.9	90%	0.903	58%	0.575	S	S	*	*			trans	-65.2	89.9	169.5	177.7	0	0	0	0	106.7	N22 R26	N22-V24 PolarHBondContact O-N 3.18Å; V24-R26 PolarHBondContact O-N 3.46Å
25	I	71	Confident	76	Confident	69 Å²	69	112.2 Å²	112.2	35%	0.354	59%	0.585	S	S	.	*			trans	-68.1	131.1	-175.4	-73.7	169.4	0	0	0	108.2	P23 E27 F29 A30	P23-I25 HydrophobicContact CB-CG1 4.48Å; P23-I25 HydrophobicContact CG-CG1 4.16Å; P23-I25 WeakPolarHBondContact O-CG1 3.3Å; P23-I25 PolarHBondContact O-N 3.48Å; I25-E27 PolarHBondContact O-N 2.61Å; I25-F29 HydrophobicContact CD1-CD1 4.44Å; I25-F29 HydrophobicContact CG1-CD1 4.39Å; I25-F29 HydrophobicContact CG2-CB 3.8Å; I25-F29 HydrophobicContact CG2-CD1 3.48Å; I25-F29 VanDerWaalsContact CG2-CD1 3.48Å; I25-F29 HydrophobicContact CG2-CG 4.1Å; I25-A30 HydrophobicContact CG2-CB 3.82Å
26	R	76	Confident	76.1	Confident	215 Å²	215	109 Å²	109	81%	0.811	57%	0.572	S	S	*	*			trans	-60.2	139.1	172.5	-67.3	-175.4	-176.4	-175.9	1.2	110	V24 K28 F29 A30	V24-R26 PolarHBondContact O-N 3.46Å; R26-K28 PolarHBondContact O-N 2.72Å; R26-F29 WeakPolarHBondContact O-CA 3.39Å; R26-F29 WeakPolarHBondContact O-CB 3.47Å; R26-F29 PolarHBondContact O-N 3.04Å; R26-A30 PolarHBondContact O-N 2.91Å
27	E	78.7	Confident	76.1	Confident	133 Å²	133	113 Å²	113	62%	0.621	58%	0.579	S	S	*	*	H	α-helix	trans	-48	-41	-176.7	-168.9	-165.4	153.9	0	0	113.6	I25 F29 A30 K31	I25-E27 PolarHBondContact O-N 2.61Å; E27-F29 VanDerWaalsContact C-N 3.34Å; E27-F29 PolarHBondContact O-N 3.34Å; E27-A30 PolarHBondContact O-N 3.5Å; E27-K31 HydrophobicContact CG-CD 4.32Å; E27-K31 WeakPolarHBondContact O-CB 3.47Å; E27-K31 WeakPolarHBondContact O-CG 3.26Å; E27-K31 PolarHBondContact O-N 2.84Å; E27-K31 WeakPolarHBondContact OE1-CE 3.39Å; E27-K31 IonicContact OE1-NZ 2.61Å; E27-K31 PolarHBondContact OE1-NZ 3.02Å
28	K	82.5	Confident	75.8	Confident	184 Å²	184	118.3 Å²	118.3	80%	0.8	59%	0.591	S	S	*	*	H	α-helix	trans	-59.2	-43.9	177	-67.9	-171.3	178.3	-175.4	0	112.5	R26 Q32	R26-K28 PolarHBondContact O-N 2.72Å; K28-Q32 WeakPolarHBondContact O-CB 3.45Å; K28-Q32 PolarHBondContact O-N 2.86Å
29	F	84.2	Confident	75.8	Confident	115 Å²	115	119.4 Å²	119.4	50%	0.504	60%	0.596	S	S	.	*	H	α-helix	trans	-72.6	-39.1	179.8	-171.8	-92.4	0	0	0	111.1	I25 R26 E27 K31 Q32 L33	I25-F29 HydrophobicContact CD1-CD1 4.44Å; I25-F29 HydrophobicContact CG1-CD1 4.39Å; I25-F29 HydrophobicContact CG2-CB 3.8Å; I25-F29 HydrophobicContact CG2-CD1 3.48Å; I25-F29 VanDerWaalsContact CG2-CD1 3.48Å; I25-F29 HydrophobicContact CG2-CG 4.1Å; R26-F29 WeakPolarHBondContact O-CA 3.39Å; R26-F29 WeakPolarHBondContact O-CB 3.47Å; R26-F29 PolarHBondContact O-N 3.04Å; E27-F29 VanDerWaalsContact C-N 3.34Å; E27-F29 PolarHBondContact O-N 3.34Å; F29-K31 VanDerWaalsContact C-N 3.33Å; F29-K31 PolarHBondContact O-N 2.91Å; F29-Q32 PolarHBondContact O-N 3.43Å; F29-L33 HydrophobicContact CE1-CD1 3.94Å; F29-L33 HydrophobicContact CZ-CD1 4.38Å; F29-L33 WeakPolarHBondContact O-CB 3.41Å; F29-L33 PolarHBondContact O-N 3.19Å
30	A	85.6	Confident	76	Confident	34 Å²	34	120.6 Å²	120.6	28%	0.281	60%	0.599	S	S	.	*	H	α-helix	trans	-59.2	-45.5	173.4	0	0	0	0	0	111.3	I25 R26 E27 Q32 L33 L34	I25-A30 HydrophobicContact CG2-CB 3.82Å; R26-A30 PolarHBondContact O-N 2.91Å; E27-A30 PolarHBondContact O-N 3.5Å; A30-Q32 VanDerWaalsContact C-N 3.33Å; A30-Q32 PolarHBondContact O-N 3.43Å; A30-L33 PolarHBondContact O-N 3.31Å; A30-L34 WeakPolarHBondContact O-CB 3.43Å; A30-L34 VanDerWaalsContact O-CG 3.26Å; A30-L34 WeakPolarHBondContact O-CG 3.47Å; A30-L34 PolarHBondContact O-N 3.43Å
31	K	88	Confident	76.1	Confident	126 Å²	126	124.6 Å²	124.6	55%	0.548	60%	0.597	S	S	.	*	H	α-helix	trans	-61.2	-40.8	175.6	-77.3	175.8	170.2	173.4	0	112.2	E27 F29 L34 R35	E27-K31 HydrophobicContact CG-CD 4.32Å; E27-K31 WeakPolarHBondContact O-CB 3.47Å; E27-K31 WeakPolarHBondContact O-CG 3.26Å; E27-K31 PolarHBondContact O-N 2.84Å; E27-K31 WeakPolarHBondContact OE1-CE 3.39Å; E27-K31 IonicContact OE1-NZ 2.61Å; E27-K31 PolarHBondContact OE1-NZ 3.02Å; F29-K31 VanDerWaalsContact C-N 3.33Å; F29-K31 PolarHBondContact O-N 2.91Å; K31-L34 PolarHBondContact O-N 3.03Å; K31-R35 WeakPolarHBondContact O-CB 3.45Å; K31-R35 PolarHBondContact O-N 3.47Å
32	Q	87.4	Confident	76.3	Confident	139 Å²	139	126 Å²	126	65%	0.65	60%	0.599	S	S	*	*	H	α-helix	trans	-65.7	-43	177.2	-171.7	162.3	-7.8	0	0	111.8	K28 F29 A30 R35 S36	K28-Q32 WeakPolarHBondContact O-CB 3.45Å; K28-Q32 PolarHBondContact O-N 2.86Å; F29-Q32 PolarHBondContact O-N 3.43Å; A30-Q32 VanDerWaalsContact C-N 3.33Å; A30-Q32 PolarHBondContact O-N 3.43Å; Q32-R35 WeakPolarHBondContact O-CB 3.36Å; Q32-R35 PolarHBondContact O-N 3.14Å; Q32-R35 VanDerWaalsContact O-N 3.13Å; Q32-S36 PolarHBondContact O-N 3.3Å
33	L	86.3	Confident	76.5	Confident	79 Å²	79	124.9 Å²	124.9	41%	0.414	60%	0.597	S	S	.	*	H	α-helix	trans	-64.3	-40.8	176.6	-157.8	107.4	0	0	0	112.3	F29 A30 R35 S36 K37	F29-L33 HydrophobicContact CE1-CD1 3.94Å; F29-L33 HydrophobicContact CZ-CD1 4.38Å; F29-L33 WeakPolarHBondContact O-CB 3.41Å; F29-L33 PolarHBondContact O-N 3.19Å; A30-L33 PolarHBondContact O-N 3.31Å; L33-R35 PolarHBondContact O-N 3.45Å; L33-S36 PolarHBondContact O-OG 3.03Å; L33-K37 WeakPolarHBondContact O-CB 3.43Å; L33-K37 WeakPolarHBondContact O-CG 3.46Å; L33-K37 PolarHBondContact O-N 2.92Å
34	L	84.3	Confident	76.1	Confident	100 Å²	100	128.7 Å²	128.7	52%	0.524	61%	0.605	S	S	.	*	H	α-helix	trans	-68.4	-23.8	174.5	-70.1	172.7	0	0	0	112.8	A30 K31 R38	A30-L34 WeakPolarHBondContact O-CB 3.43Å; A30-L34 VanDerWaalsContact O-CG 3.26Å; A30-L34 WeakPolarHBondContact O-CG 3.47Å; A30-L34 PolarHBondContact O-N 3.43Å; K31-L34 PolarHBondContact O-N 3.03Å; L34-R38 PolarHBondContact O-N 3.37Å; L34-R38 PolarHBondContact O-NE 3.05Å; L34-R38 VanDerWaalsContact O-NE 3.14Å
35	R	82.2	Confident	75.4	Confident	186 Å²	186	126.2 Å²	126.2	70%	0.702	60%	0.6	S	S	*	*	H	α-helix	trans	-79.1	-44.2	176.8	-161.1	170.4	-174.6	160.4	0.2	110.8	K31 Q32 L33 R38 Q39	K31-R35 WeakPolarHBondContact O-CB 3.45Å; K31-R35 PolarHBondContact O-N 3.47Å; Q32-R35 WeakPolarHBondContact O-CB 3.36Å; Q32-R35 PolarHBondContact O-N 3.14Å; Q32-R35 VanDerWaalsContact O-N 3.13Å; L33-R35 PolarHBondContact O-N 3.45Å; R35-R38 PolarHBondContact O-N 3.39Å; R35-Q39 PolarHBondContact O-N 3.15Å
36	S	83.4	Confident	74.6	Confident	47 Å²	47	126.1 Å²	126.1	33%	0.329	62%	0.617	S	S	.	*	H	α-helix	trans	-62.5	-45.9	174.1	59.9	0	0	0	0	111.7	Q32 L33 R38 Q39 D40	Q32-S36 PolarHBondContact O-N 3.3Å; L33-S36 PolarHBondContact O-OG 3.03Å; S36-R38 PolarHBondContact O-N 3.13Å; S36-R38 VanDerWaalsContact O-N 3.15Å; S36-Q39 WeakPolarHBondContact O-CB 3.43Å; S36-Q39 PolarHBondContact O-N 3.11Å; S36-D40 PolarHBondContact O-N 3.16Å
37	K	79.1	Confident	73.4	Confident	138 Å²	138	120.4 Å²	120.4	60%	0.6	60%	0.599	S	S	*	*	H	α-helix	trans	-61	-26.1	177.5	-74.3	-65	-172.3	-171.4	0	114.6	L33 R41	L33-K37 WeakPolarHBondContact O-CB 3.43Å; L33-K37 WeakPolarHBondContact O-CG 3.46Å; L33-K37 PolarHBondContact O-N 2.92Å; K37-R41 PolarHBondContact O-N 3.02Å
38	R	72.8	Confident	72.4	Confident	184 Å²	184	118.8 Å²	118.8	69%	0.694	60%	0.6	S	S	*	*	H	α-helix	trans	-75.7	-28.5	173.4	-89.8	-176.9	-86.2	-144.2	-1	112.9	L34 R35 S36	L34-R38 PolarHBondContact O-N 3.37Å; L34-R38 PolarHBondContact O-NE 3.05Å; L34-R38 VanDerWaalsContact O-NE 3.14Å; R35-R38 PolarHBondContact O-N 3.39Å; S36-R38 PolarHBondContact O-N 3.13Å; S36-R38 VanDerWaalsContact O-N 3.15Å
39	Q	69.4	Low	71.3	Confident	156 Å²	156	115.8 Å²	115.8	73%	0.729	59%	0.593	S	S	*	*	H	α-helix	trans	-77.9	-34.2	175.9	-67.9	177.1	-43	0	0	111.7	R35 S36 R41	R35-Q39 PolarHBondContact O-N 3.15Å; S36-Q39 WeakPolarHBondContact O-CB 3.43Å; S36-Q39 PolarHBondContact O-N 3.11Å; Q39-R41 PolarHBondContact O-N 3.4Å
40	D	70	Confident	70.2	Confident	121 Å²	121	114.4 Å²	114.4	65%	0.647	59%	0.588	S	S	*	*	S	Bend	trans	-77	-8.6	176.7	-64.8	-25.2	0	0	0	113.5	S36	S36-D40 PolarHBondContact O-N 3.16Å
41	R	64.4	Low	69.1	Low	163 Å²	163	116.5 Å²	116.5	62%	0.615	60%	0.599	S	S	*	*	S	Bend	trans	-68.9	127.1	177.6	-171.4	-178.3	-177.4	161.7	6.3	107.8	K37 Q39 V43	K37-R41 PolarHBondContact O-N 3.02Å; Q39-R41 PolarHBondContact O-N 3.4Å; R41-V43 PolarHBondContact O-N 3.05Å; R41-V43 VanDerWaalsContact O-N 3.16Å
42	P	64.6	Low	68.1	Low	109 Å²	109	115 Å²	115	71%	0.708	60%	0.595	S	S	*	*	P	Polyproline II helix	trans	-54.1	128.7	170.7	22.7	-31.8	0	0	0	108	K44	P42-K44 PolarHBondContact O-N 2.94Å; P42-K44 VanDerWaalsContact O-N 3.11Å
43	V	63.3	Low	67.4	Low	98 Å²	98	117.5 Å²	117.5	59%	0.594	60%	0.598	S	S	*	*	P	Polyproline II helix	trans	-50.6	123.6	176.2	-175.9	0	0	0	0	106.2	R41 A45 H47	R41-V43 PolarHBondContact O-N 3.05Å; R41-V43 VanDerWaalsContact O-N 3.16Å; V43-A45 PolarHBondContact O-N 3.02Å; V43-A45 VanDerWaalsContact O-N 3.12Å; V43-H47 HydrophobicContact CG1-CB 3.77Å
44	K	56.2	Low	66.8	Low	157 Å²	157	120.5 Å²	120.5	68%	0.683	61%	0.61	S	S	*	*	P	Polyproline II helix	trans	-53.8	124.1	176.2	-106.5	-179.7	171.5	-174.3	0	106.8	P42 G46 H47	P42-K44 PolarHBondContact O-N 2.94Å; P42-K44 VanDerWaalsContact O-N 3.11Å; K44-G46 PolarHBondContact O-N 3.12Å; K44-H47 PolarHBondContact O-N 2.83Å
45	A	52.9	Low	66.6	Low	97 Å²	97	121.2 Å²	121.2	80%	0.802	61%	0.611	S	S	*	*	S	Bend	trans	-49.8	116.2	170.5	0	0	0	0	0	108.4	V43 E50	V43-A45 PolarHBondContact O-N 3.02Å; V43-A45 VanDerWaalsContact O-N 3.12Å; A45-E50 WeakPolarHBondContact CA-OE2 3.38Å
46	G	54.7	Low	66.6	Low	68 Å²	68	117.3 Å²	117.3	70%	0.701	60%	0.6	S	S	*	*			trans	119	23.7	-170	0	0	0	0	0	114.9	K44 E50	K44-G46 PolarHBondContact O-N 3.12Å; G46-E50 PolarHBondContact N-OE2 3.38Å
47	H	51.8	Low	66.6	Low	95 Å²	95	119.7 Å²	119.7	44%	0.44	61%	0.609	S	S	.	*			trans	-64.3	138.8	161.5	-166.7	53.8	0	0	0	108.7	V43 K44 D49 E50	V43-H47 HydrophobicContact CG1-CB 3.77Å; K44-H47 PolarHBondContact O-N 2.83Å; H47-D49 IonicContact CD2-OD2 3.93Å; H47-D49 IonicContact NE2-OD2 3.44Å; H47-D49 PolarHBondContact NE2-OD2 3.22Å; H47-D49 PolarHBondContact O-N 2.96Å; H47-E50 HydrophobicContact CB-CB 4.42Å; H47-E50 PolarHBondContact N-OE2 2.7Å; H47-E50 WeakPolarHBondContact O-CB 3.38Å; H47-E50 PolarHBondContact O-N 3.01Å
48	P	57	Low	66.9	Low	99 Å²	99	121.6 Å²	121.6	64%	0.643	61%	0.613	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.2	-22.3	178.2	-25.2	34	0	0	0	113.8	M52	P48-M52 WeakPolarHBondContact O-CG 3.36Å
49	D	59.9	Low	67.5	Low	121 Å²	121	116.8 Å²	116.8	65%	0.647	60%	0.599	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102	6.7	-177.6	-51.2	-34.4	0	0	0	114	H47	H47-D49 IonicContact CD2-OD2 3.93Å; H47-D49 IonicContact NE2-OD2 3.44Å; H47-D49 PolarHBondContact NE2-OD2 3.22Å; H47-D49 PolarHBondContact O-N 2.96Å
50	E	60.8	Low	68.3	Low	85 Å²	85	114.8 Å²	114.8	40%	0.397	59%	0.589	S	S	.	*	S	Bend	trans	-73.5	145.2	170.7	-146	147.4	-161.5	0	0	109.9	A45 G46 H47 M52	A45-E50 WeakPolarHBondContact CA-OE2 3.38Å; G46-E50 PolarHBondContact N-OE2 3.38Å; H47-E50 HydrophobicContact CB-CB 4.42Å; H47-E50 PolarHBondContact N-OE2 2.7Å; H47-E50 WeakPolarHBondContact O-CB 3.38Å; H47-E50 PolarHBondContact O-N 3.01Å; E50-M52 PolarHBondContact O-N 3.44Å
51	P	62.7	Low	69.2	Low	79 Å²	79	110.7 Å²	110.7	51%	0.513	57%	0.573	S	S	.	*			trans	-48.8	85.9	-134.6	31.8	-36	0	0	0	112.5	R53 E54	P51-R53 PolarHBondContact O-N 3.36Å; P51-E54 PolarHBondContact O-N 2.94Å
52	M	66.5	Low	70.1	Confident	95 Å²	95	106.5 Å²	106.5	47%	0.468	56%	0.562	S	S	.	*	H	α-helix	trans	-51.5	-27.9	-179.9	-92.7	-115.8	-76.8	0	0	111.3	P48 E50 E54 H55 Q56	P48-M52 WeakPolarHBondContact O-CG 3.36Å; E50-M52 PolarHBondContact O-N 3.44Å; M52-E54 PolarHBondContact O-N 3.37Å; M52-H55 PolarHBondContact O-N 3Å; M52-Q56 WeakPolarHBondContact O-CB 3.32Å; M52-Q56 WeakPolarHBondContact O-CG 3.36Å; M52-Q56 PolarHBondContact O-N 2.9Å
53	R	72.6	Confident	71	Confident	190 Å²	190	105.9 Å²	105.9	72%	0.717	55%	0.553	S	S	*	*	H	α-helix	trans	-58	-46	177.2	-170.3	176.3	179.1	-173.3	-1	113.5	P51 L57	P51-R53 PolarHBondContact O-N 3.36Å; R53-L57 HydrophobicContact CG-CD1 4.05Å; R53-L57 WeakPolarHBondContact O-CB 3.11Å; R53-L57 WeakPolarHBondContact O-CG 3.44Å; R53-L57 PolarHBondContact O-N 3.24Å
54	E	73.9	Confident	71.8	Confident	143 Å²	143	105.9 Å²	105.9	67%	0.668	55%	0.546	S	S	*	.	H	α-helix	trans	-71	-39.2	-178.6	-67.3	-170.5	165.6	0	0	111.4	P51 M52 R58	P51-E54 PolarHBondContact O-N 2.94Å; M52-E54 PolarHBondContact O-N 3.37Å; E54-R58 WeakPolarHBondContact O-CB 3.29Å; E54-R58 PolarHBondContact O-N 2.95Å
55	H	80.8	Confident	72.8	Confident	115 Å²	115	105.9 Å²	105.9	53%	0.532	54%	0.542	S	S	.	.	H	α-helix	trans	-64.3	-46.5	174.3	-177.4	67.4	0	0	0	111.4	M52 L57 R58 M59	M52-H55 PolarHBondContact O-N 3Å; H55-L57 PolarHBondContact O-N 2.84Å; H55-R58 CarbonylContact O-C 3.6Å; H55-R58 WeakPolarHBondContact O-CB 3.24Å; H55-R58 PolarHBondContact O-N 3.42Å; H55-M59 VanDerWaalsContact O-CG 3.29Å; H55-M59 WeakPolarHBondContact O-CG 3.09Å; H55-M59 PolarHBondContact O-N 2.81Å
56	Q	81.6	Confident	73.8	Confident	103 Å²	103	103.7 Å²	103.7	48%	0.481	52%	0.524	S	S	.	.	H	α-helix	trans	-61.6	-44.2	177.2	-75.9	170.5	-4.5	0	0	112	M52 R58 M59 Q60	M52-Q56 WeakPolarHBondContact O-CB 3.32Å; M52-Q56 WeakPolarHBondContact O-CG 3.36Å; M52-Q56 PolarHBondContact O-N 2.9Å; Q56-R58 VanDerWaalsContact C-N 3.3Å; Q56-R58 PolarHBondContact O-N 3.1Å; Q56-M59 PolarHBondContact O-N 2.77Å; Q56-Q60 WeakPolarHBondContact O-CB 3.44Å; Q56-Q60 PolarHBondContact O-N 2.97Å
57	L	84	Confident	74.6	Confident	97 Å²	97	106.2 Å²	106.2	51%	0.508	52%	0.518	S	S	.	.	H	α-helix	trans	-61.6	-39.8	175	-73.8	169.9	0	0	0	111.4	R53 H55 Q60 A61	R53-L57 HydrophobicContact CG-CD1 4.05Å; R53-L57 WeakPolarHBondContact O-CB 3.11Å; R53-L57 WeakPolarHBondContact O-CG 3.44Å; R53-L57 PolarHBondContact O-N 3.24Å; H55-L57 PolarHBondContact O-N 2.84Å; L57-Q60 PolarHBondContact O-N 2.99Å; L57-A61 WeakPolarHBondContact O-CB 3.39Å; L57-A61 PolarHBondContact O-N 3.48Å
58	R	85.4	Confident	75.4	Confident	179 Å²	179	106.5 Å²	106.5	68%	0.675	52%	0.519	S	S	*	.	H	α-helix	trans	-64.9	-44.1	174.3	-179.4	175.7	178.2	170.6	-0	111.9	E54 H55 Q56 Q60 A61 L62	E54-R58 WeakPolarHBondContact O-CB 3.29Å; E54-R58 PolarHBondContact O-N 2.95Å; H55-R58 CarbonylContact O-C 3.6Å; H55-R58 WeakPolarHBondContact O-CB 3.24Å; H55-R58 PolarHBondContact O-N 3.42Å; Q56-R58 VanDerWaalsContact C-N 3.3Å; Q56-R58 PolarHBondContact O-N 3.1Å; R58-Q60 VanDerWaalsContact C-N 3.34Å; R58-A61 PolarHBondContact O-N 2.9Å; R58-L62 HydrophobicContact CG-CD1 4.37Å; R58-L62 WeakPolarHBondContact O-CG 3.42Å; R58-L62 PolarHBondContact O-N 3.13Å
59	M	84.4	Confident	75.8	Confident	83 Å²	83	104.8 Å²	104.8	41%	0.409	51%	0.51	S	S	.	.	H	α-helix	trans	-62.6	-43.1	176.9	-69.1	-55.7	-66.4	0	0	111	H55 Q56 A61 L62 D63	H55-M59 VanDerWaalsContact O-CG 3.29Å; H55-M59 WeakPolarHBondContact O-CG 3.09Å; H55-M59 PolarHBondContact O-N 2.81Å; Q56-M59 PolarHBondContact O-N 2.77Å; M59-A61 PolarHBondContact O-N 3.19Å; M59-L62 WeakPolarHBondContact O-CB 3.45Å; M59-L62 PolarHBondContact O-N 3.5Å; M59-L62 VanDerWaalsContact O-N 3.1Å; M59-L62 HydrophobicContact SD-CD1 4.31Å; M59-D63 PolarHBondContact O-N 3.42Å
60	Q	87.1	Confident	76.1	Confident	113 Å²	113	102.8 Å²	102.8	53%	0.528	50%	0.499	S	S	.	.	H	α-helix	trans	-62.3	-40.6	177.2	-168.8	174.6	12.4	0	0	112.4	Q56 L57 R58 L62 D63 Q64	Q56-Q60 WeakPolarHBondContact O-CB 3.44Å; Q56-Q60 PolarHBondContact O-N 2.97Å; L57-Q60 PolarHBondContact O-N 2.99Å; R58-Q60 VanDerWaalsContact C-N 3.34Å; Q60-L62 VanDerWaalsContact C-N 3.29Å; Q60-L62 PolarHBondContact O-N 3.08Å; Q60-D63 PolarHBondContact O-N 2.89Å; Q60-Q64 WeakPolarHBondContact O-CG 3.17Å; Q60-Q64 PolarHBondContact O-N 3.43Å
61	A	88.4	Confident	76.1	Confident	36 Å²	36	103.4 Å²	103.4	30%	0.298	50%	0.503	S	S	.	.	H	α-helix	trans	-69.1	-26.4	175.4	0	0	0	0	0	113.3	L57 R58 M59 R65	L57-A61 WeakPolarHBondContact O-CB 3.39Å; L57-A61 PolarHBondContact O-N 3.48Å; R58-A61 PolarHBondContact O-N 2.9Å; M59-A61 PolarHBondContact O-N 3.19Å; A61-R65 PolarHBondContact O-N 3.1Å; A61-R65 PolarHBondContact O-NE 3.46Å
62	L	82.8	Confident	76	Confident	75 Å²	75	106.5 Å²	106.5	39%	0.393	51%	0.511	S	S	.	.	H	α-helix	trans	-75.1	-42.3	172.6	-70.9	170.9	0	0	0	110.9	R58 M59 Q60 R65 A66	R58-L62 HydrophobicContact CG-CD1 4.37Å; R58-L62 WeakPolarHBondContact O-CG 3.42Å; R58-L62 PolarHBondContact O-N 3.13Å; M59-L62 WeakPolarHBondContact O-CB 3.45Å; M59-L62 PolarHBondContact O-N 3.5Å; M59-L62 VanDerWaalsContact O-N 3.1Å; M59-L62 HydrophobicContact SD-CD1 4.31Å; Q60-L62 VanDerWaalsContact C-N 3.29Å; Q60-L62 PolarHBondContact O-N 3.08Å; L62-R65 PolarHBondContact O-N 3.06Å; L62-A66 WeakPolarHBondContact O-CB 3.14Å; L62-A66 PolarHBondContact O-N 2.82Å
63	D	84	Confident	75.7	Confident	96 Å²	96	107.4 Å²	107.4	51%	0.513	51%	0.509	S	S	.	.	H	α-helix	trans	-63.2	-40.8	175.8	-79	-14.5	0	0	0	112	M59 Q60 A66 Q67	M59-D63 PolarHBondContact O-N 3.42Å; Q60-D63 PolarHBondContact O-N 2.89Å; D63-A66 PolarHBondContact O-N 3.42Å; D63-Q67 WeakPolarHBondContact O-CG 3.33Å; D63-Q67 PolarHBondContact O-N 3.46Å
64	Q	80	Confident	75.1	Confident	98 Å²	98	102 Å²	102	46%	0.458	49%	0.489	S	S	.	.	H	α-helix	trans	-60.6	-47.9	174.3	-76.9	174.9	-7	0	0	111.7	Q60 A66 Q67 E68	Q60-Q64 WeakPolarHBondContact O-CG 3.17Å; Q60-Q64 PolarHBondContact O-N 3.43Å; Q64-A66 VanDerWaalsContact C-N 3.31Å; Q64-A66 PolarHBondContact O-N 3.12Å; Q64-Q67 WeakPolarHBondContact O-CB 3.47Å; Q64-Q67 PolarHBondContact O-N 3.42Å; Q64-Q67 VanDerWaalsContact O-N 3.17Å; Q64-E68 WeakPolarHBondContact O-CG 3.09Å; Q64-E68 PolarHBondContact O-N 3.44Å
65	R	76.4	Confident	74.3	Confident	157 Å²	157	101.9 Å²	101.9	59%	0.592	49%	0.492	S	S	*	.	H	α-helix	trans	-64.2	-36	175.4	-89.8	-174.5	-80.7	177.6	-11.9	112.9	A61 L62 Q67 E68 S69	A61-R65 PolarHBondContact O-N 3.1Å; A61-R65 PolarHBondContact O-NE 3.46Å; L62-R65 PolarHBondContact O-N 3.06Å; R65-Q67 VanDerWaalsContact C-N 3.34Å; R65-E68 PolarHBondContact O-N 3.09Å; R65-S69 WeakPolarHBondContact O-CB 2.86Å; R65-S69 PolarHBondContact O-N 2.74Å; R65-S69 PolarHBondContact O-OG 2.91Å
66	A	74	Confident	73.2	Confident	51 Å²	51	99.7 Å²	99.7	42%	0.421	49%	0.485	S	S	.	.	H	α-helix	trans	-63.7	-43.2	174.3	0	0	0	0	0	110	L62 D63 Q64 S69 N70	L62-A66 WeakPolarHBondContact O-CB 3.14Å; L62-A66 PolarHBondContact O-N 2.82Å; D63-A66 PolarHBondContact O-N 3.42Å; Q64-A66 VanDerWaalsContact C-N 3.31Å; Q64-A66 PolarHBondContact O-N 3.12Å; A66-S69 PolarHBondContact O-OG 2.85Å; A66-S69 VanDerWaalsContact O-OG 3.09Å; A66-N70 WeakPolarHBondContact O-CA 3.5Å; A66-N70 WeakPolarHBondContact O-CB 3.36Å; A66-N70 PolarHBondContact O-N 3.17Å
67	Q	72.1	Confident	72.1	Confident	121 Å²	121	100.4 Å²	100.4	57%	0.565	50%	0.498	S	S	*	.	H	α-helix	trans	-65.5	-43.9	175.3	-73.3	177.9	3.8	0	0	112.6	D63 Q64 R65 N70 M71	D63-Q67 WeakPolarHBondContact O-CG 3.33Å; D63-Q67 PolarHBondContact O-N 3.46Å; Q64-Q67 WeakPolarHBondContact O-CB 3.47Å; Q64-Q67 PolarHBondContact O-N 3.42Å; Q64-Q67 VanDerWaalsContact O-N 3.17Å; R65-Q67 VanDerWaalsContact C-N 3.34Å; Q67-N70 PolarHBondContact O-N 3.29Å; Q67-M71 HydrophobicContact CB-CE 4.48Å; Q67-M71 VanDerWaalsContact O-CB 3.3Å; Q67-M71 WeakPolarHBondContact O-CB 3.35Å; Q67-M71 WeakPolarHBondContact O-CG 3.48Å; Q67-M71 PolarHBondContact O-N 2.9Å
68	E	69.5	Low	71.1	Confident	100 Å²	100	103.7 Å²	103.7	47%	0.467	51%	0.51	S	S	.	.	H	α-helix	trans	-62.1	-51.1	177.4	-71.4	166.9	178.7	0	0	111.1	Q64 R65 N70 M71 E72	Q64-E68 WeakPolarHBondContact O-CG 3.09Å; Q64-E68 PolarHBondContact O-N 3.44Å; R65-E68 PolarHBondContact O-N 3.09Å; E68-N70 VanDerWaalsContact C-N 3.33Å; E68-N70 PolarHBondContact O-N 3.42Å; E68-M71 HydrophobicContact CG-CE 4.43Å; E68-M71 PolarHBondContact O-N 3.33Å; E68-E72 WeakPolarHBondContact O-CB 3.36Å; E68-E72 VanDerWaalsContact O-CG 3.28Å; E68-E72 WeakPolarHBondContact O-CG 3.17Å; E68-E72 PolarHBondContact O-N 3.33Å
69	S	64.7	Low	69.8	Low	64 Å²	64	96.6 Å²	96.6	45%	0.448	49%	0.488	S	S	.	.	H	α-helix	trans	-64.9	-35.9	177.3	57.8	0	0	0	0	112.9	R65 A66 Y73	R65-S69 WeakPolarHBondContact O-CB 2.86Å; R65-S69 PolarHBondContact O-N 2.74Å; R65-S69 PolarHBondContact O-OG 2.91Å; A66-S69 PolarHBondContact O-OG 2.85Å; A66-S69 VanDerWaalsContact O-OG 3.09Å; S69-Y73 WeakPolarHBondContact O-CB 3.34Å; S69-Y73 PolarHBondContact O-N 2.85Å
70	N	66	Low	68.5	Low	78 Å²	78	96.2 Å²	96.2	42%	0.417	49%	0.492	S	S	.	.	H	α-helix	trans	-63.6	-50.6	172.7	180	-75.7	0	0	0	109.5	A66 Q67 E68 E72 Y73 W74	A66-N70 WeakPolarHBondContact O-CA 3.5Å; A66-N70 WeakPolarHBondContact O-CB 3.36Å; A66-N70 PolarHBondContact O-N 3.17Å; Q67-N70 PolarHBondContact O-N 3.29Å; E68-N70 VanDerWaalsContact C-N 3.33Å; E68-N70 PolarHBondContact O-N 3.42Å; N70-E72 PolarHBondContact O-N 2.83Å; N70-Y73 CarbonylContact O-C 3.59Å; N70-Y73 WeakPolarHBondContact O-CB 3.32Å; N70-Y73 PolarHBondContact O-N 3.49Å; N70-Y73 VanDerWaalsContact O-N 3.12Å; N70-W74 VanDerWaalsContact CG-CD1 3.46Å; N70-W74 PolarHBondContact ND2-NE1 3.38Å; N70-W74 PolarHBondContact O-N 3.45Å; N70-W74 PolarHBondContact OD1-NE1 3.02Å
71	M	60.3	Low	67	Low	99 Å²	99	96.3 Å²	96.3	49%	0.488	50%	0.502	S	S	.	.	H	α-helix	trans	-61.1	-43.3	176.8	-73.3	-174.8	-62.1	0	0	112.6	Q67 E68 Y73 W74 L75	Q67-M71 HydrophobicContact CB-CE 4.48Å; Q67-M71 VanDerWaalsContact O-CB 3.3Å; Q67-M71 WeakPolarHBondContact O-CB 3.35Å; Q67-M71 WeakPolarHBondContact O-CG 3.48Å; Q67-M71 PolarHBondContact O-N 2.9Å; E68-M71 HydrophobicContact CG-CE 4.43Å; E68-M71 PolarHBondContact O-N 3.33Å; M71-Y73 VanDerWaalsContact C-N 3.29Å; M71-Y73 PolarHBondContact O-N 2.96Å; M71-W74 PolarHBondContact O-N 3.07Å; M71-L75 WeakPolarHBondContact O-CB 3.4Å; M71-L75 WeakPolarHBondContact O-CD1 3.48Å; M71-L75 VanDerWaalsContact O-CG 3.3Å; M71-L75 WeakPolarHBondContact O-CG 3.39Å; M71-L75 PolarHBondContact O-N 3.48Å
72	E	60.8	Low	65.3	Low	144 Å²	144	105 Å²	105	67%	0.673	53%	0.527	S	S	*	.	H	α-helix	trans	-60.7	-39.3	173.9	-74	177.4	176.5	0	0	111.5	E68 N70 N76	E68-E72 WeakPolarHBondContact O-CB 3.36Å; E68-E72 VanDerWaalsContact O-CG 3.28Å; E68-E72 WeakPolarHBondContact O-CG 3.17Å; E68-E72 PolarHBondContact O-N 3.33Å; N70-E72 PolarHBondContact O-N 2.83Å; E72-N76 VanDerWaalsContact O-CB 3.23Å; E72-N76 WeakPolarHBondContact O-CB 3.23Å; E72-N76 PolarHBondContact O-N 2.84Å; E72-N76 VanDerWaalsContact O-N 3.15Å
73	Y	61	Low	63.9	Low	113 Å²	113	101.8 Å²	101.8	44%	0.443	51%	0.511	S	S	.	.	H	α-helix	trans	-73.4	-37.5	178.8	-171.8	-108.4	0	0	0	113.2	S69 N70 M71 C79 C83	S69-Y73 WeakPolarHBondContact O-CB 3.34Å; S69-Y73 PolarHBondContact O-N 2.85Å; N70-Y73 CarbonylContact O-C 3.59Å; N70-Y73 WeakPolarHBondContact O-CB 3.32Å; N70-Y73 PolarHBondContact O-N 3.49Å; N70-Y73 VanDerWaalsContact O-N 3.12Å; M71-Y73 VanDerWaalsContact C-N 3.29Å; M71-Y73 PolarHBondContact O-N 2.96Å; Y73-C79 WeakPolarHBondContact CD2-SG 3.5Å; Y73-C79 WeakPolarHBondContact O-CB 3.4Å; Y73-C79 PolarHBondContact O-SG 2.97Å; Y73-C83 HydrophobicContact CD1-CB 3.69Å; Y73-C83 HydrophobicContact CE1-CB 3.33Å; Y73-C83 WeakPolarHBondContact CE1-SG 3.19Å; Y73-C83 HydrophobicContact CG-CB 4.48Å; Y73-C83 PolarHBondContact OH-SG 3.37Å
74	W	60	Low	62.6	Low	76 Å²	76	100.1 Å²	100.1	29%	0.288	50%	0.502	S	S	.	.	H	α-helix	trans	-79	-25.5	177.3	-59.7	113.3	0	0	0	113.1	N70 M71 C83 D84 R85	N70-W74 VanDerWaalsContact CG-CD1 3.46Å; N70-W74 PolarHBondContact ND2-NE1 3.38Å; N70-W74 PolarHBondContact O-N 3.45Å; N70-W74 PolarHBondContact OD1-NE1 3.02Å; M71-W74 PolarHBondContact O-N 3.07Å; W74-C83 WeakPolarHBondContact CZ3-O 3.3Å; W74-D84 VanDerWaalsContact CE3-CA 3.46Å; W74-D84 VanDerWaalsContact CZ3-N 3.27Å; W74-D84 VanDerWaalsContact CZ3-O 3.24Å; W74-D84 WeakPolarHBondContact CZ3-O 3.33Å; W74-R85 HydrophobicContact CD2-CB 4.05Å; W74-R85 VanDerWaalsContact CE3-CA 3.44Å; W74-R85 HydrophobicContact CE3-CB 3.79Å; W74-R85 VanDerWaalsContact CZ3-CA 3.44Å; W74-R85 HydrophobicContact CZ3-CB 4.21Å
75	L	57.3	Low	61.2	Low	142 Å²	142	105 Å²	105	74%	0.743	52%	0.516	S	S	*	.	H	α-helix	trans	-94.2	-3.1	178.5	-67.6	166.2	0	0	0	113.1	M71 P77	M71-L75 WeakPolarHBondContact O-CB 3.4Å; M71-L75 WeakPolarHBondContact O-CD1 3.48Å; M71-L75 VanDerWaalsContact O-CG 3.3Å; M71-L75 WeakPolarHBondContact O-CG 3.39Å; M71-L75 PolarHBondContact O-N 3.48Å; L75-P77 VanDerWaalsContact O-CD 3.27Å; L75-P77 WeakPolarHBondContact O-CD 3.28Å
76	N	56.9	Low	60.4	Low	69 Å²	69	104 Å²	104	37%	0.369	52%	0.523	S	S	.	.			trans	-79.2	114.9	177.2	-179.6	11.9	0	0	0	110.8	E72 H78 C79	E72-N76 VanDerWaalsContact O-CB 3.23Å; E72-N76 WeakPolarHBondContact O-CB 3.23Å; E72-N76 PolarHBondContact O-N 2.84Å; E72-N76 VanDerWaalsContact O-N 3.15Å; N76-H78 PolarHBondContact O-N 3.43Å; N76-H78 PolarHBondContact OD1-N 2.92Å; N76-H78 VanDerWaalsContact OD1-N 3.11Å; N76-C79 HydrophobicContact CB-CB 4.29Å; N76-C79 PolarHBondContact ND2-SG 2.66Å; N76-C79 VanDerWaalsContact ND2-SG 3.43Å; N76-C79 WeakPolarHBondContact O-CB 3.21Å; N76-C79 PolarHBondContact O-N 2.96Å
77	P	58.3	Low	59.4	Low	118 Å²	118	110.3 Å²	110.3	77%	0.766	54%	0.537	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.7	-6.5	-179.8	26.9	-33.1	0	0	0	114	L75	L75-P77 VanDerWaalsContact O-CD 3.27Å; L75-P77 WeakPolarHBondContact O-CD 3.28Å
78	H	63.6	Low	58.5	Low	165 Å²	165	106.3 Å²	106.3	76%	0.764	53%	0.529	S	S	*	.	T	Hydrogen-bonded Turn	trans	-102.8	5.1	174.5	-63.4	-64.4	0	0	0	114.1	N76	N76-H78 PolarHBondContact O-N 3.43Å; N76-H78 PolarHBondContact OD1-N 2.92Å; N76-H78 VanDerWaalsContact OD1-N 3.11Å
79	C	57.6	Low	57.4	Low	31 Å²	31	109.9 Å²	109.9	21%	0.209	55%	0.545	C	S	.	.	S	Bend	trans	-74.8	140.9	177.1	-89.5	0	0	0	0	112	Y73 N76 C83	Y73-C79 WeakPolarHBondContact CD2-SG 3.5Å; Y73-C79 WeakPolarHBondContact O-CB 3.4Å; Y73-C79 PolarHBondContact O-SG 2.97Å; N76-C79 HydrophobicContact CB-CB 4.29Å; N76-C79 PolarHBondContact ND2-SG 2.66Å; N76-C79 VanDerWaalsContact ND2-SG 3.43Å; N76-C79 WeakPolarHBondContact O-CB 3.21Å; N76-C79 PolarHBondContact O-N 2.96Å; C79-C83 HydrophobicContact CB-CB 3.65Å
80	P	58.3	Low	56.6	Low	75 Å²	75	112.7 Å²	112.7	49%	0.487	56%	0.562	S	S	.	*			trans	-62.4	159	178.4	20.5	-27	0	0	0	112	R82 C83	P80-R82 PolarHBondContact O-N 3.11Å; P80-C83 WeakPolarHBondContact O-CB 3.3Å; P80-C83 PolarHBondContact O-N 3.05Å; P80-C83 PolarHBondContact O-SG 3.15Å
81	P	55.6	Low	55.8	Low	114 Å²	114	119.1 Å²	119.1	74%	0.74	60%	0.603	S	S	*	*	G	3₁₀ helix	trans	-64.6	-5	-168.4	23.9	-34.9	0	0	0	116	C83	P81-C83 PolarHBondContact O-N 3.09Å
82	R	52.9	Low	55.5	Low	220 Å²	220	120.1 Å²	120.1	83%	0.83	61%	0.609	S	S	*	*	G	3₁₀ helix	trans	-80	2.4	172.2	-57	-175.7	-161.1	-92.1	0.4	112.7	P80	P80-R82 PolarHBondContact O-N 3.11Å
83	C	53.4	Low	55.3	Low	7 Å²	7	118.8 Å²	118.8	5%	0.047	61%	0.605	C	S	.	*	G	3₁₀ helix	trans	-122.4	20.8	-169.6	-40.6	0	0	0	0	110.9	Y73 W74 C79 P80 P81	Y73-C83 HydrophobicContact CD1-CB 3.69Å; Y73-C83 HydrophobicContact CE1-CB 3.33Å; Y73-C83 WeakPolarHBondContact CE1-SG 3.19Å; Y73-C83 HydrophobicContact CG-CB 4.48Å; Y73-C83 PolarHBondContact OH-SG 3.37Å; W74-C83 WeakPolarHBondContact CZ3-O 3.3Å; C79-C83 HydrophobicContact CB-CB 3.65Å; P80-C83 WeakPolarHBondContact O-CB 3.3Å; P80-C83 PolarHBondContact O-N 3.05Å; P80-C83 PolarHBondContact O-SG 3.15Å; P81-C83 PolarHBondContact O-N 3.09Å
84	D	55.3	Low	54.9	Low	60 Å²	60	119.2 Å²	119.2	32%	0.321	61%	0.614	S	S	.	*			trans	-102.6	124.8	162	-177.1	-14.7	0	0	0	109.6	W74 N86 Y87 G88	W74-D84 VanDerWaalsContact CE3-CA 3.46Å; W74-D84 VanDerWaalsContact CZ3-N 3.27Å; W74-D84 VanDerWaalsContact CZ3-O 3.24Å; W74-D84 WeakPolarHBondContact CZ3-O 3.33Å; D84-N86 PolarHBondContact O-N 2.92Å; D84-N86 VanDerWaalsContact O-N 3.08Å; D84-N86 WeakPolarHBondContact OD1-CB 3.49Å; D84-N86 PolarHBondContact OD1-N 2.79Å; D84-N86 PolarHBondContact OD1-ND2 3.22Å; D84-Y87 HydrophobicContact CB-CD2 4.01Å; D84-Y87 PolarHBondContact O-N 3.44Å; D84-Y87 VanDerWaalsContact OD2-CD2 3.32Å; D84-Y87 WeakPolarHBondContact OD2-CD2 3.27Å; D84-G88 PolarHBondContact O-N 2.77Å; D84-G88 VanDerWaalsContact O-N 3.13Å
85	R	52.3	Low	54.7	Low	200 Å²	200	121.7 Å²	121.7	76%	0.755	63%	0.634	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.3	-20.6	-171.6	-168	179.8	111	-179.1	2.8	110.5	W74	W74-R85 HydrophobicContact CD2-CB 4.05Å; W74-R85 VanDerWaalsContact CE3-CA 3.44Å; W74-R85 HydrophobicContact CE3-CB 3.79Å; W74-R85 VanDerWaalsContact CZ3-CA 3.44Å; W74-R85 HydrophobicContact CZ3-CB 4.21Å
86	N	57.8	Low	54.5	Low	138 Å²	138	120.4 Å²	120.4	74%	0.738	63%	0.627	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.5	-14.9	176.8	-54.9	-56.7	0	0	0	113.4	D84	D84-N86 PolarHBondContact O-N 2.92Å; D84-N86 VanDerWaalsContact O-N 3.08Å; D84-N86 WeakPolarHBondContact OD1-CB 3.49Å; D84-N86 PolarHBondContact OD1-N 2.79Å; D84-N86 PolarHBondContact OD1-ND2 3.22Å
87	Y	54.6	Low	54.3	Low	182 Å²	182	123.9 Å²	123.9	71%	0.714	64%	0.644	S	S	*	*	T	Hydrogen-bonded Turn	trans	-116.7	-8.1	-176.8	-75.5	-87.7	0	0	0	114.4	D84	D84-Y87 HydrophobicContact CB-CD2 4.01Å; D84-Y87 PolarHBondContact O-N 3.44Å; D84-Y87 VanDerWaalsContact OD2-CD2 3.32Å; D84-Y87 WeakPolarHBondContact OD2-CD2 3.27Å
88	G	52.2	Low	54	Low	38 Å²	38	124.3 Å²	124.3	39%	0.392	64%	0.635	S	S	.	*	P	Polyproline II helix	trans	-80.7	117.5	174.1	0	0	0	0	0	112	D84	D84-G88 PolarHBondContact O-N 2.77Å; D84-G88 VanDerWaalsContact O-N 3.13Å
89	H	46.8	Very low	53.3	Low	175 Å²	175	121.2 Å²	121.2	81%	0.81	63%	0.625	S	S	*	*	P	Polyproline II helix	trans	-63.9	134.9	163.8	-81.4	-65.8	0	0	0	109.5	V91	H89-V91 PolarHBondContact O-N 2.85Å
90	P	48.1	Very low	53	Low	123 Å²	123	128.7 Å²	128.7	80%	0.799	66%	0.66	S	S	*	*	P	Polyproline II helix	trans	-63.9	130.2	172	27.3	-31.6	0	0	0	108.7
91	V	48.3	Very low	52.5	Low	212 Å²	212	133.5 Å²	133.5	100%	1.285	68%	0.676	S	S	*	*			trans	-91.6	0	166.9	-166.3	0	0	0	0	108.1	H89	H89-V91 PolarHBondContact O-N 2.85Å

Retrieved 91 of 91 residues in 415.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).