A0A087YGM3_POEFO Loading...

Basic leucine zipper transcription factor, ATF-like 3

AlphaFold DB , UniProt , Accession A0A087YGM3, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 114 aa.

						>A0A087YGM3_POEFO|A0A087YGM3
MSDPSSQQQPGRAAHLGGGWTGLKDEGRRMKRREKNRVAAQKSRKRQTQRADQLHQACELLEQRNRKLKREVDSLSEEQNFLSEALRAHEPFCPIMHCSFASSSLQPDAAARSV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.2	Very low	52.3	Low	232 Å²	232	143 Å²	143	100%	1.143	83%	0.829	S	S	*	*				0	84.3	0	-62.8	-170.6	150.4	0	0	105.5
2	S	43.3	Very low	52.2	Low	109 Å²	109	151.6 Å²	151.6	76%	0.762	84%	0.837	S	S	*	*				67.2	118.1	92.9	-48.3	0	0	0	0	109.9
3	D	52.9	Low	51.7	Low	150 Å²	150	147.4 Å²	147.4	80%	0.802	83%	0.834	S	S	*	*			cis	-155.1	158.7	17.6	-94	-48.2	0	0	0	110.6
4	P	55.8	Low	52	Low	110 Å²	110	142.9 Å²	142.9	71%	0.714	83%	0.825	S	S	*	*			trans	-85.4	109.1	170.9	33.3	-26.6	0	0	0	110	S6	P4-S6 VanDerWaalsContact C-N 3.33Å; P4-S6 PolarHBondContact O-N 3.44Å
5	S	52.5	Low	52.6	Low	127 Å²	127	145 Å²	145	89%	0.888	82%	0.824	S	S	*	*			trans	-73.2	92.5	170.6	-95	0	0	0	0	110.4	Q7	S5-Q7 PolarHBondContact O-N 3.33Å; S5-Q7 VanDerWaalsContact O-N 3.1Å
6	S	57.8	Low	52.7	Low	109 Å²	109	146.6 Å²	146.6	76%	0.762	83%	0.828	S	S	*	*			trans	-36.6	107.3	159.5	-68.8	0	0	0	0	111.8	P4 Q8	P4-S6 VanDerWaalsContact C-N 3.33Å; P4-S6 PolarHBondContact O-N 3.44Å; S6-Q8 VanDerWaalsContact C-N 3.33Å; S6-Q8 PolarHBondContact O-N 3.11Å
7	Q	62	Low	52.4	Low	192 Å²	192	142.8 Å²	142.8	90%	0.897	83%	0.829	S	S	*	*			trans	-70.2	98.3	163.1	-167.1	166.3	82.1	0	0	107.2	S5 Q9	S5-Q7 PolarHBondContact O-N 3.33Å; S5-Q7 VanDerWaalsContact O-N 3.1Å; Q7-Q9 PolarHBondContact O-N 3.38Å; Q7-Q9 VanDerWaalsContact O-N 3.12Å
8	Q	57.4	Low	52.3	Low	176 Å²	176	136 Å²	136	82%	0.822	80%	0.795	S	S	*	*			trans	-61.3	109.7	176.9	-165.1	146.8	72.7	0	0	108.5	S6 P10	S6-Q8 VanDerWaalsContact C-N 3.33Å; S6-Q8 PolarHBondContact O-N 3.11Å; Q8-P10 WeakPolarHBondContact O-CD 3.43Å
9	Q	52.8	Low	52.3	Low	177 Å²	177	132.1 Å²	132.1	83%	0.827	79%	0.786	S	S	*	*			trans	-62.3	124.6	163.6	-68.1	-169.7	-4.5	0	0	107.1	Q7 G11	Q7-Q9 PolarHBondContact O-N 3.38Å; Q7-Q9 VanDerWaalsContact O-N 3.12Å; Q9-G11 PolarHBondContact O-N 3.25Å
10	P	49.5	Very low	52.5	Low	123 Å²	123	137 Å²	137	80%	0.799	79%	0.79	S	S	*	*			trans	-63.9	115.6	168.2	25.5	-28.8	0	0	0	106.4	Q8 R12	Q8-P10 WeakPolarHBondContact O-CD 3.43Å; P10-R12 PolarHBondContact O-N 3.47Å
11	G	47.1	Very low	52.8	Low	68 Å²	68	135 Å²	135	70%	0.701	78%	0.781	S	S	*	*			trans	-47.9	125.6	176.7	0	0	0	0	0	109.1	Q9 A13	Q9-G11 PolarHBondContact O-N 3.25Å; G11-A13 PolarHBondContact O-N 3.13Å
12	R	51.5	Low	53.8	Low	246 Å²	246	125.6 Å²	125.6	93%	0.928	74%	0.744	S	S	*	*			trans	-56.2	97.7	164.6	-73	173.2	115.4	-136	5.1	106	P10 A14	P10-R12 PolarHBondContact O-N 3.47Å; R12-A14 PolarHBondContact O-N 3.19Å
13	A	45	Very low	54.8	Low	97 Å²	97	127.2 Å²	127.2	80%	0.802	74%	0.743	S	S	*	*			trans	-55.1	109.9	173.8	0	0	0	0	0	107	G11 H15	G11-A13 PolarHBondContact O-N 3.13Å; A13-H15 PolarHBondContact O-N 2.89Å
14	A	56.4	Low	55.6	Low	85 Å²	85	127.3 Å²	127.3	70%	0.702	74%	0.736	S	S	*	*			trans	-60.3	113.7	173.2	0	0	0	0	0	107.9	R12 L16	R12-A14 PolarHBondContact O-N 3.19Å; A14-L16 PolarHBondContact O-N 2.78Å
15	H	61.6	Low	56.8	Low	174 Å²	174	126.1 Å²	126.1	81%	0.806	72%	0.724	S	S	*	*			trans	-28.2	95.8	165.5	-132.6	-71.6	0	0	0	114	A13	A13-H15 PolarHBondContact O-N 2.89Å
16	L	53.2	Low	58.4	Low	171 Å²	171	124.9 Å²	124.9	90%	0.895	70%	0.704	S	S	*	*			trans	-139.8	51.5	175.5	-68.5	175.7	0	0	0	112.9	A14	A14-L16 PolarHBondContact O-N 2.78Å
17	G	47.8	Very low	60	Low	82 Å²	82	121.3 Å²	121.3	85%	0.845	68%	0.684	S	S	*	*	S	Bend	trans	-141.1	6	168.7	0	0	0	0	0	115.1
18	G	51.6	Low	61.5	Low	20 Å²	20	119.1 Å²	119.1	21%	0.206	67%	0.668	C	S	.	*			trans	-117.7	14	-161.8	0	0	0	0	0	117.2	W20 T21 G22	G18-W20 PolarHBondContact O-N 3.18Å; G18-T21 WeakPolarHBondContact CA-OG1 3.43Å; G18-T21 PolarHBondContact O-N 3.16Å; G18-T21 PolarHBondContact O-OG1 3.5Å; G18-T21 VanDerWaalsContact O-OG1 3.1Å; G18-G22 PolarHBondContact O-N 3.13Å
19	G	51.8	Low	63.2	Low	62 Å²	62	116.5 Å²	116.5	64%	0.639	65%	0.651	S	S	*	*	H	α-helix	trans	-56.6	-36.8	-173.8	0	0	0	0	0	113.9	L23	G19-L23 PolarHBondContact O-N 3.24Å
20	W	55.9	Low	65.2	Low	229 Å²	229	114.9 Å²	114.9	87%	0.867	65%	0.645	S	S	*	*	H	α-helix	trans	-84.8	-30.5	-179.8	-70.4	87.3	0	0	0	114	G18 K24	G18-W20 PolarHBondContact O-N 3.18Å; W20-K24 PolarHBondContact O-N 3.13Å
21	T	59.3	Low	67.4	Low	95 Å²	95	116.3 Å²	116.3	58%	0.583	64%	0.638	S	S	*	*	H	α-helix	trans	-76.5	-38.3	176	39.3	0	0	0	0	111.5	G18 K24 D25	G18-T21 WeakPolarHBondContact CA-OG1 3.43Å; G18-T21 PolarHBondContact O-N 3.16Å; G18-T21 PolarHBondContact O-OG1 3.5Å; G18-T21 VanDerWaalsContact O-OG1 3.1Å; T21-K24 PolarHBondContact O-N 3.13Å; T21-D25 VanDerWaalsContact O-CB 3.27Å; T21-D25 WeakPolarHBondContact O-CB 3.19Å; T21-D25 PolarHBondContact O-N 3.15Å
22	G	64.2	Low	69.8	Low	36 Å²	36	122.7 Å²	122.7	37%	0.371	64%	0.641	S	S	.	*	H	α-helix	trans	-63.4	-41.1	175.2	0	0	0	0	0	113.3	G18 D25 E26	G18-G22 PolarHBondContact O-N 3.13Å; G22-D25 PolarHBondContact O-N 2.91Å; G22-E26 WeakPolarHBondContact O-CG 3.41Å; G22-E26 PolarHBondContact O-N 2.95Å
23	L	65.2	Low	72	Confident	143 Å²	143	118.2 Å²	118.2	75%	0.749	63%	0.625	S	S	*	*	H	α-helix	trans	-68.3	-41.6	178.1	-147.7	83.8	0	0	0	112.5	G19 D25 E26 G27	G19-L23 PolarHBondContact O-N 3.24Å; L23-D25 VanDerWaalsContact C-N 3.26Å; L23-D25 PolarHBondContact O-N 3.43Å; L23-E26 PolarHBondContact O-N 3.45Å; L23-G27 PolarHBondContact O-N 2.85Å; L23-G27 VanDerWaalsContact O-N 3.1Å
24	K	69.5	Low	74.5	Confident	152 Å²	152	117.9 Å²	117.9	66%	0.661	61%	0.606	S	S	*	*	H	α-helix	trans	-63.1	-33.9	171.3	-81.9	-174.9	176	-178.5	0	111.8	W20 T21 R28	W20-K24 PolarHBondContact O-N 3.13Å; T21-K24 PolarHBondContact O-N 3.13Å; K24-R28 PolarHBondContact O-N 2.84Å; K24-R28 VanDerWaalsContact O-N 3.15Å
25	D	79.9	Confident	76.5	Confident	85 Å²	85	121.4 Å²	121.4	46%	0.455	61%	0.606	S	S	.	*	H	α-helix	trans	-73.8	-39.4	179.1	-151.2	45	0	0	0	112.9	T21 G22 L23 G27 R28 R29	T21-D25 VanDerWaalsContact O-CB 3.27Å; T21-D25 WeakPolarHBondContact O-CB 3.19Å; T21-D25 PolarHBondContact O-N 3.15Å; G22-D25 PolarHBondContact O-N 2.91Å; L23-D25 VanDerWaalsContact C-N 3.26Å; L23-D25 PolarHBondContact O-N 3.43Å; D25-G27 VanDerWaalsContact C-N 3.33Å; D25-G27 PolarHBondContact O-N 3.42Å; D25-R28 PolarHBondContact O-N 3.28Å; D25-R28 VanDerWaalsContact O-N 3.17Å; D25-R28 IonicContact OD1-CZ 3.45Å; D25-R28 IonicContact OD1-NE 2.82Å; D25-R28 PolarHBondContact OD1-NE 3.37Å; D25-R28 IonicContact OD1-NH2 3.39Å; D25-R28 PolarHBondContact OD1-NH2 2.7Å; D25-R29 WeakPolarHBondContact O-CB 3.5Å; D25-R29 PolarHBondContact O-N 3.46Å
26	E	87.1	Confident	78.2	Confident	100 Å²	100	118.4 Å²	118.4	47%	0.467	60%	0.596	S	S	.	*	H	α-helix	trans	-62.6	-38.8	171.4	-76.1	-59.5	139.4	0	0	111.8	G22 L23 R28 R29 M30	G22-E26 WeakPolarHBondContact O-CG 3.41Å; G22-E26 PolarHBondContact O-N 2.95Å; L23-E26 PolarHBondContact O-N 3.45Å; E26-R28 PolarHBondContact O-N 2.95Å; E26-R29 WeakPolarHBondContact O-CB 3.45Å; E26-R29 PolarHBondContact O-N 3.05Å; E26-R29 IonicContact OE1-NH1 3.73Å; E26-R29 PolarHBondContact OE1-NH1 3.45Å; E26-R29 IonicContact OE2-NH1 3.86Å; E26-M30 WeakPolarHBondContact O-CB 3.36Å; E26-M30 PolarHBondContact O-N 2.86Å
27	G	91.4	Very high	80.4	Confident	34 Å²	34	116.5 Å²	116.5	35%	0.351	58%	0.577	S	S	.	*	H	α-helix	trans	-61.2	-40.4	171.8	0	0	0	0	0	113.5	L23 D25 K31	L23-G27 PolarHBondContact O-N 2.85Å; L23-G27 VanDerWaalsContact O-N 3.1Å; D25-G27 VanDerWaalsContact C-N 3.33Å; D25-G27 PolarHBondContact O-N 3.42Å; G27-K31 WeakPolarHBondContact O-CG 3.5Å; G27-K31 PolarHBondContact O-N 2.94Å; G27-K31 VanDerWaalsContact O-N 3.12Å
28	R	92.8	Very high	82.8	Confident	146 Å²	146	116 Å²	116	55%	0.551	56%	0.557	S	S	*	*	H	α-helix	trans	-67.8	-41	173.7	-74.7	-173.3	-68	-115	-0.5	111.8	K24 D25 E26 K31 R32	K24-R28 PolarHBondContact O-N 2.84Å; K24-R28 VanDerWaalsContact O-N 3.15Å; D25-R28 PolarHBondContact O-N 3.28Å; D25-R28 VanDerWaalsContact O-N 3.17Å; D25-R28 IonicContact OD1-CZ 3.45Å; D25-R28 IonicContact OD1-NE 2.82Å; D25-R28 PolarHBondContact OD1-NE 3.37Å; D25-R28 IonicContact OD1-NH2 3.39Å; D25-R28 PolarHBondContact OD1-NH2 2.7Å; E26-R28 PolarHBondContact O-N 2.95Å; R28-K31 PolarHBondContact O-N 3.35Å; R28-R32 WeakPolarHBondContact O-CB 3.1Å; R28-R32 PolarHBondContact O-N 2.93Å
29	R	94.1	Very high	85	Confident	121 Å²	121	117.7 Å²	117.7	46%	0.457	57%	0.569	S	S	.	*	H	α-helix	trans	-61.8	-44.6	177.3	-169.5	-177.8	-172.2	-167.3	0.8	111.3	D25 E26 R32 R33	D25-R29 WeakPolarHBondContact O-CB 3.5Å; D25-R29 PolarHBondContact O-N 3.46Å; E26-R29 WeakPolarHBondContact O-CB 3.45Å; E26-R29 PolarHBondContact O-N 3.05Å; E26-R29 IonicContact OE1-NH1 3.73Å; E26-R29 PolarHBondContact OE1-NH1 3.45Å; E26-R29 IonicContact OE2-NH1 3.86Å; R29-R32 WeakPolarHBondContact O-CB 3.49Å; R29-R32 PolarHBondContact O-N 3.06Å; R29-R33 VanDerWaalsContact CZ-NH2 3.31Å; R29-R33 VanDerWaalsContact NH2-NH2 3.14Å; R29-R33 WeakPolarHBondContact O-CG 3.49Å; R29-R33 PolarHBondContact O-N 3.24Å
30	M	94.4	Very high	87.3	Confident	144 Å²	144	116 Å²	116	71%	0.709	55%	0.549	S	S	*	.	H	α-helix	trans	-61.7	-47.5	175.9	-166	-175.6	-131.6	0	0	111.2	E26 R32 R33 E34	E26-M30 WeakPolarHBondContact O-CB 3.36Å; E26-M30 PolarHBondContact O-N 2.86Å; M30-R32 VanDerWaalsContact C-N 3.29Å; M30-R32 PolarHBondContact O-N 3.46Å; M30-R33 PolarHBondContact O-N 2.92Å; M30-E34 PolarHBondContact O-N 2.93Å
31	K	95.9	Very high	89.3	Confident	152 Å²	152	110.5 Å²	110.5	66%	0.661	53%	0.533	S	S	*	.	H	α-helix	trans	-58.6	-38.7	174.5	-73.5	176.5	-176.6	-178.2	0	112.5	G27 R28 K35	G27-K31 WeakPolarHBondContact O-CG 3.5Å; G27-K31 PolarHBondContact O-N 2.94Å; G27-K31 VanDerWaalsContact O-N 3.12Å; R28-K31 PolarHBondContact O-N 3.35Å; K31-K35 VanDerWaalsContact O-CG 3.32Å; K31-K35 WeakPolarHBondContact O-CG 3.45Å; K31-K35 PolarHBondContact O-N 3.35Å
32	R	97	Very high	91.2	Very high	202 Å²	202	111.8 Å²	111.8	76%	0.762	53%	0.531	S	S	*	.	H	α-helix	trans	-67.4	-44.1	177.4	-165.2	-175.6	-142.4	167.5	6.5	111.9	R28 R29 M30 E34 K35 N36	R28-R32 WeakPolarHBondContact O-CB 3.1Å; R28-R32 PolarHBondContact O-N 2.93Å; R29-R32 WeakPolarHBondContact O-CB 3.49Å; R29-R32 PolarHBondContact O-N 3.06Å; M30-R32 VanDerWaalsContact C-N 3.29Å; M30-R32 PolarHBondContact O-N 3.46Å; R32-E34 VanDerWaalsContact C-N 3.34Å; R32-K35 PolarHBondContact O-N 3.43Å; R32-N36 WeakPolarHBondContact O-CB 3.27Å; R32-N36 PolarHBondContact O-N 2.91Å
33	R	97.6	Very high	92.8	Very high	153 Å²	153	113.4 Å²	113.4	58%	0.577	54%	0.537	S	S	*	.	H	α-helix	trans	-61.2	-43.9	176	-73.9	178.2	179.9	-159.6	0.9	111.1	R29 M30 N36 R37	R29-R33 VanDerWaalsContact CZ-NH2 3.31Å; R29-R33 VanDerWaalsContact NH2-NH2 3.14Å; R29-R33 WeakPolarHBondContact O-CG 3.49Å; R29-R33 PolarHBondContact O-N 3.24Å; M30-R33 PolarHBondContact O-N 2.92Å; R33-N36 PolarHBondContact O-N 3.49Å; R33-R37 WeakPolarHBondContact O-CB 3.33Å; R33-R37 PolarHBondContact O-N 3.04Å
34	E	97.8	Very high	94.4	Very high	89 Å²	89	113.7 Å²	113.7	42%	0.416	53%	0.528	S	S	.	.	H	α-helix	trans	-64.5	-44.1	178.8	-176	55.9	-161.2	0	0	111.9	M30 R32 N36 R37 V38	M30-E34 PolarHBondContact O-N 2.93Å; R32-E34 VanDerWaalsContact C-N 3.34Å; E34-N36 VanDerWaalsContact C-N 3.35Å; E34-N36 PolarHBondContact O-N 2.86Å; E34-R37 WeakPolarHBondContact O-CB 3.4Å; E34-R37 PolarHBondContact O-N 3.45Å; E34-R37 IonicContact OE1-CZ 3.53Å; E34-R37 IonicContact OE1-NE 2.88Å; E34-R37 PolarHBondContact OE1-NE 2.9Å; E34-R37 IonicContact OE1-NH2 2.69Å; E34-R37 PolarHBondContact OE1-NH2 2.92Å; E34-R37 IonicContact OE2-CZ 2.96Å; E34-R37 IonicContact OE2-NE 3.26Å; E34-R37 PolarHBondContact OE2-NE 3.16Å; E34-R37 IonicContact OE2-NH2 3.59Å; E34-V38 WeakPolarHBondContact O-CG2 3.35Å; E34-V38 PolarHBondContact O-N 3.35Å
35	K	98.3	Very high	95.8	Very high	160 Å²	160	112.8 Å²	112.8	70%	0.696	52%	0.524	S	S	*	.	H	α-helix	trans	-58.8	-44.2	172.7	-73.7	177.3	-179	-172.9	0	112.3	K31 R32 V38 A39	K31-K35 VanDerWaalsContact O-CG 3.32Å; K31-K35 WeakPolarHBondContact O-CG 3.45Å; K31-K35 PolarHBondContact O-N 3.35Å; R32-K35 PolarHBondContact O-N 3.43Å; K35-V38 PolarHBondContact O-N 2.7Å; K35-A39 WeakPolarHBondContact O-CB 3.37Å; K35-A39 PolarHBondContact O-N 3.46Å
36	N	98.1	Very high	96.7	Very high	111 Å²	111	115.8 Å²	115.8	59%	0.594	53%	0.529	S	S	*	.	H	α-helix	trans	-66.8	-39.2	177.9	-178.7	-95.3	0	0	0	112	R32 R33 E34 V38 A39 A40	R32-N36 WeakPolarHBondContact O-CB 3.27Å; R32-N36 PolarHBondContact O-N 2.91Å; R33-N36 PolarHBondContact O-N 3.49Å; E34-N36 VanDerWaalsContact C-N 3.35Å; E34-N36 PolarHBondContact O-N 2.86Å; N36-V38 VanDerWaalsContact C-N 3.35Å; N36-V38 PolarHBondContact O-N 2.92Å; N36-A39 PolarHBondContact O-N 3.44Å; N36-A40 VanDerWaalsContact O-CB 3.31Å; N36-A40 WeakPolarHBondContact O-CB 3.48Å; N36-A40 PolarHBondContact O-N 3.49Å
37	R	98.5	Very high	97.3	Very high	130 Å²	130	117.7 Å²	117.7	49%	0.491	54%	0.538	S	S	.	.	H	α-helix	trans	-57.1	-48.7	175.5	-171	-174.4	73.5	84.3	1.5	110.9	R33 E34 A40 Q41	R33-R37 WeakPolarHBondContact O-CB 3.33Å; R33-R37 PolarHBondContact O-N 3.04Å; E34-R37 WeakPolarHBondContact O-CB 3.4Å; E34-R37 PolarHBondContact O-N 3.45Å; E34-R37 IonicContact OE1-CZ 3.53Å; E34-R37 IonicContact OE1-NE 2.88Å; E34-R37 PolarHBondContact OE1-NE 2.9Å; E34-R37 IonicContact OE1-NH2 2.69Å; E34-R37 PolarHBondContact OE1-NH2 2.92Å; E34-R37 IonicContact OE2-CZ 2.96Å; E34-R37 IonicContact OE2-NE 3.26Å; E34-R37 PolarHBondContact OE2-NE 3.16Å; E34-R37 IonicContact OE2-NH2 3.59Å; R37-A40 PolarHBondContact O-N 2.94Å; R37-Q41 WeakPolarHBondContact O-CB 3.46Å; R37-Q41 PolarHBondContact O-N 3.44Å
38	V	98.5	Very high	97.6	Very high	72 Å²	72	120 Å²	120	44%	0.436	55%	0.545	S	S	.	.	H	α-helix	trans	-64.5	-43.6	176.5	175	0	0	0	0	111.3	E34 K35 N36 A40 Q41 K42	E34-V38 WeakPolarHBondContact O-CG2 3.35Å; E34-V38 PolarHBondContact O-N 3.35Å; K35-V38 PolarHBondContact O-N 2.7Å; N36-V38 VanDerWaalsContact C-N 3.35Å; N36-V38 PolarHBondContact O-N 2.92Å; V38-A40 PolarHBondContact O-N 2.93Å; V38-Q41 PolarHBondContact O-N 2.91Å; V38-K42 WeakPolarHBondContact O-CB 3.31Å; V38-K42 PolarHBondContact O-N 3.28Å
39	A	98.6	Very high	97.9	Very high	56 Å²	56	117.2 Å²	117.2	46%	0.463	54%	0.538	S	S	.	.	H	α-helix	trans	-61.6	-43.2	177.7	0	0	0	0	0	112.1	K35 N36 K42 S43	K35-A39 WeakPolarHBondContact O-CB 3.37Å; K35-A39 PolarHBondContact O-N 3.46Å; N36-A39 PolarHBondContact O-N 3.44Å; A39-K42 PolarHBondContact O-N 3.43Å; A39-S43 WeakPolarHBondContact O-CB 3.48Å; A39-S43 PolarHBondContact O-N 3.22Å
40	A	98.7	Very high	98.1	Very high	27 Å²	27	119.8 Å²	119.8	22%	0.223	55%	0.548	C	S	.	.	H	α-helix	trans	-65.7	-42.2	176.9	0	0	0	0	0	111.7	N36 R37 V38 S43 R44	N36-A40 VanDerWaalsContact O-CB 3.31Å; N36-A40 WeakPolarHBondContact O-CB 3.48Å; N36-A40 PolarHBondContact O-N 3.49Å; R37-A40 PolarHBondContact O-N 2.94Å; V38-A40 PolarHBondContact O-N 2.93Å; A40-S43 PolarHBondContact O-N 3.34Å; A40-R44 WeakPolarHBondContact O-CG 3.42Å; A40-R44 PolarHBondContact O-N 2.92Å
41	Q	98.8	Very high	98.3	Very high	113 Å²	113	115.6 Å²	115.6	53%	0.528	54%	0.536	S	S	.	.	H	α-helix	trans	-62.2	-43.4	174.4	-172.4	179.8	13	0	0	111.5	R37 V38 R44 K45	R37-Q41 WeakPolarHBondContact O-CB 3.46Å; R37-Q41 PolarHBondContact O-N 3.44Å; V38-Q41 PolarHBondContact O-N 2.91Å; Q41-R44 PolarHBondContact O-N 3.23Å; Q41-K45 WeakPolarHBondContact O-CB 3.31Å; Q41-K45 PolarHBondContact O-N 3.34Å
42	K	98.8	Very high	98.5	Very high	121 Å²	121	112.2 Å²	112.2	53%	0.526	53%	0.525	S	S	.	.	H	α-helix	trans	-64.4	-41.6	176.7	-170.5	175.5	-172.9	176.4	0	111.8	V38 A39 K45 R46	V38-K42 WeakPolarHBondContact O-CB 3.31Å; V38-K42 PolarHBondContact O-N 3.28Å; A39-K42 PolarHBondContact O-N 3.43Å; K42-K45 PolarHBondContact O-N 3.09Å; K42-R46 WeakPolarHBondContact O-CG 3.47Å; K42-R46 PolarHBondContact O-N 2.85Å
43	S	98.8	Very high	98.6	Very high	71 Å²	71	108.9 Å²	108.9	50%	0.497	52%	0.518	S	S	.	.	H	α-helix	trans	-61.5	-50.1	176	175.4	0	0	0	0	111.2	A39 A40 K45 R46 Q47	A39-S43 WeakPolarHBondContact O-CB 3.48Å; A39-S43 PolarHBondContact O-N 3.22Å; A40-S43 PolarHBondContact O-N 3.34Å; S43-K45 PolarHBondContact O-N 3.43Å; S43-R46 PolarHBondContact O-N 3.44Å; S43-Q47 PolarHBondContact O-N 3.37Å
44	R	98.8	Very high	98.6	Very high	149 Å²	149	106.4 Å²	106.4	56%	0.562	52%	0.516	S	S	*	.	H	α-helix	trans	-56.4	-47.7	174.6	-74.7	-171.5	-71.3	-95.7	3.6	111.8	A40 Q41 R46 Q47 T48	A40-R44 WeakPolarHBondContact O-CG 3.42Å; A40-R44 PolarHBondContact O-N 2.92Å; Q41-R44 PolarHBondContact O-N 3.23Å; R44-R46 VanDerWaalsContact C-N 3.34Å; R44-R46 PolarHBondContact O-N 3.46Å; R44-Q47 WeakPolarHBondContact O-CB 3.33Å; R44-Q47 PolarHBondContact O-N 2.87Å; R44-Q47 VanDerWaalsContact O-N 3.13Å; R44-T48 PolarHBondContact O-N 2.92Å; R44-T48 PolarHBondContact O-OG1 3.18Å
45	K	98.7	Very high	98.7	Very high	132 Å²	132	107.7 Å²	107.7	57%	0.574	52%	0.522	S	S	*	.	H	α-helix	trans	-58.4	-44.9	177.5	-174.6	175.6	-178.2	176.8	0	112	Q41 K42 S43 Q47 T48 Q49	Q41-K45 WeakPolarHBondContact O-CB 3.31Å; Q41-K45 PolarHBondContact O-N 3.34Å; K42-K45 PolarHBondContact O-N 3.09Å; S43-K45 PolarHBondContact O-N 3.43Å; K45-Q47 VanDerWaalsContact C-N 3.31Å; K45-Q47 PolarHBondContact O-N 3.32Å; K45-T48 PolarHBondContact O-N 2.91Å; K45-Q49 HydrophobicContact CG-CG 4.43Å; K45-Q49 WeakPolarHBondContact O-CB 3.42Å; K45-Q49 VanDerWaalsContact O-CG 3.26Å; K45-Q49 WeakPolarHBondContact O-CG 3.39Å; K45-Q49 PolarHBondContact O-N 3.25Å
46	R	98.8	Very high	98.7	Very high	149 Å²	149	106 Å²	106	56%	0.562	52%	0.516	S	S	*	.	H	α-helix	trans	-63.1	-38.5	177	-73.6	-178.2	-175.2	-75.7	11.2	112	K42 S43 R44 R50	K42-R46 WeakPolarHBondContact O-CG 3.47Å; K42-R46 PolarHBondContact O-N 2.85Å; S43-R46 PolarHBondContact O-N 3.44Å; R44-R46 VanDerWaalsContact C-N 3.34Å; R44-R46 PolarHBondContact O-N 3.46Å; R46-R50 WeakPolarHBondContact O-CB 3.48Å; R46-R50 PolarHBondContact O-N 3.49Å
47	Q	98.8	Very high	98.7	Very high	140 Å²	140	103 Å²	103	65%	0.654	51%	0.507	S	S	*	.	H	α-helix	trans	-65.9	-47.6	177.7	-173.8	173.2	13.4	0	0	111.4	S43 R44 K45 R50 A51	S43-Q47 PolarHBondContact O-N 3.37Å; R44-Q47 WeakPolarHBondContact O-CB 3.33Å; R44-Q47 PolarHBondContact O-N 2.87Å; R44-Q47 VanDerWaalsContact O-N 3.13Å; K45-Q47 VanDerWaalsContact C-N 3.31Å; K45-Q47 PolarHBondContact O-N 3.32Å; Q47-R50 PolarHBondContact O-N 3.37Å; Q47-A51 PolarHBondContact O-N 2.81Å
48	T	98.7	Very high	98.7	Very high	81 Å²	81	100 Å²	100	50%	0.497	51%	0.506	S	S	.	.	H	α-helix	trans	-58.8	-50.2	175	-55.4	0	0	0	0	110.9	R44 K45 R50 A51 D52	R44-T48 PolarHBondContact O-N 2.92Å; R44-T48 PolarHBondContact O-OG1 3.18Å; K45-T48 PolarHBondContact O-N 2.91Å; T48-R50 VanDerWaalsContact C-N 3.27Å; T48-R50 PolarHBondContact O-N 2.91Å; T48-A51 WeakPolarHBondContact O-CA 3.37Å; T48-A51 WeakPolarHBondContact O-CB 3.04Å; T48-A51 PolarHBondContact O-N 2.98Å; T48-D52 PolarHBondContact O-N 3.33Å
49	Q	98.8	Very high	98.8	Very high	88 Å²	88	101.3 Å²	101.3	41%	0.411	51%	0.507	S	S	.	.	H	α-helix	trans	-57.6	-39.6	178.1	-75.1	178.4	-25.7	0	0	112.9	K45 D52 Q53	K45-Q49 HydrophobicContact CG-CG 4.43Å; K45-Q49 WeakPolarHBondContact O-CB 3.42Å; K45-Q49 VanDerWaalsContact O-CG 3.26Å; K45-Q49 WeakPolarHBondContact O-CG 3.39Å; K45-Q49 PolarHBondContact O-N 3.25Å; Q49-D52 PolarHBondContact O-N 2.94Å; Q49-Q53 WeakPolarHBondContact O-CB 3.39Å; Q49-Q53 VanDerWaalsContact O-CG 3.24Å; Q49-Q53 WeakPolarHBondContact O-CG 3.49Å; Q49-Q53 PolarHBondContact O-N 3.12Å
50	R	98.8	Very high	98.8	Very high	175 Å²	175	104 Å²	104	66%	0.66	51%	0.512	S	S	*	.	H	α-helix	trans	-66.1	-41	176.2	-176	177.7	-179.2	175.5	-0	111.5	R46 Q47 T48 L54	R46-R50 WeakPolarHBondContact O-CB 3.48Å; R46-R50 PolarHBondContact O-N 3.49Å; Q47-R50 PolarHBondContact O-N 3.37Å; T48-R50 VanDerWaalsContact C-N 3.27Å; T48-R50 PolarHBondContact O-N 2.91Å; R50-L54 HydrophobicContact CG-CD1 4.17Å; R50-L54 WeakPolarHBondContact O-CB 3.49Å; R50-L54 VanDerWaalsContact O-CG 3.27Å; R50-L54 WeakPolarHBondContact O-CG 3.25Å; R50-L54 PolarHBondContact O-N 3.32Å
51	A	98.8	Very high	98.8	Very high	57 Å²	57	108.2 Å²	108.2	47%	0.471	53%	0.531	S	S	.	.	H	α-helix	trans	-62.7	-44.9	176.1	0	0	0	0	0	111	Q47 T48 Q53 L54 H55	Q47-A51 PolarHBondContact O-N 2.81Å; T48-A51 WeakPolarHBondContact O-CA 3.37Å; T48-A51 WeakPolarHBondContact O-CB 3.04Å; T48-A51 PolarHBondContact O-N 2.98Å; A51-Q53 PolarHBondContact O-N 3.34Å; A51-L54 PolarHBondContact O-N 3Å; A51-H55 WeakPolarHBondContact O-CB 3.38Å; A51-H55 PolarHBondContact O-N 3.49Å
52	D	98.8	Very high	98.8	Very high	80 Å²	80	108 Å²	108	43%	0.428	53%	0.53	S	S	.	.	H	α-helix	trans	-61.6	-45	178.4	-58.6	-25	0	0	0	111.4	T48 Q49 L54 H55 Q56	T48-D52 PolarHBondContact O-N 3.33Å; Q49-D52 PolarHBondContact O-N 2.94Å; D52-L54 PolarHBondContact O-N 3.17Å; D52-H55 PolarHBondContact O-N 2.97Å; D52-Q56 VanDerWaalsContact O-CG 3.3Å; D52-Q56 WeakPolarHBondContact O-CG 3.36Å; D52-Q56 PolarHBondContact O-N 3.48Å
53	Q	98.8	Very high	98.8	Very high	132 Å²	132	108 Å²	108	62%	0.617	53%	0.532	S	S	*	.	H	α-helix	trans	-62	-42.7	177.1	-75.9	173.8	-14	0	0	112.4	Q49 A51 A57	Q49-Q53 WeakPolarHBondContact O-CB 3.39Å; Q49-Q53 VanDerWaalsContact O-CG 3.24Å; Q49-Q53 WeakPolarHBondContact O-CG 3.49Å; Q49-Q53 PolarHBondContact O-N 3.12Å; A51-Q53 PolarHBondContact O-N 3.34Å; Q53-A57 WeakPolarHBondContact O-CB 3.33Å; Q53-A57 PolarHBondContact O-N 3.02Å
54	L	98.9	Very high	98.8	Very high	102 Å²	102	112.7 Å²	112.7	53%	0.534	54%	0.539	S	S	.	.	H	α-helix	trans	-64.7	-42.4	176.8	-73.9	170.3	0	0	0	111.1	R50 A51 D52 A57 C58	R50-L54 HydrophobicContact CG-CD1 4.17Å; R50-L54 WeakPolarHBondContact O-CB 3.49Å; R50-L54 VanDerWaalsContact O-CG 3.27Å; R50-L54 WeakPolarHBondContact O-CG 3.25Å; R50-L54 PolarHBondContact O-N 3.32Å; A51-L54 PolarHBondContact O-N 3Å; D52-L54 PolarHBondContact O-N 3.17Å; L54-A57 PolarHBondContact O-N 2.9Å; L54-C58 PolarHBondContact O-N 2.94Å; L54-C58 PolarHBondContact O-SG 3.24Å; L54-C58 VanDerWaalsContact O-SG 3.33Å
55	H	98.8	Very high	98.8	Very high	116 Å²	116	109.2 Å²	109.2	54%	0.537	53%	0.531	S	S	.	.	H	α-helix	trans	-61.4	-50.6	178	-172.6	62.4	0	0	0	111.5	A51 D52 A57 C58 E59	A51-H55 WeakPolarHBondContact O-CB 3.38Å; A51-H55 PolarHBondContact O-N 3.49Å; D52-H55 PolarHBondContact O-N 2.97Å; H55-A57 VanDerWaalsContact C-N 3.29Å; H55-A57 PolarHBondContact O-N 3.46Å; H55-C58 WeakPolarHBondContact O-CB 3.48Å; H55-C58 PolarHBondContact O-N 3.36Å; H55-C58 VanDerWaalsContact O-N 3.12Å; H55-E59 IonicContact CD2-OE1 3.96Å; H55-E59 IonicContact CD2-OE2 3.85Å; H55-E59 IonicContact CE1-OE1 3.24Å; H55-E59 IonicContact NE2-OE1 3.49Å; H55-E59 PolarHBondContact NE2-OE1 3.35Å; H55-E59 WeakPolarHBondContact O-CG 3.38Å; H55-E59 PolarHBondContact O-N 3.28Å
56	Q	98.8	Very high	98.8	Very high	124 Å²	124	108.5 Å²	108.5	58%	0.579	53%	0.525	S	S	*	.	H	α-helix	trans	-58.3	-41	176.6	-70.7	172.1	10.8	0	0	112.2	D52 E59 L60	D52-Q56 VanDerWaalsContact O-CG 3.3Å; D52-Q56 WeakPolarHBondContact O-CG 3.36Å; D52-Q56 PolarHBondContact O-N 3.48Å; Q56-E59 PolarHBondContact O-N 2.98Å; Q56-L60 WeakPolarHBondContact O-CB 3.3Å; Q56-L60 PolarHBondContact O-N 2.99Å
57	A	98.7	Very high	98.8	Very high	48 Å²	48	108.2 Å²	108.2	40%	0.397	53%	0.528	S	S	.	.	H	α-helix	trans	-64.5	-42.3	176.9	0	0	0	0	0	111.9	Q53 L54 H55 L60 L61	Q53-A57 WeakPolarHBondContact O-CB 3.33Å; Q53-A57 PolarHBondContact O-N 3.02Å; L54-A57 PolarHBondContact O-N 2.9Å; H55-A57 VanDerWaalsContact C-N 3.29Å; H55-A57 PolarHBondContact O-N 3.46Å; A57-L60 PolarHBondContact O-N 3.28Å; A57-L61 WeakPolarHBondContact O-CB 3.4Å; A57-L61 VanDerWaalsContact O-CG 3.26Å; A57-L61 WeakPolarHBondContact O-CG 3.29Å; A57-L61 PolarHBondContact O-N 3.48Å
58	C	98.8	Very high	98.8	Very high	68 Å²	68	105.4 Å²	105.4	46%	0.459	52%	0.517	S	S	.	.	H	α-helix	trans	-60.7	-49.6	174.7	-72.4	0	0	0	0	111.3	L54 H55 L60 L61 E62	L54-C58 PolarHBondContact O-N 2.94Å; L54-C58 PolarHBondContact O-SG 3.24Å; L54-C58 VanDerWaalsContact O-SG 3.33Å; H55-C58 WeakPolarHBondContact O-CB 3.48Å; H55-C58 PolarHBondContact O-N 3.36Å; H55-C58 VanDerWaalsContact O-N 3.12Å; C58-L60 VanDerWaalsContact C-N 3.31Å; C58-L60 PolarHBondContact O-N 3.03Å; C58-L61 PolarHBondContact O-N 3.47Å; C58-E62 WeakPolarHBondContact O-CG 3.36Å; C58-E62 PolarHBondContact O-N 2.98Å
59	E	98.9	Very high	98.8	Very high	98 Å²	98	107.5 Å²	107.5	46%	0.458	52%	0.519	S	S	.	.	H	α-helix	trans	-58.2	-43.5	179.7	-69.5	-178.7	136.8	0	0	112.1	H55 Q56 E62 Q63	H55-E59 IonicContact CD2-OE1 3.96Å; H55-E59 IonicContact CD2-OE2 3.85Å; H55-E59 IonicContact CE1-OE1 3.24Å; H55-E59 IonicContact NE2-OE1 3.49Å; H55-E59 PolarHBondContact NE2-OE1 3.35Å; H55-E59 WeakPolarHBondContact O-CG 3.38Å; H55-E59 PolarHBondContact O-N 3.28Å; Q56-E59 PolarHBondContact O-N 2.98Å; E59-E62 PolarHBondContact O-N 2.89Å; E59-Q63 WeakPolarHBondContact O-CB 3.41Å; E59-Q63 PolarHBondContact O-N 3.24Å
60	L	98.8	Very high	98.8	Very high	112 Å²	112	111.3 Å²	111.3	59%	0.586	53%	0.53	S	S	*	.	H	α-helix	trans	-64.4	-44.3	177.2	-179.4	62.9	0	0	0	111.8	Q56 A57 C58 Q63 R64	Q56-L60 WeakPolarHBondContact O-CB 3.3Å; Q56-L60 PolarHBondContact O-N 2.99Å; A57-L60 PolarHBondContact O-N 3.28Å; C58-L60 VanDerWaalsContact C-N 3.31Å; C58-L60 PolarHBondContact O-N 3.03Å; L60-Q63 PolarHBondContact O-N 2.9Å; L60-R64 WeakPolarHBondContact O-CB 3.26Å; L60-R64 PolarHBondContact O-N 2.94Å
61	L	98.9	Very high	98.8	Very high	116 Å²	116	107.9 Å²	107.9	61%	0.607	52%	0.521	S	S	*	.	H	α-helix	trans	-63.9	-41.7	177.6	-75	172.8	0	0	0	111.4	A57 C58 R64 N65	A57-L61 WeakPolarHBondContact O-CB 3.4Å; A57-L61 VanDerWaalsContact O-CG 3.26Å; A57-L61 WeakPolarHBondContact O-CG 3.29Å; A57-L61 PolarHBondContact O-N 3.48Å; C58-L61 PolarHBondContact O-N 3.47Å; L61-R64 PolarHBondContact O-N 3.29Å; L61-N65 VanDerWaalsContact O-CB 3.29Å; L61-N65 WeakPolarHBondContact O-CB 3.47Å; L61-N65 PolarHBondContact O-N 3.41Å
62	E	98.8	Very high	98.8	Very high	109 Å²	109	109.3 Å²	109.3	51%	0.509	52%	0.523	S	S	.	.	H	α-helix	trans	-64.2	-42.9	175.3	-72.8	-178.7	-175	0	0	111.9	C58 E59 R64 N65 R66	C58-E62 WeakPolarHBondContact O-CG 3.36Å; C58-E62 PolarHBondContact O-N 2.98Å; E59-E62 PolarHBondContact O-N 2.89Å; E62-R64 VanDerWaalsContact C-N 3.35Å; E62-R64 PolarHBondContact O-N 3.13Å; E62-N65 PolarHBondContact O-N 2.92Å; E62-R66 WeakPolarHBondContact O-CB 3.4Å; E62-R66 WeakPolarHBondContact O-CG 3.4Å; E62-R66 PolarHBondContact O-N 2.92Å; E62-R66 IonicContact OE2-NH1 3.63Å; E62-R66 PolarHBondContact OE2-NH1 3.46Å
63	Q	98.8	Very high	98.8	Very high	120 Å²	120	109.8 Å²	109.8	56%	0.561	53%	0.526	S	S	*	.	H	α-helix	trans	-60.2	-46.3	175.1	-172.8	-172.5	33.5	0	0	111.1	E59 L60 R66 K67	E59-Q63 WeakPolarHBondContact O-CB 3.41Å; E59-Q63 PolarHBondContact O-N 3.24Å; L60-Q63 PolarHBondContact O-N 2.9Å; Q63-R66 PolarHBondContact O-N 3.47Å; Q63-K67 PolarHBondContact O-N 3.01Å
64	R	98.8	Very high	98.8	Very high	171 Å²	171	106.7 Å²	106.7	65%	0.645	52%	0.519	S	S	*	.	H	α-helix	trans	-63	-42.7	176.9	-175.7	174.5	-179.4	162.8	0.6	111.5	L60 L61 E62 K67 L68	L60-R64 WeakPolarHBondContact O-CB 3.26Å; L60-R64 PolarHBondContact O-N 2.94Å; L61-R64 PolarHBondContact O-N 3.29Å; E62-R64 VanDerWaalsContact C-N 3.35Å; E62-R64 PolarHBondContact O-N 3.13Å; R64-K67 PolarHBondContact O-N 2.93Å; R64-L68 HydrophobicContact CG-CD1 4.04Å; R64-L68 HydrophobicContact CG-CG 4.43Å; R64-L68 WeakPolarHBondContact O-CG 3.27Å; R64-L68 PolarHBondContact O-N 3.47Å
65	N	98.8	Very high	98.8	Very high	76 Å²	76	106.4 Å²	106.4	41%	0.406	52%	0.518	S	S	.	.	H	α-helix	trans	-61.7	-45	177	-170.9	-92.5	0	0	0	111.4	L61 E62 K67 L68 K69	L61-N65 VanDerWaalsContact O-CB 3.29Å; L61-N65 WeakPolarHBondContact O-CB 3.47Å; L61-N65 PolarHBondContact O-N 3.41Å; E62-N65 PolarHBondContact O-N 2.92Å; N65-K67 VanDerWaalsContact C-N 3.33Å; N65-K67 PolarHBondContact O-N 3.42Å; N65-L68 PolarHBondContact O-N 3.39Å; N65-K69 WeakPolarHBondContact O-CB 3.34Å; N65-K69 WeakPolarHBondContact O-CG 3.48Å; N65-K69 PolarHBondContact O-N 3.18Å; N65-K69 WeakPolarHBondContact OD1-CD 3.44Å; N65-K69 WeakPolarHBondContact OD1-CE 3.37Å; N65-K69 PolarHBondContact OD1-NZ 3.44Å
66	R	98.8	Very high	98.8	Very high	116 Å²	116	103.5 Å²	103.5	44%	0.438	51%	0.51	S	S	.	.	H	α-helix	trans	-59	-42.9	174.4	-73.8	-172.5	-63.2	-95.8	2.6	111.8	E62 Q63 R70	E62-R66 WeakPolarHBondContact O-CB 3.4Å; E62-R66 WeakPolarHBondContact O-CG 3.4Å; E62-R66 PolarHBondContact O-N 2.92Å; E62-R66 IonicContact OE2-NH1 3.63Å; E62-R66 PolarHBondContact OE2-NH1 3.46Å; Q63-R66 PolarHBondContact O-N 3.47Å; R66-R70 WeakPolarHBondContact O-CG 3.41Å; R66-R70 PolarHBondContact O-N 2.85Å
67	K	98.8	Very high	98.8	Very high	144 Å²	144	104.2 Å²	104.2	63%	0.626	51%	0.514	S	S	*	.	H	α-helix	trans	-62.8	-49.4	177.1	-175.8	-179.7	175.8	-175.9	0	111.5	Q63 R64 N65 K69 R70 E71	Q63-K67 PolarHBondContact O-N 3.01Å; R64-K67 PolarHBondContact O-N 2.93Å; N65-K67 VanDerWaalsContact C-N 3.33Å; N65-K67 PolarHBondContact O-N 3.42Å; K67-K69 VanDerWaalsContact C-N 3.33Å; K67-K69 PolarHBondContact O-N 2.93Å; K67-R70 PolarHBondContact O-N 3.36Å; K67-E71 PolarHBondContact O-N 2.94Å; K67-E71 VanDerWaalsContact O-N 3.09Å
68	L	98.9	Very high	98.8	Very high	81 Å²	81	107.1 Å²	107.1	42%	0.424	52%	0.519	S	S	.	.	H	α-helix	trans	-62.1	-40	179.9	-71.8	170.8	0	0	0	112.1	R64 N65 E71 V72	R64-L68 HydrophobicContact CG-CD1 4.04Å; R64-L68 HydrophobicContact CG-CG 4.43Å; R64-L68 WeakPolarHBondContact O-CG 3.27Å; R64-L68 PolarHBondContact O-N 3.47Å; N65-L68 PolarHBondContact O-N 3.39Å; L68-E71 WeakPolarHBondContact O-CB 3.42Å; L68-E71 PolarHBondContact O-N 2.92Å; L68-V72 WeakPolarHBondContact O-CG2 3.24Å; L68-V72 PolarHBondContact O-N 3.19Å
69	K	98.8	Very high	98.8	Very high	125 Å²	125	109 Å²	109	54%	0.543	52%	0.521	S	S	.	.	H	α-helix	trans	-59.5	-47	175.6	-78.4	174.6	171.2	166	0	112.1	N65 K67 E71 V72 D73	N65-K69 WeakPolarHBondContact O-CB 3.34Å; N65-K69 WeakPolarHBondContact O-CG 3.48Å; N65-K69 PolarHBondContact O-N 3.18Å; N65-K69 WeakPolarHBondContact OD1-CD 3.44Å; N65-K69 WeakPolarHBondContact OD1-CE 3.37Å; N65-K69 PolarHBondContact OD1-NZ 3.44Å; K67-K69 VanDerWaalsContact C-N 3.33Å; K67-K69 PolarHBondContact O-N 2.93Å; K69-E71 VanDerWaalsContact C-N 3.27Å; K69-E71 PolarHBondContact O-N 3.1Å; K69-V72 WeakPolarHBondContact O-CB 3.42Å; K69-V72 PolarHBondContact O-N 2.99Å; K69-D73 PolarHBondContact O-N 3.26Å
70	R	98.8	Very high	98.8	Very high	168 Å²	168	108.4 Å²	108.4	63%	0.634	52%	0.521	S	S	*	.	H	α-helix	trans	-60.5	-37.9	175.9	-67.8	174.2	-167.3	153.1	-0.4	112.8	R66 K67 D73 S74	R66-R70 WeakPolarHBondContact O-CG 3.41Å; R66-R70 PolarHBondContact O-N 2.85Å; K67-R70 PolarHBondContact O-N 3.36Å; R70-D73 PolarHBondContact O-N 3.45Å; R70-S74 VanDerWaalsContact O-CB 3.3Å; R70-S74 WeakPolarHBondContact O-CB 3.45Å; R70-S74 PolarHBondContact O-N 3.22Å
71	E	98.8	Very high	98.8	Very high	103 Å²	103	109.7 Å²	109.7	48%	0.481	52%	0.522	S	S	.	.	H	α-helix	trans	-66.3	-43.1	176.7	-172.8	173.8	178.6	0	0	111.1	K67 L68 K69 S74 L75	K67-E71 PolarHBondContact O-N 2.94Å; K67-E71 VanDerWaalsContact O-N 3.09Å; L68-E71 WeakPolarHBondContact O-CB 3.42Å; L68-E71 PolarHBondContact O-N 2.92Å; K69-E71 VanDerWaalsContact C-N 3.27Å; K69-E71 PolarHBondContact O-N 3.1Å; E71-S74 PolarHBondContact O-N 2.8Å; E71-L75 HydrophobicContact CG-CD1 4.1Å; E71-L75 WeakPolarHBondContact O-CB 3.49Å; E71-L75 VanDerWaalsContact O-CG 3.25Å; E71-L75 WeakPolarHBondContact O-CG 3.3Å; E71-L75 PolarHBondContact O-N 2.95Å
72	V	98.9	Very high	98.8	Very high	86 Å²	86	108.4 Å²	108.4	52%	0.521	52%	0.515	S	S	.	.	H	α-helix	trans	-59.9	-46.8	172.8	169.2	0	0	0	0	111.4	L68 K69 L75 S76	L68-V72 WeakPolarHBondContact O-CG2 3.24Å; L68-V72 PolarHBondContact O-N 3.19Å; K69-V72 WeakPolarHBondContact O-CB 3.42Å; K69-V72 PolarHBondContact O-N 2.99Å; V72-L75 PolarHBondContact O-N 3.12Å; V72-S76 WeakPolarHBondContact O-CB 3.43Å; V72-S76 PolarHBondContact O-N 2.79Å; V72-S76 PolarHBondContact O-OG 3.44Å
73	D	98.8	Very high	98.7	Very high	91 Å²	91	105.7 Å²	105.7	49%	0.487	51%	0.509	S	S	.	.	H	α-helix	trans	-61.4	-49.1	179.9	-62.8	-25.2	0	0	0	110.4	K69 R70 L75 S76 E77	K69-D73 PolarHBondContact O-N 3.26Å; R70-D73 PolarHBondContact O-N 3.45Å; D73-L75 PolarHBondContact O-N 3.34Å; D73-S76 WeakPolarHBondContact O-CB 3.37Å; D73-S76 PolarHBondContact O-N 3.36Å; D73-S76 VanDerWaalsContact O-N 3.16Å; D73-E77 WeakPolarHBondContact O-CG 3.26Å; D73-E77 PolarHBondContact O-N 3.47Å
74	S	98.8	Very high	98.7	Very high	67 Å²	67	105.6 Å²	105.6	47%	0.469	51%	0.508	S	S	.	.	H	α-helix	trans	-60.2	-43.8	178.4	-178	0	0	0	0	112.9	R70 E71 S76 E77 E78	R70-S74 VanDerWaalsContact O-CB 3.3Å; R70-S74 WeakPolarHBondContact O-CB 3.45Å; R70-S74 PolarHBondContact O-N 3.22Å; E71-S74 PolarHBondContact O-N 2.8Å; S74-S76 VanDerWaalsContact C-N 3.32Å; S74-E77 PolarHBondContact O-N 3.41Å; S74-E78 PolarHBondContact O-N 2.94Å
75	L	98.9	Very high	98.7	Very high	96 Å²	96	99.7 Å²	99.7	50%	0.503	50%	0.496	S	S	.	.	H	α-helix	trans	-68.3	-34	177.6	-72	170.8	0	0	0	111.7	E71 V72 D73 E78 Q79	E71-L75 HydrophobicContact CG-CD1 4.1Å; E71-L75 WeakPolarHBondContact O-CB 3.49Å; E71-L75 VanDerWaalsContact O-CG 3.25Å; E71-L75 WeakPolarHBondContact O-CG 3.3Å; E71-L75 PolarHBondContact O-N 2.95Å; V72-L75 PolarHBondContact O-N 3.12Å; D73-L75 PolarHBondContact O-N 3.34Å; L75-E78 PolarHBondContact O-N 3.42Å; L75-Q79 VanDerWaalsContact O-CB 3.31Å; L75-Q79 WeakPolarHBondContact O-CB 3.46Å; L75-Q79 PolarHBondContact O-N 3.48Å
76	S	98.8	Very high	98.5	Very high	55 Å²	55	102 Å²	102	39%	0.385	51%	0.508	S	S	.	.	H	α-helix	trans	-68.9	-41.1	176.6	-57.3	0	0	0	0	111.2	V72 D73 S74 Q79 N80	V72-S76 WeakPolarHBondContact O-CB 3.43Å; V72-S76 PolarHBondContact O-N 2.79Å; V72-S76 PolarHBondContact O-OG 3.44Å; D73-S76 WeakPolarHBondContact O-CB 3.37Å; D73-S76 PolarHBondContact O-N 3.36Å; D73-S76 VanDerWaalsContact O-N 3.16Å; S74-S76 VanDerWaalsContact C-N 3.32Å; S76-Q79 PolarHBondContact O-N 2.94Å; S76-N80 WeakPolarHBondContact O-CB 3.43Å; S76-N80 VanDerWaalsContact O-CG 3.24Å; S76-N80 PolarHBondContact O-N 2.88Å; S76-N80 PolarHBondContact O-ND2 3.26Å
77	E	98.8	Very high	98.4	Very high	138 Å²	138	104.8 Å²	104.8	65%	0.645	52%	0.518	S	S	*	.	H	α-helix	trans	-60.2	-46.3	172.9	-73.4	173.3	-172.6	0	0	111.5	D73 S74 N80 F81	D73-E77 WeakPolarHBondContact O-CG 3.26Å; D73-E77 PolarHBondContact O-N 3.47Å; S74-E77 PolarHBondContact O-N 3.41Å; E77-N80 PolarHBondContact O-N 2.91Å; E77-F81 WeakPolarHBondContact O-CB 3.46Å; E77-F81 PolarHBondContact O-N 2.88Å
78	E	98.7	Very high	98.2	Very high	109 Å²	109	101 Å²	101	51%	0.509	51%	0.514	S	S	.	.	H	α-helix	trans	-63.2	-43.9	177.3	-174.4	174.5	-171	0	0	111.9	S74 L75 N80 F81 L82	S74-E78 PolarHBondContact O-N 2.94Å; L75-E78 PolarHBondContact O-N 3.42Å; E78-N80 VanDerWaalsContact C-N 3.35Å; E78-N80 PolarHBondContact O-N 3.02Å; E78-F81 PolarHBondContact O-N 3.17Å; E78-L82 HydrophobicContact CG-CD1 4.07Å; E78-L82 HydrophobicContact CG-CG 4.46Å; E78-L82 WeakPolarHBondContact O-CB 3.4Å; E78-L82 VanDerWaalsContact O-CG 3.31Å; E78-L82 WeakPolarHBondContact O-CG 3.32Å; E78-L82 PolarHBondContact O-N 3.45Å
79	Q	98.7	Very high	98	Very high	107 Å²	107	102 Å²	102	50%	0.5	52%	0.516	S	S	.	.	H	α-helix	trans	-61.3	-43.6	176.8	-176.4	-86.2	1.3	0	0	111.6	L75 S76 S83	L75-Q79 VanDerWaalsContact O-CB 3.31Å; L75-Q79 WeakPolarHBondContact O-CB 3.46Å; L75-Q79 PolarHBondContact O-N 3.48Å; S76-Q79 PolarHBondContact O-N 2.94Å; Q79-S83 VanDerWaalsContact O-CB 3.27Å; Q79-S83 WeakPolarHBondContact O-CB 3.42Å; Q79-S83 PolarHBondContact O-N 2.82Å; Q79-S83 PolarHBondContact O-OG 2.93Å
80	N	98.7	Very high	97.7	Very high	87 Å²	87	101 Å²	101	47%	0.465	51%	0.513	S	S	.	.	H	α-helix	trans	-64.3	-46.7	178.4	-75.7	-37.2	0	0	0	110.4	S76 E77 E78 L82 S83 E84	S76-N80 WeakPolarHBondContact O-CB 3.43Å; S76-N80 VanDerWaalsContact O-CG 3.24Å; S76-N80 PolarHBondContact O-N 2.88Å; S76-N80 PolarHBondContact O-ND2 3.26Å; E77-N80 PolarHBondContact O-N 2.91Å; E78-N80 VanDerWaalsContact C-N 3.35Å; E78-N80 PolarHBondContact O-N 3.02Å; N80-L82 PolarHBondContact O-N 2.77Å; N80-S83 PolarHBondContact O-N 3.18Å; N80-E84 WeakPolarHBondContact O-CB 3.31Å; N80-E84 WeakPolarHBondContact O-CG 3.32Å; N80-E84 PolarHBondContact O-N 2.96Å
81	F	98.7	Very high	97.2	Very high	139 Å²	139	96.6 Å²	96.6	61%	0.61	51%	0.507	S	S	*	.	H	α-helix	trans	-57.7	-48.7	177.8	173.7	-99.8	0	0	0	112.2	E77 E78 S83 E84 A85	E77-F81 WeakPolarHBondContact O-CB 3.46Å; E77-F81 PolarHBondContact O-N 2.88Å; E78-F81 PolarHBondContact O-N 3.17Å; F81-S83 PolarHBondContact O-N 2.83Å; F81-E84 PolarHBondContact O-N 3.24Å; F81-A85 WeakPolarHBondContact O-CB 3.37Å; F81-A85 PolarHBondContact O-N 3.39Å
82	L	98.5	Very high	96.7	Very high	88 Å²	88	99.2 Å²	99.2	46%	0.461	52%	0.517	S	S	.	.	H	α-helix	trans	-65.1	-40	178.4	-68.4	174.4	0	0	0	111.8	E78 N80 A85 L86	E78-L82 HydrophobicContact CG-CD1 4.07Å; E78-L82 HydrophobicContact CG-CG 4.46Å; E78-L82 WeakPolarHBondContact O-CB 3.4Å; E78-L82 VanDerWaalsContact O-CG 3.31Å; E78-L82 WeakPolarHBondContact O-CG 3.32Å; E78-L82 PolarHBondContact O-N 3.45Å; N80-L82 PolarHBondContact O-N 2.77Å; L82-A85 PolarHBondContact O-N 2.92Å; L82-L86 WeakPolarHBondContact O-CG 3.46Å; L82-L86 PolarHBondContact O-N 3.33Å
83	S	98.1	Very high	96.2	Very high	53 Å²	53	96 Å²	96	37%	0.371	50%	0.498	S	S	.	.	H	α-helix	trans	-63.5	-42.2	177.1	-59.3	0	0	0	0	111.6	Q79 N80 F81 L86 R87	Q79-S83 VanDerWaalsContact O-CB 3.27Å; Q79-S83 WeakPolarHBondContact O-CB 3.42Å; Q79-S83 PolarHBondContact O-N 2.82Å; Q79-S83 PolarHBondContact O-OG 2.93Å; N80-S83 PolarHBondContact O-N 3.18Å; F81-S83 PolarHBondContact O-N 2.83Å; S83-L86 PolarHBondContact O-N 3.23Å; S83-R87 WeakPolarHBondContact O-CB 3.27Å; S83-R87 PolarHBondContact O-N 2.92Å
84	E	98.3	Very high	95.4	Very high	117 Å²	117	95.9 Å²	95.9	55%	0.547	50%	0.502	S	S	.	.	H	α-helix	trans	-64.9	-43.1	175	-75.4	-180	-177.3	0	0	112.1	N80 F81 L86 R87 A88	N80-E84 WeakPolarHBondContact O-CB 3.31Å; N80-E84 WeakPolarHBondContact O-CG 3.32Å; N80-E84 PolarHBondContact O-N 2.96Å; F81-E84 PolarHBondContact O-N 3.24Å; E84-L86 VanDerWaalsContact C-N 3.33Å; E84-L86 PolarHBondContact O-N 3.25Å; E84-R87 PolarHBondContact O-N 2.82Å; E84-A88 WeakPolarHBondContact O-CB 3.48Å; E84-A88 PolarHBondContact O-N 2.93Å
85	A	97.5	Very high	94.6	Very high	48 Å²	48	98.9 Å²	98.9	40%	0.397	51%	0.511	S	S	.	.	H	α-helix	trans	-60.1	-43.3	176.2	0	0	0	0	0	111.7	F81 L82 A88 H89	F81-A85 WeakPolarHBondContact O-CB 3.37Å; F81-A85 PolarHBondContact O-N 3.39Å; L82-A85 PolarHBondContact O-N 2.92Å; A85-A88 PolarHBondContact O-N 3.04Å; A85-H89 WeakPolarHBondContact O-CB 3.37Å; A85-H89 PolarHBondContact O-N 3.37Å
86	L	96.2	Very high	93.2	Very high	124 Å²	124	99.6 Å²	99.6	65%	0.649	51%	0.513	S	S	*	.	H	α-helix	trans	-64.2	-45.3	175.3	-72.2	173	0	0	0	111.9	L82 S83 E84 A88 H89 E90	L82-L86 WeakPolarHBondContact O-CG 3.46Å; L82-L86 PolarHBondContact O-N 3.33Å; S83-L86 PolarHBondContact O-N 3.23Å; E84-L86 VanDerWaalsContact C-N 3.33Å; E84-L86 PolarHBondContact O-N 3.25Å; L86-A88 VanDerWaalsContact C-N 3.31Å; L86-A88 PolarHBondContact O-N 3.06Å; L86-H89 WeakPolarHBondContact O-CB 3.35Å; L86-H89 PolarHBondContact O-N 3.06Å; L86-H89 VanDerWaalsContact O-N 3.13Å; L86-E90 PolarHBondContact O-N 3.12Å
87	R	95.1	Very high	91.3	Very high	175 Å²	175	102.3 Å²	102.3	66%	0.66	52%	0.52	S	S	*	.	H	α-helix	trans	-62.8	-37.8	177.5	-170.9	179.5	67.2	158.3	-1.9	112.2	S83 E84 H89 E90 P91	S83-R87 WeakPolarHBondContact O-CB 3.27Å; S83-R87 PolarHBondContact O-N 2.92Å; E84-R87 PolarHBondContact O-N 2.82Å; R87-H89 VanDerWaalsContact C-N 3.31Å; R87-E90 WeakPolarHBondContact O-CB 3.5Å; R87-E90 PolarHBondContact O-N 3.05Å; R87-P91 WeakPolarHBondContact O-CD 3.39Å
88	A	95.3	Very high	89.2	Confident	65 Å²	65	100 Å²	100	54%	0.537	52%	0.518	S	S	.	.	H	α-helix	trans	-67.9	-32.1	175.4	0	0	0	0	0	112.2	E84 A85 L86 P91 F92	E84-A88 WeakPolarHBondContact O-CB 3.48Å; E84-A88 PolarHBondContact O-N 2.93Å; A85-A88 PolarHBondContact O-N 3.04Å; L86-A88 VanDerWaalsContact C-N 3.31Å; L86-A88 PolarHBondContact O-N 3.06Å; A88-P91 WeakPolarHBondContact O-CD 3.45Å; A88-F92 WeakPolarHBondContact O-CD2 3.47Å; A88-F92 WeakPolarHBondContact O-CE2 3.37Å
89	H	94.5	Very high	87.1	Confident	101 Å²	101	99.3 Å²	99.3	47%	0.468	53%	0.525	S	S	.	.	H	α-helix	trans	-76.4	-34	175.7	173.9	-91.3	0	0	0	113.3	A85 L86 R87 P91 F92 C93	A85-H89 WeakPolarHBondContact O-CB 3.37Å; A85-H89 PolarHBondContact O-N 3.37Å; L86-H89 WeakPolarHBondContact O-CB 3.35Å; L86-H89 PolarHBondContact O-N 3.06Å; L86-H89 VanDerWaalsContact O-N 3.13Å; R87-H89 VanDerWaalsContact C-N 3.31Å; H89-P91 VanDerWaalsContact C-CD 3.45Å; H89-F92 PolarHBondContact O-N 3.1Å; H89-C93 VanDerWaalsContact CE1-CB 3.5Å; H89-C93 WeakPolarHBondContact CE1-CB 3.44Å; H89-C93 PolarHBondContact O-N 3.19Å
90	E	92	Very high	84.8	Confident	103 Å²	103	102.9 Å²	102.9	48%	0.481	54%	0.54	S	S	.	.	G	3₁₀ helix	trans	-42.5	-49	-176.9	-169.1	164.6	-164.8	0	0	115.4	L86 R87 F92 C93	L86-E90 PolarHBondContact O-N 3.12Å; R87-E90 WeakPolarHBondContact O-CB 3.5Å; R87-E90 PolarHBondContact O-N 3.05Å; E90-F92 PolarHBondContact O-N 3.5Å; E90-F92 VanDerWaalsContact O-N 3.16Å; E90-C93 WeakPolarHBondContact O-CB 3.36Å; E90-C93 PolarHBondContact O-N 2.88Å
91	P	89.7	Confident	82.5	Confident	76 Å²	76	102.3 Å²	102.3	49%	0.494	55%	0.547	S	S	.	.	G	3₁₀ helix	trans	-65.7	-16.1	178.6	25.8	-35.9	0	0	0	114.8	R87 A88 H89 H97	R87-P91 WeakPolarHBondContact O-CD 3.39Å; A88-P91 WeakPolarHBondContact O-CD 3.45Å; H89-P91 VanDerWaalsContact C-CD 3.45Å; P91-H97 VanDerWaalsContact C-NE2 3.32Å; P91-H97 PolarHBondContact O-NE2 2.92Å
92	F	88.4	Confident	80.3	Confident	159 Å²	159	100.6 Å²	100.6	70%	0.697	55%	0.552	S	S	*	*	G	3₁₀ helix	trans	-102.9	-5.8	178.3	-53.3	-76.3	0	0	0	112.9	A88 H89 E90 P94	A88-F92 WeakPolarHBondContact O-CD2 3.47Å; A88-F92 WeakPolarHBondContact O-CE2 3.37Å; H89-F92 PolarHBondContact O-N 3.1Å; E90-F92 PolarHBondContact O-N 3.5Å; E90-F92 VanDerWaalsContact O-N 3.16Å; F92-P94 WeakPolarHBondContact O-CD 3.5Å
93	C	88.3	Confident	78	Confident	18 Å²	18	101.8 Å²	101.8	12%	0.122	57%	0.568	C	S	.	*			trans	-72	107.9	-173.1	-173.6	0	0	0	0	111.3	H89 E90 I95 M96 H97	H89-C93 VanDerWaalsContact CE1-CB 3.5Å; H89-C93 WeakPolarHBondContact CE1-CB 3.44Å; H89-C93 PolarHBondContact O-N 3.19Å; E90-C93 WeakPolarHBondContact O-CB 3.36Å; E90-C93 PolarHBondContact O-N 2.88Å; C93-I95 PolarHBondContact O-N 3.24Å; C93-I95 VanDerWaalsContact O-N 3.15Å; C93-M96 HydrophobicContact CB-CB 4.19Å; C93-M96 HydrophobicContact CB-CG 3.99Å; C93-M96 PolarHBondContact O-N 3.49Å; C93-M96 VanDerWaalsContact O-N 3.13Å; C93-H97 PolarHBondContact O-CD2 3.25Å; C93-H97 PolarHBondContact O-N 3.21Å
94	P	82.3	Confident	75.8	Confident	88 Å²	88	103.6 Å²	103.6	57%	0.571	58%	0.581	S	S	*	*	H	α-helix	trans	-64.1	-27.1	-176.2	-18.5	32.7	0	0	0	112.2	F92 H97 C98	F92-P94 WeakPolarHBondContact O-CD 3.5Å; P94-H97 PolarHBondContact O-N 3.45Å; P94-C98 WeakPolarHBondContact O-CB 3.33Å; P94-C98 PolarHBondContact O-N 3.49Å; P94-C98 PolarHBondContact O-SG 3.4Å
95	I	81.9	Confident	73.5	Confident	130 Å²	130	105.9 Å²	105.9	67%	0.667	60%	0.596	S	S	*	*	H	α-helix	trans	-68.3	-36.7	180	-58	172.4	0	0	0	111.2	C93 S99	C93-I95 PolarHBondContact O-N 3.24Å; C93-I95 VanDerWaalsContact O-N 3.15Å; I95-S99 PolarHBondContact O-OG 2.86Å; I95-S99 VanDerWaalsContact O-OG 3.13Å
96	M	68	Low	71.5	Confident	111 Å²	111	112 Å²	112	55%	0.547	62%	0.616	S	S	.	*	H	α-helix	trans	-76.9	-34.2	178.2	-63.3	-63.3	-76.1	0	0	111.7	C93	C93-M96 HydrophobicContact CB-CB 4.19Å; C93-M96 HydrophobicContact CB-CG 3.99Å; C93-M96 PolarHBondContact O-N 3.49Å; C93-M96 VanDerWaalsContact O-N 3.13Å
97	H	60.7	Low	69.2	Low	112 Å²	112	112.1 Å²	112.1	52%	0.519	62%	0.624	S	S	.	*	H	α-helix	trans	-81	-24.6	177.7	-66.7	-68.5	0	0	0	114.1	P91 C93 P94	P91-H97 VanDerWaalsContact C-NE2 3.32Å; P91-H97 PolarHBondContact O-NE2 2.92Å; C93-H97 PolarHBondContact O-CD2 3.25Å; C93-H97 PolarHBondContact O-N 3.21Å; P94-H97 PolarHBondContact O-N 3.45Å
98	C	53.7	Low	67.3	Low	91 Å²	91	111.2 Å²	111.2	62%	0.615	63%	0.632	S	S	*	*	H	α-helix	trans	-80.6	-19	175.9	-75	0	0	0	0	113.8	P94 F100	P94-C98 WeakPolarHBondContact O-CB 3.33Å; P94-C98 PolarHBondContact O-N 3.49Å; P94-C98 PolarHBondContact O-SG 3.4Å; C98-F100 VanDerWaalsContact C-N 3.27Å; C98-F100 PolarHBondContact O-N 3.44Å
99	S	53.8	Low	65.2	Low	94 Å²	94	112 Å²	112	66%	0.657	64%	0.639	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.8	-15.5	179.8	-66.9	0	0	0	0	113.8	I95	I95-S99 PolarHBondContact O-OG 2.86Å; I95-S99 VanDerWaalsContact O-OG 3.13Å
100	F	52	Low	63.3	Low	182 Å²	182	112 Å²	112	80%	0.798	66%	0.657	S	S	*	*	S	Bend	trans	-98.7	-19	179.9	-141.5	-97.6	0	0	0	114	C98 S102	C98-F100 VanDerWaalsContact C-N 3.27Å; C98-F100 PolarHBondContact O-N 3.44Å; F100-S102 VanDerWaalsContact C-N 3.25Å; F100-S102 PolarHBondContact O-N 3.15Å
101	A	50.1	Low	61	Low	74 Å²	74	111.8 Å²	111.8	61%	0.612	67%	0.673	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.9	-10.2	-178.3	0	0	0	0	0	113.7
102	S	51	Low	59.2	Low	104 Å²	104	119.5 Å²	119.5	73%	0.727	69%	0.692	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84	-6.3	-178.9	-160.5	0	0	0	0	114.4	F100	F100-S102 VanDerWaalsContact C-N 3.25Å; F100-S102 PolarHBondContact O-N 3.15Å
103	S	51.5	Low	57.2	Low	113 Å²	113	116.9 Å²	116.9	79%	0.79	69%	0.693	S	S	*	*	S	Bend	trans	-112.2	0.5	-176.2	-57.7	0	0	0	0	115.5
104	S	51.5	Low	55.5	Low	91 Å²	91	126.2 Å²	126.2	64%	0.636	75%	0.749	S	S	*	*			trans	-118.6	47.5	179.8	69.3	0	0	0	0	113.3	Q106	S104-Q106 VanDerWaalsContact C-N 3.31Å; S104-Q106 PolarHBondContact O-N 3.1Å; S104-Q106 VanDerWaalsContact O-N 3.11Å
105	L	51	Low	54.2	Low	165 Å²	165	128.2 Å²	128.2	86%	0.864	76%	0.758	S	S	*	*			trans	-73.7	92.7	156.5	-82.1	161	0	0	0	107.5	P107	L105-P107 WeakPolarHBondContact O-CD 3.39Å
106	Q	53.8	Low	52.7	Low	175 Å²	175	128.1 Å²	128.1	82%	0.818	76%	0.763	S	S	*	*			trans	-59.7	126	157.5	-70.5	-103.6	-62.1	0	0	108.1	S104 D108	S104-Q106 VanDerWaalsContact C-N 3.31Å; S104-Q106 PolarHBondContact O-N 3.1Å; S104-Q106 VanDerWaalsContact O-N 3.11Å; Q106-D108 PolarHBondContact O-N 2.69Å
107	P	47.8	Very low	51.9	Low	127 Å²	127	129 Å²	129	83%	0.825	78%	0.775	S	S	*	*			trans	-83.2	106.5	157.9	11	6.8	0	0	0	107.5	L105	L105-P107 WeakPolarHBondContact O-CD 3.39Å
108	D	56.5	Low	51.4	Low	156 Å²	156	130 Å²	130	83%	0.834	79%	0.79	S	S	*	*			trans	-73.9	158.5	160.8	-154.6	-13.8	0	0	0	109.8	Q106	Q106-D108 PolarHBondContact O-N 2.69Å
109	A	49.8	Very low	51.2	Low	82 Å²	82	132.4 Å²	132.4	68%	0.678	80%	0.801	S	S	*	*			trans	86.6	106	162	0	0	0	0	0	120.8
110	A	54.6	Low	51.1	Low	102 Å²	102	135 Å²	135	84%	0.843	81%	0.811	S	S	*	*				73	107.2	118.9	0	0	0	0	0	121.1
111	A	45.3	Very low	51	Low	98 Å²	98	131.6 Å²	131.6	81%	0.81	81%	0.812	S	S	*	*			trans	-154.5	100	136.5	0	0	0	0	0	107.5
112	R	50.5	Low	51.1	Low	237 Å²	237	136.1 Å²	136.1	89%	0.894	83%	0.827	S	S	*	*				51.7	117.1	86.3	-87.6	-174.6	152.4	-160.1	-5.1	115.4
113	S	46.7	Very low	51.1	Low	104 Å²	104	138.8 Å²	138.8	73%	0.727	84%	0.835	S	S	*	*			trans	103	116.2	136.1	-66.4	0	0	0	0	119.8
114	V	53.9	Low	51	Low	215 Å²	215	141.1 Å²	141.1	100%	1.303	84%	0.839	S	S	*	*			trans	68.4	0	141.7	-168.9	0	0	0	0	118.3

Retrieved 114 of 114 residues in 17.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).