A0A087YGR4_POEFO Loading...

Ubiquinol-cytochrome c reductase complex assembly factor 6

AlphaFold DB , UniProt , Accession A0A087YGR4, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 69 aa.

						>A0A087YGR4_POEFO|A0A087YGR4
MPAGVSWPRYIRMLGASVLAMFAGAQVVHQYYLPDLSIPEIPPKPGELRTELHGYKAREEAAAAFQGLK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	76.5	Confident	90.3	Very high	161 Å²	161	94.2 Å²	94.2	79%	0.793	52%	0.518	S	S	*	.				0	121.6	0	-84.2	-173.9	176.2	0	0	107.7	A3 V5	M1-A3 PolarHBondContact O-N 3.44Å; M1-V5 VanDerWaalsContact CB-O 3.24Å; M1-V5 WeakPolarHBondContact CB-O 3.42Å
2	P	80.4	Confident	90.9	Very high	34 Å²	34	102.3 Å²	102.3	22%	0.221	54%	0.535	C	S	.	.	G	3₁₀ helix	trans	-62.1	130.7	179.8	25.4	-32.1	0	0	0	109.9	G4 V5 Y10	P2-G4 PolarHBondContact O-N 3.38Å; P2-V5 WeakPolarHBondContact O-CG2 3.46Å; P2-V5 PolarHBondContact O-N 3.12Å; P2-Y10 HydrophobicContact CB-CD2 3.81Å; P2-Y10 HydrophobicContact CB-CE2 3.97Å; P2-Y10 HydrophobicContact CB-CG 4.2Å; P2-Y10 HydrophobicContact CG-CD1 3.95Å; P2-Y10 HydrophobicContact CG-CD2 3.54Å; P2-Y10 HydrophobicContact CG-CE1 4.49Å; P2-Y10 HydrophobicContact CG-CE2 4.13Å; P2-Y10 HydrophobicContact CG-CG 3.43Å; P2-Y10 VanDerWaalsContact CG-CG 3.43Å
3	A	83	Confident	91.3	Very high	106 Å²	106	104.5 Å²	104.5	88%	0.876	54%	0.543	S	S	*	.	G	3₁₀ helix	trans	48.5	30.4	176.5	0	0	0	0	0	115.7	M1 V5	M1-A3 PolarHBondContact O-N 3.44Å; A3-V5 VanDerWaalsContact C-N 3.29Å; A3-V5 PolarHBondContact O-N 3.42Å
4	G	90.7	Very high	91.7	Very high	70 Å²	70	103.1 Å²	103.1	72%	0.722	54%	0.536	S	S	*	.	G	3₁₀ helix	trans	75.8	7.8	179.9	0	0	0	0	0	115.5	P2	P2-G4 PolarHBondContact O-N 3.38Å
5	V	92.2	Very high	92.1	Very high	44 Å²	44	98.3 Å²	98.3	27%	0.267	52%	0.522	S	S	.	.	S	Bend	trans	-105.9	150.8	176	-66.2	0	0	0	0	112.6	M1 P2 A3 R9	M1-V5 VanDerWaalsContact CB-O 3.24Å; M1-V5 WeakPolarHBondContact CB-O 3.42Å; P2-V5 WeakPolarHBondContact O-CG2 3.46Å; P2-V5 PolarHBondContact O-N 3.12Å; A3-V5 VanDerWaalsContact C-N 3.29Å; A3-V5 PolarHBondContact O-N 3.42Å; V5-R9 HydrophobicContact CB-CG 4.42Å
6	S	95	Very high	92.5	Very high	37 Å²	37	95.6 Å²	95.6	26%	0.259	52%	0.518	S	S	.	.			trans	-63	147.7	175.5	68.8	0	0	0	0	111.5	R9 Y10	S6-R9 WeakPolarHBondContact O-CB 3.37Å; S6-R9 PolarHBondContact O-N 3.46Å; S6-Y10 PolarHBondContact O-N 3.42Å
7	W	93.9	Very high	92.9	Very high	160 Å²	160	93.9 Å²	93.9	61%	0.606	52%	0.515	S	S	*	.	H	α-helix	trans	-50.8	-45.8	177.4	-89.5	105.2	0	0	0	113.9	R9 Y10 I11	W7-R9 VanDerWaalsContact C-N 3.29Å; W7-R9 PolarHBondContact O-N 3.19Å; W7-Y10 HydrophobicContact CZ3-CD1 4.5Å; W7-Y10 PolarHBondContact O-N 3.37Å; W7-I11 HydrophobicContact CE3-CD1 4.36Å; W7-I11 HydrophobicContact CE3-CG1 4.27Å; W7-I11 HydrophobicContact CZ3-CD1 4.35Å; W7-I11 WeakPolarHBondContact O-CG1 3.48Å; W7-I11 PolarHBondContact O-N 3.31Å
8	P	95.2	Very high	93.2	Very high	77 Å²	77	91.7 Å²	91.7	50%	0.5	51%	0.505	S	S	.	.	H	α-helix	trans	-60.6	-36.9	176.8	-24.8	34.7	0	0	0	113.2	R12	P8-R12 WeakPolarHBondContact O-CG 3.41Å; P8-R12 PolarHBondContact O-N 3.49Å; P8-R12 VanDerWaalsContact O-N 3.14Å
9	R	94.9	Very high	93.5	Very high	159 Å²	159	93.3 Å²	93.3	60%	0.6	51%	0.512	S	S	*	.	H	α-helix	trans	-68.9	-43.1	177.5	-178.5	174.1	-69.1	130.1	0.3	111.1	V5 S6 W7 R12 M13	V5-R9 HydrophobicContact CB-CG 4.42Å; S6-R9 WeakPolarHBondContact O-CB 3.37Å; S6-R9 PolarHBondContact O-N 3.46Å; W7-R9 VanDerWaalsContact C-N 3.29Å; W7-R9 PolarHBondContact O-N 3.19Å; R9-R12 PolarHBondContact O-N 3.14Å; R9-M13 PolarHBondContact O-N 2.94Å; R9-M13 VanDerWaalsContact O-N 3.1Å
10	Y	95.4	Very high	93.7	Very high	95 Å²	95	91.9 Å²	91.9	37%	0.373	51%	0.512	S	S	.	.	H	α-helix	trans	-59.6	-49.6	176.6	179.6	-97.9	0	0	0	112	P2 S6 W7 R12 M13 L14	P2-Y10 HydrophobicContact CB-CD2 3.81Å; P2-Y10 HydrophobicContact CB-CE2 3.97Å; P2-Y10 HydrophobicContact CB-CG 4.2Å; P2-Y10 HydrophobicContact CG-CD1 3.95Å; P2-Y10 HydrophobicContact CG-CD2 3.54Å; P2-Y10 HydrophobicContact CG-CE1 4.49Å; P2-Y10 HydrophobicContact CG-CE2 4.13Å; P2-Y10 HydrophobicContact CG-CG 3.43Å; P2-Y10 VanDerWaalsContact CG-CG 3.43Å; S6-Y10 PolarHBondContact O-N 3.42Å; W7-Y10 HydrophobicContact CZ3-CD1 4.5Å; W7-Y10 PolarHBondContact O-N 3.37Å; Y10-R12 VanDerWaalsContact C-N 3.35Å; Y10-R12 PolarHBondContact O-N 3.05Å; Y10-M13 PolarHBondContact O-N 2.92Å; Y10-L14 HydrophobicContact CE1-CD2 4.23Å; Y10-L14 WeakPolarHBondContact O-CB 3.45Å; Y10-L14 PolarHBondContact O-N 3.48Å
11	I	96.6	Very high	93.9	Very high	93 Å²	93	93 Å²	93	48%	0.477	52%	0.515	S	S	.	.	H	α-helix	trans	-63.9	-39.2	-179.1	-65.5	-63.6	0	0	0	111.9	W7 L14 G15	W7-I11 HydrophobicContact CE3-CD1 4.36Å; W7-I11 HydrophobicContact CE3-CG1 4.27Å; W7-I11 HydrophobicContact CZ3-CD1 4.35Å; W7-I11 WeakPolarHBondContact O-CG1 3.48Å; W7-I11 PolarHBondContact O-N 3.31Å; I11-L14 PolarHBondContact O-N 3.37Å; I11-G15 PolarHBondContact O-N 3.47Å
12	R	96.8	Very high	95	Very high	192 Å²	192	91.3 Å²	91.3	73%	0.725	50%	0.504	S	S	*	.	H	α-helix	trans	-60.3	-46.1	174.2	-77.7	177.3	-177.1	140.6	-0.1	112.1	P8 R9 Y10 G15 A16	P8-R12 WeakPolarHBondContact O-CG 3.41Å; P8-R12 PolarHBondContact O-N 3.49Å; P8-R12 VanDerWaalsContact O-N 3.14Å; R9-R12 PolarHBondContact O-N 3.14Å; Y10-R12 VanDerWaalsContact C-N 3.35Å; Y10-R12 PolarHBondContact O-N 3.05Å; R12-G15 PolarHBondContact O-N 2.93Å; R12-A16 WeakPolarHBondContact O-CB 3.41Å; R12-A16 PolarHBondContact O-N 2.95Å
13	M	96.9	Very high	95.8	Very high	131 Å²	131	92.3 Å²	92.3	65%	0.645	52%	0.515	S	S	*	.	H	α-helix	trans	-64.2	-47.2	178.7	-174	66.1	96.2	0	0	110.9	R9 Y10 G15 A16 S17	R9-M13 PolarHBondContact O-N 2.94Å; R9-M13 VanDerWaalsContact O-N 3.1Å; Y10-M13 PolarHBondContact O-N 2.92Å; M13-G15 VanDerWaalsContact C-N 3.34Å; M13-G15 PolarHBondContact O-N 3.25Å; M13-A16 PolarHBondContact O-N 3.46Å; M13-S17 PolarHBondContact O-N 3.14Å; M13-S17 PolarHBondContact O-OG 3.32Å; M13-S17 VanDerWaalsContact O-OG 3.08Å
14	L	96.5	Very high	96.4	Very high	84 Å²	84	89.1 Å²	89.1	44%	0.44	49%	0.493	S	S	.	.	H	α-helix	trans	-57.8	-47.5	177.6	178.6	63.7	0	0	0	111.6	Y10 I11 S17 V18	Y10-L14 HydrophobicContact CE1-CD2 4.23Å; Y10-L14 WeakPolarHBondContact O-CB 3.45Å; Y10-L14 PolarHBondContact O-N 3.48Å; I11-L14 PolarHBondContact O-N 3.37Å; L14-S17 PolarHBondContact O-N 3.14Å; L14-V18 WeakPolarHBondContact O-CG2 3.42Å; L14-V18 PolarHBondContact O-N 3.44Å
15	G	98.1	Very high	96.7	Very high	32 Å²	32	88 Å²	88	33%	0.33	48%	0.477	S	S	.	.	H	α-helix	trans	-60.6	-45	177	0	0	0	0	0	112.3	I11 R12 M13 S17 V18 L19	I11-G15 PolarHBondContact O-N 3.47Å; R12-G15 PolarHBondContact O-N 2.93Å; M13-G15 VanDerWaalsContact C-N 3.34Å; M13-G15 PolarHBondContact O-N 3.25Å; G15-S17 VanDerWaalsContact C-N 3.34Å; G15-S17 PolarHBondContact O-N 3.01Å; G15-V18 PolarHBondContact O-N 3.44Å; G15-L19 WeakPolarHBondContact O-CB 3.39Å; G15-L19 VanDerWaalsContact O-CG 3.29Å; G15-L19 WeakPolarHBondContact O-CG 3.31Å; G15-L19 PolarHBondContact O-N 3.06Å
16	A	98.4	Very high	96.8	Very high	55 Å²	55	91 Å²	91	46%	0.455	49%	0.488	S	S	.	.	H	α-helix	trans	-60.4	-42.4	176.5	0	0	0	0	0	112.2	R12 M13 L19 A20	R12-A16 WeakPolarHBondContact O-CB 3.41Å; R12-A16 PolarHBondContact O-N 2.95Å; M13-A16 PolarHBondContact O-N 3.46Å; A16-L19 PolarHBondContact O-N 3.32Å; A16-A20 WeakPolarHBondContact O-CB 3.49Å; A16-A20 PolarHBondContact O-N 3.24Å
17	S	98.3	Very high	96.8	Very high	66 Å²	66	93.8 Å²	93.8	46%	0.462	50%	0.503	S	S	.	.	H	α-helix	trans	-62.9	-44.4	177.3	-60.5	0	0	0	0	112.5	M13 L14 G15 A20 M21	M13-S17 PolarHBondContact O-N 3.14Å; M13-S17 PolarHBondContact O-OG 3.32Å; M13-S17 VanDerWaalsContact O-OG 3.08Å; L14-S17 PolarHBondContact O-N 3.14Å; G15-S17 VanDerWaalsContact C-N 3.34Å; G15-S17 PolarHBondContact O-N 3.01Å; S17-A20 PolarHBondContact O-N 3.47Å; S17-M21 PolarHBondContact O-N 3.07Å
18	V	98.6	Very high	96.8	Very high	55 Å²	55	89.6 Å²	89.6	33%	0.333	50%	0.495	S	S	.	.	H	α-helix	trans	-65.2	-43	177.4	172.7	0	0	0	0	111	L14 G15 M21 F22	L14-V18 WeakPolarHBondContact O-CG2 3.42Å; L14-V18 PolarHBondContact O-N 3.44Å; G15-V18 PolarHBondContact O-N 3.44Å; V18-M21 HydrophobicContact CG1-CE 4.49Å; V18-M21 WeakPolarHBondContact O-CB 3.2Å; V18-M21 PolarHBondContact O-N 3.16Å; V18-F22 HydrophobicContact CG1-CD2 3.98Å; V18-F22 HydrophobicContact CG1-CE2 3.44Å; V18-F22 VanDerWaalsContact CG1-CE2 3.44Å; V18-F22 HydrophobicContact CG1-CZ 3.77Å; V18-F22 PolarHBondContact O-N 2.96Å
19	L	98.6	Very high	96.5	Very high	122 Å²	122	89.7 Å²	89.7	64%	0.639	49%	0.489	S	S	*	.	H	α-helix	trans	-63.4	-41.8	176.5	-71.6	174.2	0	0	0	112	G15 A16 M21 F22 A23	G15-L19 WeakPolarHBondContact O-CB 3.39Å; G15-L19 VanDerWaalsContact O-CG 3.29Å; G15-L19 WeakPolarHBondContact O-CG 3.31Å; G15-L19 PolarHBondContact O-N 3.06Å; A16-L19 PolarHBondContact O-N 3.32Å; L19-M21 VanDerWaalsContact C-N 3.31Å; L19-M21 PolarHBondContact O-N 3.06Å; L19-F22 PolarHBondContact O-N 3.19Å; L19-A23 WeakPolarHBondContact O-CB 3.29Å; L19-A23 PolarHBondContact O-N 2.65Å
20	A	98.4	Very high	96.3	Very high	64 Å²	64	88 Å²	88	53%	0.529	49%	0.487	S	S	.	.	H	α-helix	trans	-62	-40.1	175.4	0	0	0	0	0	111.8	A16 S17 A23 G24	A16-A20 WeakPolarHBondContact O-CB 3.49Å; A16-A20 PolarHBondContact O-N 3.24Å; S17-A20 PolarHBondContact O-N 3.47Å; A20-A23 PolarHBondContact O-N 3Å; A20-G24 PolarHBondContact O-N 3.36Å
21	M	98.4	Very high	96	Very high	117 Å²	117	87.2 Å²	87.2	58%	0.576	48%	0.484	S	S	*	.	H	α-helix	trans	-60.5	-47.8	174.7	-178.9	-174.5	71.9	0	0	111.7	S17 V18 L19 G24 A25	S17-M21 PolarHBondContact O-N 3.07Å; V18-M21 HydrophobicContact CG1-CE 4.49Å; V18-M21 WeakPolarHBondContact O-CB 3.2Å; V18-M21 PolarHBondContact O-N 3.16Å; L19-M21 VanDerWaalsContact C-N 3.31Å; L19-M21 PolarHBondContact O-N 3.06Å; M21-G24 PolarHBondContact O-N 3.49Å; M21-A25 PolarHBondContact O-N 2.95Å
22	F	98	Very high	95.6	Very high	124 Å²	124	87.5 Å²	87.5	54%	0.544	48%	0.48	S	S	.	.	H	α-helix	trans	-65.4	-40.5	177.4	-65.7	-30.4	0	0	0	112.8	V18 L19 A25 Q26	V18-F22 HydrophobicContact CG1-CD2 3.98Å; V18-F22 HydrophobicContact CG1-CE2 3.44Å; V18-F22 VanDerWaalsContact CG1-CE2 3.44Å; V18-F22 HydrophobicContact CG1-CZ 3.77Å; V18-F22 PolarHBondContact O-N 2.96Å; L19-F22 PolarHBondContact O-N 3.19Å; F22-A25 PolarHBondContact O-N 3.37Å; F22-Q26 WeakPolarHBondContact O-CB 3.19Å; F22-Q26 PolarHBondContact O-N 3.07Å
23	A	97.7	Very high	95.2	Very high	56 Å²	56	82.4 Å²	82.4	46%	0.463	47%	0.467	S	S	.	.	H	α-helix	trans	-61.3	-45.1	175.6	0	0	0	0	0	111.3	L19 A20 Q26 V27	L19-A23 WeakPolarHBondContact O-CB 3.29Å; L19-A23 PolarHBondContact O-N 2.65Å; A20-A23 PolarHBondContact O-N 3Å; A23-Q26 PolarHBondContact O-N 3.49Å; A23-V27 VanDerWaalsContact O-CG2 3.3Å; A23-V27 WeakPolarHBondContact O-CG2 3.48Å; A23-V27 PolarHBondContact O-N 2.94Å
24	G	96.8	Very high	94.7	Very high	39 Å²	39	78.7 Å²	78.7	40%	0.402	45%	0.452	S	S	.	.	H	α-helix	trans	-61	-45.1	175.9	0	0	0	0	0	112.8	A20 M21 Q26 V27 V28	A20-G24 PolarHBondContact O-N 3.36Å; M21-G24 PolarHBondContact O-N 3.49Å; G24-Q26 PolarHBondContact O-N 3.33Å; G24-V27 PolarHBondContact O-N 3.48Å; G24-V28 PolarHBondContact O-N 2.85Å
25	A	95.6	Very high	94.1	Very high	47 Å²	47	79.6 Å²	79.6	39%	0.388	46%	0.458	S	S	.	.	H	α-helix	trans	-59	-46.4	175.1	0	0	0	0	0	111.3	M21 F22 V27 V28 H29	M21-A25 PolarHBondContact O-N 2.95Å; F22-A25 PolarHBondContact O-N 3.37Å; A25-V27 VanDerWaalsContact C-N 3.33Å; A25-V27 PolarHBondContact O-N 2.89Å; A25-V28 WeakPolarHBondContact O-CG2 3.3Å; A25-V28 PolarHBondContact O-N 3.11Å; A25-H29 PolarHBondContact O-CD2 2.99Å; A25-H29 VanDerWaalsContact O-CD2 3.25Å; A25-H29 PolarHBondContact O-N 2.96Å
26	Q	95.5	Very high	93.5	Very high	106 Å²	106	84 Å²	84	50%	0.495	47%	0.473	S	S	.	.	H	α-helix	trans	-63.5	-39.8	178.9	-175.8	65	-5.4	0	0	112.3	F22 A23 G24 V28 H29 Q30	F22-Q26 WeakPolarHBondContact O-CB 3.19Å; F22-Q26 PolarHBondContact O-N 3.07Å; A23-Q26 PolarHBondContact O-N 3.49Å; G24-Q26 PolarHBondContact O-N 3.33Å; Q26-V28 VanDerWaalsContact C-N 3.34Å; Q26-V28 PolarHBondContact O-N 3.29Å; Q26-H29 PolarHBondContact O-N 3.39Å; Q26-Q30 HydrophobicContact CG-CG 4.3Å; Q26-Q30 VanDerWaalsContact NE2-NE2 3.16Å; Q26-Q30 VanDerWaalsContact O-CG 3.29Å; Q26-Q30 WeakPolarHBondContact O-CG 3.42Å; Q26-Q30 PolarHBondContact O-N 3.47Å
27	V	95.2	Very high	92.9	Very high	95 Å²	95	85.1 Å²	85.1	58%	0.576	48%	0.478	S	S	*	.	H	α-helix	trans	-59.7	-44.1	178.2	168	0	0	0	0	111.4	A23 G24 A25 H29 Q30 Y31	A23-V27 VanDerWaalsContact O-CG2 3.3Å; A23-V27 WeakPolarHBondContact O-CG2 3.48Å; A23-V27 PolarHBondContact O-N 2.94Å; G24-V27 PolarHBondContact O-N 3.48Å; A25-V27 VanDerWaalsContact C-N 3.33Å; A25-V27 PolarHBondContact O-N 2.89Å; V27-H29 PolarHBondContact O-N 2.91Å; V27-Q30 PolarHBondContact O-N 2.88Å; V27-Y31 WeakPolarHBondContact O-CB 3.2Å; V27-Y31 PolarHBondContact O-N 2.93Å
28	V	92.4	Very high	92.2	Very high	73 Å²	73	89.5 Å²	89.5	44%	0.442	49%	0.494	S	S	.	.	H	α-helix	trans	-67.9	-36.4	179.2	-61.7	0	0	0	0	112.2	G24 A25 Q26 Y31 Y32	G24-V28 PolarHBondContact O-N 2.85Å; A25-V28 WeakPolarHBondContact O-CG2 3.3Å; A25-V28 PolarHBondContact O-N 3.11Å; Q26-V28 VanDerWaalsContact C-N 3.34Å; Q26-V28 PolarHBondContact O-N 3.29Å; V28-Y31 PolarHBondContact O-N 3.2Å; V28-Y32 HydrophobicContact CB-CD2 4.29Å; V28-Y32 WeakPolarHBondContact O-CD2 3.49Å; V28-Y32 PolarHBondContact O-N 3.3Å
29	H	90.3	Very high	91.5	Very high	79 Å²	79	90.6 Å²	90.6	37%	0.366	50%	0.502	S	S	.	.	H	α-helix	trans	-63.7	-41.7	174.1	-86.3	-92	0	0	0	112	A25 Q26 V27 L33 P34	A25-H29 PolarHBondContact O-CD2 2.99Å; A25-H29 VanDerWaalsContact O-CD2 3.25Å; A25-H29 PolarHBondContact O-N 2.96Å; Q26-H29 PolarHBondContact O-N 3.39Å; V27-H29 PolarHBondContact O-N 2.91Å; H29-L33 WeakPolarHBondContact O-CA 3.04Å; H29-L33 PolarHBondContact O-N 3.17Å; H29-P34 WeakPolarHBondContact O-CD 3.33Å
30	Q	89.6	Confident	90.9	Very high	122 Å²	122	94.2 Å²	94.2	57%	0.57	52%	0.516	S	S	*	.	H	α-helix	trans	-71.4	-34.1	176.9	-67	-67.4	-23.7	0	0	112.4	Q26 V27	Q26-Q30 HydrophobicContact CG-CG 4.3Å; Q26-Q30 VanDerWaalsContact NE2-NE2 3.16Å; Q26-Q30 VanDerWaalsContact O-CG 3.29Å; Q26-Q30 WeakPolarHBondContact O-CG 3.42Å; Q26-Q30 PolarHBondContact O-N 3.47Å; V27-Q30 PolarHBondContact O-N 2.88Å
31	Y	89.6	Confident	90.4	Very high	79 Å²	79	97.8 Å²	97.8	31%	0.31	52%	0.524	S	S	.	.	H	α-helix	trans	-77.1	-47.4	-176.1	-172.7	-94.6	0	0	0	112.5	V27 V28 Y55	V27-Y31 WeakPolarHBondContact O-CB 3.2Å; V27-Y31 PolarHBondContact O-N 2.93Å; V28-Y31 PolarHBondContact O-N 3.2Å; Y31-Y55 AromaticContact CE1-CE2 3.78Å; Y31-Y55 HydrophobicContact CE1-CE2 3.78Å; Y31-Y55 AromaticContact CE1-CZ 3.72Å; Y31-Y55 WeakPolarHBondContact CE1-OH 3.29Å; Y31-Y55 AromaticContact CZ-CZ 3.95Å; Y31-Y55 PolarHBondContact OH-OH 2.88Å
32	Y	87.8	Confident	89.7	Confident	99 Å²	99	97.2 Å²	97.2	39%	0.388	53%	0.53	S	S	.	.	H	α-helix	trans	-91.2	-18.1	-178.1	-66.7	-69.7	0	0	0	113.4	V28 L52 G54 Y55	V28-Y32 HydrophobicContact CB-CD2 4.29Å; V28-Y32 WeakPolarHBondContact O-CD2 3.49Å; V28-Y32 PolarHBondContact O-N 3.3Å; Y32-L52 HydrophobicContact CD1-CD2 3.97Å; Y32-G54 PolarHBondContact O-N 3.28Å; Y32-Y55 AromaticContact CD1-CE2 3.96Å; Y32-Y55 HydrophobicContact CD1-CE2 3.96Å; Y32-Y55 AromaticContact CE1-CE2 3.79Å; Y32-Y55 HydrophobicContact CE1-CE2 3.79Å
33	L	88	Confident	89.1	Confident	86 Å²	86	93.8 Å²	93.8	45%	0.45	52%	0.52	S	S	.	.			trans	44.8	57.3	-176.5	-153.3	90.1	0	0	0	111.6	H29 D35 H53	H29-L33 WeakPolarHBondContact O-CA 3.04Å; H29-L33 PolarHBondContact O-N 3.17Å; L33-D35 PolarHBondContact O-N 3.27Å; L33-H53 HydrophobicContact CB-CB 4.47Å; L33-H53 HydrophobicContact CD2-CB 4.31Å
34	P	86	Confident	88.5	Confident	53 Å²	53	97.7 Å²	97.7	34%	0.344	53%	0.527	S	S	.	.			trans	-61.2	141.4	-175.6	27.6	-34.3	0	0	0	110.1	H29 L36	H29-P34 WeakPolarHBondContact O-CD 3.33Å; P34-L36 HydrophobicContact CG-CD2 4.41Å; P34-L36 PolarHBondContact O-N 3.31Å
35	D	85.6	Confident	87.9	Confident	103 Å²	103	102.3 Å²	102.3	55%	0.551	55%	0.549	S	S	*	.			trans	-68.3	118.1	167.9	-175.6	12	0	0	0	108.8	L33 S37	L33-D35 PolarHBondContact O-N 3.27Å; D35-S37 VanDerWaalsContact CG-OG 3.24Å; D35-S37 WeakPolarHBondContact OD1-CB 3.39Å; D35-S37 PolarHBondContact OD1-N 3.43Å; D35-S37 PolarHBondContact OD1-OG 3.25Å; D35-S37 PolarHBondContact OD2-OG 3.25Å
36	L	84.9	Confident	87.1	Confident	125 Å²	125	103.9 Å²	103.9	65%	0.654	57%	0.57	S	S	*	*			trans	-99.5	3.7	179.1	-63.5	171.8	0	0	0	111.7	P34 I38	P34-L36 HydrophobicContact CG-CD2 4.41Å; P34-L36 PolarHBondContact O-N 3.31Å; L36-I38 PolarHBondContact O-N 3.48Å
37	S	85.4	Confident	86.5	Confident	78 Å²	78	104.2 Å²	104.2	55%	0.545	57%	0.571	S	S	.	*			trans	-66.9	131.7	174.5	77.8	0	0	0	0	109.9	D35	D35-S37 VanDerWaalsContact CG-OG 3.24Å; D35-S37 WeakPolarHBondContact OD1-CB 3.39Å; D35-S37 PolarHBondContact OD1-N 3.43Å; D35-S37 PolarHBondContact OD1-OG 3.25Å; D35-S37 PolarHBondContact OD2-OG 3.25Å
38	I	83.3	Confident	85.8	Confident	158 Å²	158	105.6 Å²	105.6	81%	0.81	58%	0.575	S	S	*	*			trans	-104.7	114.4	174.7	-56.3	179.6	0	0	0	106.6	L36	L36-I38 PolarHBondContact O-N 3.48Å
39	P	84.4	Confident	84.9	Confident	77 Å²	77	112.5 Å²	112.5	50%	0.5	59%	0.593	S	S	.	*			trans	-68.2	140.6	175.8	29.1	-33.9	0	0	0	109.8	I41	P39-I41 PolarHBondContact O-N 3.42Å
40	E	86.8	Confident	84.2	Confident	198 Å²	198	115 Å²	115	93%	0.925	61%	0.614	S	S	*	*	S	Bend	trans	-59	-34.3	176.7	-72.6	-174.2	165.5	0	0	112.3
41	I	88.1	Confident	83.7	Confident	139 Å²	139	113.2 Å²	113.2	71%	0.713	61%	0.606	S	S	*	*	S	Bend	trans	-104.5	120	176.7	-57.7	172.4	0	0	0	107.8	P39	P39-I41 PolarHBondContact O-N 3.42Å
42	P	83.4	Confident	83.3	Confident	105 Å²	105	113.9 Å²	113.9	68%	0.682	61%	0.614	S	S	*	*	P	Polyproline II helix	trans	-58.2	136.3	175.5	-22.6	32.2	0	0	0	110.8
43	P	84.3	Confident	83	Confident	53 Å²	53	112.4 Å²	112.4	34%	0.344	61%	0.611	S	S	.	*	P	Polyproline II helix	trans	-62.3	149.8	174.4	25.8	-32.5	0	0	0	110	E47 L48	P43-E47 HydrophobicContact CB-CB 4.48Å; P43-L48 HydrophobicContact CB-CG 4.47Å; P43-L48 HydrophobicContact CG-CD2 3.44Å; P43-L48 VanDerWaalsContact CG-CD2 3.44Å; P43-L48 HydrophobicContact CG-CG 3.76Å
44	K	85.7	Confident	82.8	Confident	138 Å²	138	108.6 Å²	108.6	60%	0.6	59%	0.593	S	S	*	*	P	Polyproline II helix	trans	-64.2	152.6	176.8	-61.8	176.5	-173	162.3	0	109.8	G46 E47	K44-G46 PolarHBondContact O-N 2.92Å; K44-G46 VanDerWaalsContact O-N 3.11Å; K44-E47 HydrophobicContact CB-CG 4.18Å; K44-E47 WeakPolarHBondContact CB-OE2 3.36Å; K44-E47 PolarHBondContact O-N 2.97Å
45	P	83.3	Confident	82.7	Confident	135 Å²	135	110.8 Å²	110.8	88%	0.877	60%	0.595	S	S	*	*	T	Hydrogen-bonded Turn	trans	-51.8	121.6	174.9	-25.3	34.1	0	0	0	110.8
46	G	80.3	Confident	82.7	Confident	80 Å²	80	110.2 Å²	110.2	83%	0.825	59%	0.587	S	S	*	*	T	Hydrogen-bonded Turn	trans	92.9	-8.8	-177.9	0	0	0	0	0	116.1	K44	K44-G46 PolarHBondContact O-N 2.92Å; K44-G46 VanDerWaalsContact O-N 3.11Å
47	E	81.9	Confident	82.7	Confident	113 Å²	113	106.5 Å²	106.5	53%	0.528	58%	0.575	S	S	.	*			trans	-95	2.3	176.4	-66.7	-179.7	173.3	0	0	113.3	P43 K44 R49	P43-E47 HydrophobicContact CB-CB 4.48Å; K44-E47 HydrophobicContact CB-CG 4.18Å; K44-E47 WeakPolarHBondContact CB-OE2 3.36Å; K44-E47 PolarHBondContact O-N 2.97Å; E47-R49 PolarHBondContact O-N 3.37Å
48	L	80.2	Confident	82.7	Confident	124 Å²	124	109.9 Å²	109.9	65%	0.649	58%	0.576	S	S	*	*			trans	-62.1	109	176.5	-81.2	156.6	0	0	0	110.5	P43 T50	P43-L48 HydrophobicContact CB-CG 4.47Å; P43-L48 HydrophobicContact CG-CD2 3.44Å; P43-L48 VanDerWaalsContact CG-CD2 3.44Å; P43-L48 HydrophobicContact CG-CG 3.76Å; L48-T50 PolarHBondContact O-N 3.38Å
49	R	74.8	Confident	82.9	Confident	219 Å²	219	109 Å²	109	83%	0.826	57%	0.568	S	S	*	*			trans	-82.1	116.3	172.8	-64.4	-174	179.6	-175.5	-0.2	109	E47	E47-R49 PolarHBondContact O-N 3.37Å
50	T	75.8	Confident	83.1	Confident	132 Å²	132	111.7 Å²	111.7	81%	0.81	57%	0.574	S	S	*	*			trans	-113.4	80.3	175.2	46.5	0	0	0	0	108.6	L48	L48-T50 PolarHBondContact O-N 3.38Å
51	E	77.8	Confident	83.1	Confident	83 Å²	83	105 Å²	105	39%	0.388	55%	0.553	S	S	.	*			trans	-91.2	142.4	178.6	-60.4	-163.4	164.7	0	0	111.4	H53 K56	E51-H53 PolarHBondContact O-N 2.89Å; E51-H53 IonicContact OE2-CE1 3.58Å; E51-K56 IonicContact OE1-NZ 3.47Å; E51-K56 PolarHBondContact OE1-NZ 2.99Å; E51-K56 IonicContact OE2-NZ 2.65Å; E51-K56 PolarHBondContact OE2-NZ 3.26Å
52	L	82.1	Confident	83.1	Confident	94 Å²	94	100.9 Å²	100.9	49%	0.492	54%	0.54	S	S	.	.			trans	-88.3	74.9	174.4	-59.5	179.9	0	0	0	110.2	Y32 G54 Y55 K56	Y32-L52 HydrophobicContact CD1-CD2 3.97Å; L52-G54 PolarHBondContact O-N 2.93Å; L52-G54 VanDerWaalsContact O-N 3.16Å; L52-Y55 HydrophobicContact CB-CD2 3.86Å; L52-Y55 HydrophobicContact CD1-CD2 3.91Å; L52-Y55 HydrophobicContact CD1-CE2 4.01Å; L52-Y55 HydrophobicContact CG-CD2 4.47Å; L52-Y55 PolarHBondContact O-N 3.44Å; L52-Y55 VanDerWaalsContact O-N 3.07Å; L52-K56 PolarHBondContact O-N 3.24Å
53	H	81.6	Confident	83.4	Confident	67 Å²	67	98.7 Å²	98.7	31%	0.31	53%	0.53	S	S	.	.	H	α-helix	trans	-55.6	-34.1	-176	-63.8	-65.6	0	0	0	113.2	L33 E51 Y55 K56 A57	L33-H53 HydrophobicContact CB-CB 4.47Å; L33-H53 HydrophobicContact CD2-CB 4.31Å; E51-H53 PolarHBondContact O-N 2.89Å; E51-H53 IonicContact OE2-CE1 3.58Å; H53-Y55 VanDerWaalsContact C-N 3.32Å; H53-Y55 PolarHBondContact O-N 3.3Å; H53-K56 PolarHBondContact O-N 2.93Å; H53-A57 WeakPolarHBondContact O-CB 3.41Å; H53-A57 PolarHBondContact O-N 2.92Å
54	G	84.2	Confident	83.5	Confident	7 Å²	7	99.2 Å²	99.2	7%	0.072	54%	0.539	C	S	.	.	H	α-helix	trans	-61.5	-34.7	177.8	0	0	0	0	0	114.3	Y32 L52 R58	Y32-G54 PolarHBondContact O-N 3.28Å; L52-G54 PolarHBondContact O-N 2.93Å; L52-G54 VanDerWaalsContact O-N 3.16Å; G54-R58 WeakPolarHBondContact O-CG 3.41Å; G54-R58 PolarHBondContact O-N 3.46Å
55	Y	83.1	Confident	83.4	Confident	99 Å²	99	100.5 Å²	100.5	39%	0.388	55%	0.545	S	S	.	.	H	α-helix	trans	-72	-46.2	175.8	-81.1	-92.1	0	0	0	111.5	Y31 Y32 L52 H53 A57 R58 E59	Y31-Y55 AromaticContact CE1-CE2 3.78Å; Y31-Y55 HydrophobicContact CE1-CE2 3.78Å; Y31-Y55 AromaticContact CE1-CZ 3.72Å; Y31-Y55 WeakPolarHBondContact CE1-OH 3.29Å; Y31-Y55 AromaticContact CZ-CZ 3.95Å; Y31-Y55 PolarHBondContact OH-OH 2.88Å; Y32-Y55 AromaticContact CD1-CE2 3.96Å; Y32-Y55 HydrophobicContact CD1-CE2 3.96Å; Y32-Y55 AromaticContact CE1-CE2 3.79Å; Y32-Y55 HydrophobicContact CE1-CE2 3.79Å; L52-Y55 HydrophobicContact CB-CD2 3.86Å; L52-Y55 HydrophobicContact CD1-CD2 3.91Å; L52-Y55 HydrophobicContact CD1-CE2 4.01Å; L52-Y55 HydrophobicContact CG-CD2 4.47Å; L52-Y55 PolarHBondContact O-N 3.44Å; L52-Y55 VanDerWaalsContact O-N 3.07Å; H53-Y55 VanDerWaalsContact C-N 3.32Å; H53-Y55 PolarHBondContact O-N 3.3Å; Y55-A57 PolarHBondContact O-N 3.4Å; Y55-R58 PolarHBondContact O-N 3.41Å; Y55-R58 VanDerWaalsContact O-N 3.14Å; Y55-E59 PolarHBondContact O-N 3.31Å
56	K	85.4	Confident	83.3	Confident	90 Å²	90	101.1 Å²	101.1	39%	0.391	54%	0.536	S	S	.	.	H	α-helix	trans	-57.7	-47.9	177.4	-68.2	-174.9	177.8	-178.5	0	111.6	E51 L52 H53 R58 E59 E60	E51-K56 IonicContact OE1-NZ 3.47Å; E51-K56 PolarHBondContact OE1-NZ 2.99Å; E51-K56 IonicContact OE2-NZ 2.65Å; E51-K56 PolarHBondContact OE2-NZ 3.26Å; L52-K56 PolarHBondContact O-N 3.24Å; H53-K56 PolarHBondContact O-N 2.93Å; K56-R58 PolarHBondContact O-N 3.04Å; K56-E59 PolarHBondContact O-N 2.93Å; K56-E59 VanDerWaalsContact O-N 3.14Å; K56-E60 WeakPolarHBondContact O-CG 3.44Å; K56-E60 PolarHBondContact O-N 2.89Å
57	A	85.9	Confident	83.1	Confident	48 Å²	48	100.7 Å²	100.7	40%	0.397	53%	0.531	S	S	.	.	H	α-helix	trans	-59.3	-34.6	178.6	0	0	0	0	0	112.7	H53 Y55 A61	H53-A57 WeakPolarHBondContact O-CB 3.41Å; H53-A57 PolarHBondContact O-N 2.92Å; Y55-A57 PolarHBondContact O-N 3.4Å; A57-A61 VanDerWaalsContact O-CB 3.31Å; A57-A61 WeakPolarHBondContact O-CB 3.33Å; A57-A61 PolarHBondContact O-N 3.44Å
58	R	85.6	Confident	82.9	Confident	148 Å²	148	102.6 Å²	102.6	56%	0.558	54%	0.544	S	S	*	.	H	α-helix	trans	-72.6	-40.4	175.5	-79.5	-177.9	173.2	-171.3	-1.3	113	G54 Y55 K56 A61 A62	G54-R58 WeakPolarHBondContact O-CG 3.41Å; G54-R58 PolarHBondContact O-N 3.46Å; Y55-R58 PolarHBondContact O-N 3.41Å; Y55-R58 VanDerWaalsContact O-N 3.14Å; K56-R58 PolarHBondContact O-N 3.04Å; R58-A61 PolarHBondContact O-N 3.34Å; R58-A62 WeakPolarHBondContact O-CB 3.13Å; R58-A62 PolarHBondContact O-N 3.02Å
59	E	87.1	Confident	81.8	Confident	139 Å²	139	108.3 Å²	108.3	65%	0.65	56%	0.564	S	S	*	*	H	α-helix	trans	-62.5	-45.9	175.2	-72	-174.1	151.2	0	0	111.2	Y55 K56 A61 A62 A63	Y55-E59 PolarHBondContact O-N 3.31Å; K56-E59 PolarHBondContact O-N 2.93Å; K56-E59 VanDerWaalsContact O-N 3.14Å; E59-A61 PolarHBondContact O-N 3.1Å; E59-A62 PolarHBondContact O-N 3.21Å; E59-A63 WeakPolarHBondContact O-CB 3.45Å; E59-A63 PolarHBondContact O-N 3.08Å
60	E	89	Confident	82.2	Confident	134 Å²	134	102.8 Å²	102.8	63%	0.626	55%	0.551	S	S	*	*	H	α-helix	trans	-60.1	-45.6	176.1	-71.3	172.8	-169.2	0	0	111.7	K56 A62 A63 A64	K56-E60 WeakPolarHBondContact O-CG 3.44Å; K56-E60 PolarHBondContact O-N 2.89Å; E60-A62 PolarHBondContact O-N 3.42Å; E60-A63 PolarHBondContact O-N 3.48Å; E60-A64 WeakPolarHBondContact O-CB 3.46Å; E60-A64 PolarHBondContact O-N 3.14Å
61	A	86.1	Confident	82.5	Confident	59 Å²	59	101.3 Å²	101.3	49%	0.488	54%	0.537	S	S	.	.	H	α-helix	trans	-62.2	-41.3	176.3	0	0	0	0	0	112.3	A57 R58 E59 A64 F65	A57-A61 VanDerWaalsContact O-CB 3.31Å; A57-A61 WeakPolarHBondContact O-CB 3.33Å; A57-A61 PolarHBondContact O-N 3.44Å; R58-A61 PolarHBondContact O-N 3.34Å; E59-A61 PolarHBondContact O-N 3.1Å; A61-A64 PolarHBondContact O-N 2.87Å; A61-F65 WeakPolarHBondContact O-CB 3.39Å; A61-F65 PolarHBondContact O-N 2.97Å
62	A	87.9	Confident	82.8	Confident	52 Å²	52	102.3 Å²	102.3	43%	0.43	55%	0.546	S	S	.	.	H	α-helix	trans	-65.6	-42.5	177.6	0	0	0	0	0	111.9	R58 E59 E60 F65 Q66	R58-A62 WeakPolarHBondContact O-CB 3.13Å; R58-A62 PolarHBondContact O-N 3.02Å; E59-A62 PolarHBondContact O-N 3.21Å; E60-A62 PolarHBondContact O-N 3.42Å; A62-F65 PolarHBondContact O-N 3.24Å; A62-Q66 WeakPolarHBondContact O-CG 3.24Å; A62-Q66 PolarHBondContact O-N 3.01Å; A62-Q66 VanDerWaalsContact O-N 3.14Å
63	A	88.9	Confident	82.8	Confident	59 Å²	59	102.8 Å²	102.8	49%	0.488	55%	0.549	S	S	.	.	H	α-helix	trans	-64.5	-43	176.4	0	0	0	0	0	112.1	E59 E60 F65 Q66 G67	E59-A63 WeakPolarHBondContact O-CB 3.45Å; E59-A63 PolarHBondContact O-N 3.08Å; E60-A63 PolarHBondContact O-N 3.48Å; A63-F65 VanDerWaalsContact C-N 3.31Å; A63-F65 PolarHBondContact O-N 3.45Å; A63-Q66 PolarHBondContact O-N 3.32Å; A63-G67 PolarHBondContact O-N 2.98Å; A63-G67 VanDerWaalsContact O-N 3.12Å
64	A	88	Confident	82.9	Confident	63 Å²	63	105 Å²	105	52%	0.521	56%	0.564	S	S	.	*	H	α-helix	trans	-61.9	-38.9	175.8	0	0	0	0	0	112.2	E60 A61 Q66 G67 L68	E60-A64 WeakPolarHBondContact O-CB 3.46Å; E60-A64 PolarHBondContact O-N 3.14Å; A61-A64 PolarHBondContact O-N 2.87Å; A64-Q66 VanDerWaalsContact C-N 3.31Å; A64-Q66 PolarHBondContact O-N 3.42Å; A64-G67 PolarHBondContact O-N 2.97Å; A64-L68 PolarHBondContact O-N 2.96Å
65	F	83	Confident	82.8	Confident	166 Å²	166	111.5 Å²	111.5	73%	0.728	60%	0.596	S	S	*	*	H	α-helix	trans	-67.3	-30.8	176.9	-133.7	-87.9	0	0	0	112.9	A61 A62 A63	A61-F65 WeakPolarHBondContact O-CB 3.39Å; A61-F65 PolarHBondContact O-N 2.97Å; A62-F65 PolarHBondContact O-N 3.24Å; A63-F65 VanDerWaalsContact C-N 3.31Å; A63-F65 PolarHBondContact O-N 3.45Å
66	Q	81.4	Confident	82.8	Confident	148 Å²	148	112.4 Å²	112.4	69%	0.692	61%	0.611	S	S	*	*	H	α-helix	trans	-73.8	-36	175.4	-72.6	177.7	4.2	0	0	112.5	A62 A63 A64 L68 K69	A62-Q66 WeakPolarHBondContact O-CG 3.24Å; A62-Q66 PolarHBondContact O-N 3.01Å; A62-Q66 VanDerWaalsContact O-N 3.14Å; A63-Q66 PolarHBondContact O-N 3.32Å; A64-Q66 VanDerWaalsContact C-N 3.31Å; A64-Q66 PolarHBondContact O-N 3.42Å; Q66-L68 VanDerWaalsContact C-N 3.26Å; Q66-L68 PolarHBondContact O-N 3.37Å; Q66-K69 PolarHBondContact O-N 3.4Å
67	G	74.8	Confident	82.6	Confident	70 Å²	70	114.2 Å²	114.2	72%	0.722	63%	0.628	S	S	*	*	H	α-helix	trans	-73.4	-15.4	176.8	0	0	0	0	0	114.7	A63 A64	A63-G67 PolarHBondContact O-N 2.98Å; A63-G67 VanDerWaalsContact O-N 3.12Å; A64-G67 PolarHBondContact O-N 2.97Å
68	L	77.6	Confident	82.3	Confident	154 Å²	154	119.7 Å²	119.7	81%	0.806	65%	0.647	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.3	-5.6	177.1	-113	155.6	0	0	0	113.5	A64 Q66	A64-L68 PolarHBondContact O-N 2.96Å; Q66-L68 VanDerWaalsContact C-N 3.26Å; Q66-L68 PolarHBondContact O-N 3.37Å
69	K	58.3	Low	82	Confident	244 Å²	244	117.1 Å²	117.1	100%	1.061	66%	0.655	S	S	*	*			trans	-108.9	0	-173.7	-145	-177.9	-169.6	-179.7	0	111.1	Q66	Q66-K69 PolarHBondContact O-N 3.4Å

Retrieved 69 of 69 residues in 80.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).