A0A087YH71_POEFO Loading...

Progonadoliberin

Stimulates the secretion of gonadotropins.

AlphaFold DB , UniProt , Accession A0A087YH71, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 89 aa.

						>A0A087YH71_POEFO|A0A087YH71
MKASSRVMVQVLLLALLAQVTLCQHWSYGWLPGGKRSVGELEATIRMMGTGGVVSLPEEASAQTQERLRPHNINDGSSHFDRNKRFLNK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61.1	Low	85.2	Confident	211 Å²	211	118.7 Å²	118.7	100%	1.039	63%	0.628	S	S	*	*				0	-15.1	0	-59.7	176.1	88.2	0	0	115.1	S4	M1-S4 PolarHBondContact O-OG 3.48Å
2	K	68.1	Low	86.1	Confident	184 Å²	184	118 Å²	118	80%	0.8	62%	0.623	S	S	*	*	H	α-helix	trans	-77.3	-38.2	176.8	-84.6	175.1	161.3	110.4	0	114.4	S5 R6	K2-S5 PolarHBondContact O-N 3.13Å; K2-R6 PolarHBondContact O-N 3.23Å
3	A	70.1	Confident	86.9	Confident	75 Å²	75	118.3 Å²	118.3	62%	0.62	62%	0.624	S	S	*	*	H	α-helix	trans	-65.1	-42.8	179.6	0	0	0	0	0	112.2	S5 R6 V7	A3-S5 VanDerWaalsContact C-N 3.31Å; A3-S5 PolarHBondContact O-N 3.27Å; A3-R6 PolarHBondContact O-N 2.99Å; A3-V7 WeakPolarHBondContact O-CG2 3.34Å; A3-V7 PolarHBondContact O-N 3.4Å; A3-V7 VanDerWaalsContact O-N 3.13Å
4	S	84.9	Confident	87.5	Confident	77 Å²	77	118.3 Å²	118.3	54%	0.538	62%	0.624	S	S	.	*	H	α-helix	trans	-62.1	-35.7	175.9	49.3	0	0	0	0	113.1	M1 V7 M8	M1-S4 PolarHBondContact O-OG 3.48Å; S4-V7 PolarHBondContact O-N 3.01Å; S4-M8 WeakPolarHBondContact O-CB 3.42Å; S4-M8 PolarHBondContact O-N 2.94Å
5	S	88.2	Confident	88	Confident	59 Å²	59	114 Å²	114	41%	0.413	61%	0.612	S	S	.	*	H	α-helix	trans	-65.4	-41.4	175	168.2	0	0	0	0	112.3	K2 A3 M8 V9	K2-S5 PolarHBondContact O-N 3.13Å; A3-S5 VanDerWaalsContact C-N 3.31Å; A3-S5 PolarHBondContact O-N 3.27Å; S5-M8 PolarHBondContact O-N 3.28Å; S5-V9 WeakPolarHBondContact O-CG2 3.45Å; S5-V9 PolarHBondContact O-N 3.37Å; S5-V9 VanDerWaalsContact O-N 3.08Å
6	R	90.4	Very high	88.3	Confident	189 Å²	189	112.4 Å²	112.4	71%	0.713	60%	0.603	S	S	*	*	H	α-helix	trans	-64.4	-42.5	176.9	-67.3	-177.8	178.9	-153.9	-1.3	112	K2 A3 M8 V9 Q10	K2-R6 PolarHBondContact O-N 3.23Å; A3-R6 PolarHBondContact O-N 2.99Å; R6-M8 VanDerWaalsContact C-N 3.35Å; R6-V9 PolarHBondContact O-N 3.07Å; R6-Q10 WeakPolarHBondContact O-CG 3.41Å; R6-Q10 PolarHBondContact O-N 3.33Å
7	V	94.2	Very high	88.4	Confident	83 Å²	83	112.3 Å²	112.3	50%	0.503	60%	0.601	S	S	.	*	H	α-helix	trans	-62	-44	176.5	174.5	0	0	0	0	110.7	A3 S4 V9 Q10 V11	A3-V7 WeakPolarHBondContact O-CG2 3.34Å; A3-V7 PolarHBondContact O-N 3.4Å; A3-V7 VanDerWaalsContact O-N 3.13Å; S4-V7 PolarHBondContact O-N 3.01Å; V7-V9 VanDerWaalsContact C-N 3.34Å; V7-V9 PolarHBondContact O-N 3.36Å; V7-Q10 PolarHBondContact O-N 3.22Å; V7-V11 HydrophobicContact CG1-CG2 4.38Å; V7-V11 WeakPolarHBondContact O-CG2 3.38Å; V7-V11 PolarHBondContact O-N 3.41Å
8	M	93.6	Very high	88.3	Confident	129 Å²	129	109.1 Å²	109.1	64%	0.635	59%	0.593	S	S	*	*	H	α-helix	trans	-60.4	-42.2	177.5	-174.1	176.8	66	0	0	112.4	S4 S5 R6 V11 L12	S4-M8 WeakPolarHBondContact O-CB 3.42Å; S4-M8 PolarHBondContact O-N 2.94Å; S5-M8 PolarHBondContact O-N 3.28Å; R6-M8 VanDerWaalsContact C-N 3.35Å; M8-V11 PolarHBondContact O-N 3.39Å; M8-L12 WeakPolarHBondContact O-CB 3.44Å; M8-L12 PolarHBondContact O-N 3.4Å
9	V	94.7	Very high	88.3	Confident	86 Å²	86	109.9 Å²	109.9	52%	0.521	59%	0.593	S	S	.	*	H	α-helix	trans	-65.3	-40.5	176.4	173.6	0	0	0	0	111.5	S5 R6 V7 L12 L13	S5-V9 WeakPolarHBondContact O-CG2 3.45Å; S5-V9 PolarHBondContact O-N 3.37Å; S5-V9 VanDerWaalsContact O-N 3.08Å; R6-V9 PolarHBondContact O-N 3.07Å; V7-V9 VanDerWaalsContact C-N 3.34Å; V7-V9 PolarHBondContact O-N 3.36Å; V9-L12 PolarHBondContact O-N 3.47Å; V9-L13 WeakPolarHBondContact O-CB 3.4Å; V9-L13 PolarHBondContact O-N 2.95Å
10	Q	95.4	Very high	88	Confident	123 Å²	123	107.9 Å²	107.9	58%	0.575	58%	0.584	S	S	*	*	H	α-helix	trans	-64.2	-44.8	177.1	-75.1	176.5	-26.9	0	0	112.2	R6 V7 L12 L13 L14	R6-Q10 WeakPolarHBondContact O-CG 3.41Å; R6-Q10 PolarHBondContact O-N 3.33Å; V7-Q10 PolarHBondContact O-N 3.22Å; Q10-L12 VanDerWaalsContact C-N 3.32Å; Q10-L12 PolarHBondContact O-N 3.49Å; Q10-L13 PolarHBondContact O-N 3.34Å; Q10-L14 WeakPolarHBondContact O-CB 3.37Å; Q10-L14 WeakPolarHBondContact O-CG 3.49Å; Q10-L14 PolarHBondContact O-N 2.92Å
11	V	96.4	Very high	87.5	Confident	90 Å²	90	106.3 Å²	106.3	55%	0.545	58%	0.578	S	S	.	*	H	α-helix	trans	-62.6	-42.2	176.7	172.8	0	0	0	0	110.7	V7 M8 L14 A15	V7-V11 HydrophobicContact CG1-CG2 4.38Å; V7-V11 WeakPolarHBondContact O-CG2 3.38Å; V7-V11 PolarHBondContact O-N 3.41Å; M8-V11 PolarHBondContact O-N 3.39Å; V11-L14 PolarHBondContact O-N 2.98Å; V11-A15 WeakPolarHBondContact O-CB 3.32Å; V11-A15 PolarHBondContact O-N 3.03Å
12	L	96.3	Very high	88.1	Confident	110 Å²	110	102.1 Å²	102.1	58%	0.576	56%	0.559	S	S	*	*	H	α-helix	trans	-62	-44.8	176.7	-173	66.8	0	0	0	111.6	M8 V9 Q10 A15 L16	M8-L12 WeakPolarHBondContact O-CB 3.44Å; M8-L12 PolarHBondContact O-N 3.4Å; V9-L12 PolarHBondContact O-N 3.47Å; Q10-L12 VanDerWaalsContact C-N 3.32Å; Q10-L12 PolarHBondContact O-N 3.49Å; L12-A15 PolarHBondContact O-N 2.94Å; L12-L16 HydrophobicContact CG-CD1 4.05Å; L12-L16 WeakPolarHBondContact O-CB 3.28Å; L12-L16 WeakPolarHBondContact O-CD1 3.41Å; L12-L16 WeakPolarHBondContact O-CG 3.37Å; L12-L16 PolarHBondContact O-N 3.33Å
13	L	96.3	Very high	88.1	Confident	122 Å²	122	97 Å²	97	64%	0.639	55%	0.546	S	S	*	.	H	α-helix	trans	-64.7	-40.5	179.1	-162.2	73.1	0	0	0	112	V9 Q10 L16 L17	V9-L13 WeakPolarHBondContact O-CB 3.4Å; V9-L13 PolarHBondContact O-N 2.95Å; Q10-L13 PolarHBondContact O-N 3.34Å; L13-L16 PolarHBondContact O-N 3.08Å; L13-L17 WeakPolarHBondContact O-CB 3.4Å; L13-L17 PolarHBondContact O-N 3.12Å
14	L	96.1	Very high	87.9	Confident	118 Å²	118	100.1 Å²	100.1	62%	0.618	55%	0.548	S	S	*	.	H	α-helix	trans	-64.3	-43.7	174.8	-78.8	165.8	0	0	0	112	Q10 V11 L17 A18	Q10-L14 WeakPolarHBondContact O-CB 3.37Å; Q10-L14 WeakPolarHBondContact O-CG 3.49Å; Q10-L14 PolarHBondContact O-N 2.92Å; V11-L14 PolarHBondContact O-N 2.98Å; L14-L17 PolarHBondContact O-N 3.33Å; L14-A18 WeakPolarHBondContact O-CB 3.39Å; L14-A18 PolarHBondContact O-N 2.88Å
15	A	94	Very high	86.8	Confident	54 Å²	54	102.3 Å²	102.3	45%	0.446	55%	0.549	S	S	.	.	H	α-helix	trans	-63.1	-42.8	177.3	0	0	0	0	0	111.7	V11 L12 A18 Q19	V11-A15 WeakPolarHBondContact O-CB 3.32Å; V11-A15 PolarHBondContact O-N 3.03Å; L12-A15 PolarHBondContact O-N 2.94Å; A15-A18 PolarHBondContact O-N 2.93Å; A15-Q19 WeakPolarHBondContact O-CB 3.4Å; A15-Q19 PolarHBondContact O-N 2.92Å
16	L	93	Very high	85.4	Confident	88 Å²	88	109.8 Å²	109.8	46%	0.461	57%	0.568	S	S	.	*	H	α-helix	trans	-59.6	-46.2	174.5	-79.2	156.7	0	0	0	111.6	L12 L13 Q19 V20	L12-L16 HydrophobicContact CG-CD1 4.05Å; L12-L16 WeakPolarHBondContact O-CB 3.28Å; L12-L16 WeakPolarHBondContact O-CD1 3.41Å; L12-L16 WeakPolarHBondContact O-CG 3.37Å; L12-L16 PolarHBondContact O-N 3.33Å; L13-L16 PolarHBondContact O-N 3.08Å; L16-Q19 PolarHBondContact O-N 3.33Å; L16-V20 WeakPolarHBondContact O-CB 3.47Å; L16-V20 VanDerWaalsContact O-CG2 3.28Å; L16-V20 WeakPolarHBondContact O-CG2 3.47Å; L16-V20 PolarHBondContact O-N 3.2Å
17	L	90.3	Very high	83.7	Confident	111 Å²	111	103.6 Å²	103.6	58%	0.581	55%	0.554	S	S	*	*	H	α-helix	trans	-65.4	-40.6	178.8	-173.7	61.9	0	0	0	112.1	L13 L14 V20 T21	L13-L17 WeakPolarHBondContact O-CB 3.4Å; L13-L17 PolarHBondContact O-N 3.12Å; L14-L17 PolarHBondContact O-N 3.33Å; L17-V20 PolarHBondContact O-N 2.93Å; L17-T21 WeakPolarHBondContact O-CG2 3.34Å; L17-T21 PolarHBondContact O-N 3.48Å; L17-T21 PolarHBondContact O-OG1 3.43Å
18	A	86.8	Confident	81.8	Confident	55 Å²	55	108.9 Å²	108.9	46%	0.455	57%	0.566	S	S	.	*	H	α-helix	trans	-63.2	-44	174.8	0	0	0	0	0	111.3	L14 A15 V20 T21 L22	L14-A18 WeakPolarHBondContact O-CB 3.39Å; L14-A18 PolarHBondContact O-N 2.88Å; A15-A18 PolarHBondContact O-N 2.93Å; A18-V20 PolarHBondContact O-N 3.42Å; A18-T21 WeakPolarHBondContact CA-OG1 3.19Å; A18-T21 PolarHBondContact O-N 3.5Å; A18-T21 PolarHBondContact O-OG1 2.86Å; A18-L22 WeakPolarHBondContact O-CB 3.32Å; A18-L22 PolarHBondContact O-N 3.37Å
19	Q	87.1	Confident	80	Confident	125 Å²	125	105.4 Å²	105.4	58%	0.584	56%	0.563	S	S	*	*	H	α-helix	trans	-61.1	-47.2	176.2	-175.4	-178.5	-24.6	0	0	111.3	A15 L16 T21 L22 C23	A15-Q19 WeakPolarHBondContact O-CB 3.4Å; A15-Q19 PolarHBondContact O-N 2.92Å; L16-Q19 PolarHBondContact O-N 3.33Å; Q19-T21 PolarHBondContact O-N 2.96Å; Q19-L22 PolarHBondContact O-N 3.04Å; Q19-C23 VanDerWaalsContact O-CB 3.28Å; Q19-C23 WeakPolarHBondContact O-CB 3.37Å; Q19-C23 PolarHBondContact O-N 3.47Å; Q19-C23 PolarHBondContact O-SG 3.02Å
20	V	82.3	Confident	78	Confident	69 Å²	69	111.2 Å²	111.2	42%	0.418	58%	0.576	S	S	.	*	H	α-helix	trans	-61.5	-43.7	179.6	168.8	0	0	0	0	111.5	L16 L17 A18 C23 Q24	L16-V20 WeakPolarHBondContact O-CB 3.47Å; L16-V20 VanDerWaalsContact O-CG2 3.28Å; L16-V20 WeakPolarHBondContact O-CG2 3.47Å; L16-V20 PolarHBondContact O-N 3.2Å; L17-V20 PolarHBondContact O-N 2.93Å; A18-V20 PolarHBondContact O-N 3.42Å; V20-C23 PolarHBondContact O-N 2.96Å; V20-Q24 HydrophobicContact CG1-CG 4.48Å; V20-Q24 VanDerWaalsContact O-CB 3.32Å; V20-Q24 WeakPolarHBondContact O-CB 3.41Å; V20-Q24 WeakPolarHBondContact O-CG 3.46Å; V20-Q24 PolarHBondContact O-N 2.93Å
21	T	78.6	Confident	76.1	Confident	75 Å²	75	111.8 Å²	111.8	46%	0.46	58%	0.582	S	S	.	*	H	α-helix	trans	-69.7	-37.1	178.6	51.9	0	0	0	0	112.7	L17 A18 Q19 Q24 H25	L17-T21 WeakPolarHBondContact O-CG2 3.34Å; L17-T21 PolarHBondContact O-N 3.48Å; L17-T21 PolarHBondContact O-OG1 3.43Å; A18-T21 WeakPolarHBondContact CA-OG1 3.19Å; A18-T21 PolarHBondContact O-N 3.5Å; A18-T21 PolarHBondContact O-OG1 2.86Å; Q19-T21 PolarHBondContact O-N 2.96Å; T21-Q24 PolarHBondContact O-N 3.48Å; T21-H25 PolarHBondContact O-N 3.36Å
22	L	72.8	Confident	73.9	Confident	123 Å²	123	114 Å²	114	64%	0.644	60%	0.599	S	S	*	*	H	α-helix	trans	-69.9	-38.1	175.7	-139.9	73.1	0	0	0	111.9	A18 Q19 H25 W26	A18-L22 WeakPolarHBondContact O-CB 3.32Å; A18-L22 PolarHBondContact O-N 3.37Å; Q19-L22 PolarHBondContact O-N 3.04Å; L22-H25 WeakPolarHBondContact O-CB 3.28Å; L22-H25 PolarHBondContact O-N 3.31Å; L22-W26 PolarHBondContact O-NE1 3.4Å
23	C	68	Low	72.3	Confident	77 Å²	77	112.3 Å²	112.3	52%	0.52	61%	0.608	S	S	.	*	H	α-helix	trans	-67.4	-37.6	172.4	-70	0	0	0	0	111.8	Q19 V20 H25 W26	Q19-C23 VanDerWaalsContact O-CB 3.28Å; Q19-C23 WeakPolarHBondContact O-CB 3.37Å; Q19-C23 PolarHBondContact O-N 3.47Å; Q19-C23 PolarHBondContact O-SG 3.02Å; V20-C23 PolarHBondContact O-N 2.96Å; C23-H25 VanDerWaalsContact C-N 3.27Å; C23-H25 PolarHBondContact O-N 2.9Å; C23-W26 PolarHBondContact O-N 3.34Å
24	Q	66.1	Low	70.7	Confident	140 Å²	140	108.7 Å²	108.7	65%	0.654	60%	0.599	S	S	*	*	H	α-helix	trans	-70.4	-21.6	174.3	-75.6	178.8	34.5	0	0	113.2	V20 T21 W26	V20-Q24 HydrophobicContact CG1-CG 4.48Å; V20-Q24 VanDerWaalsContact O-CB 3.32Å; V20-Q24 WeakPolarHBondContact O-CB 3.41Å; V20-Q24 WeakPolarHBondContact O-CG 3.46Å; V20-Q24 PolarHBondContact O-N 2.93Å; T21-Q24 PolarHBondContact O-N 3.48Å; Q24-W26 PolarHBondContact O-N 2.99Å
25	H	62.2	Low	68.9	Low	122 Å²	122	113 Å²	113	57%	0.565	61%	0.613	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.2	-21.1	174.5	-172.7	71	0	0	0	112.6	T21 L22 C23 S27 Y28	T21-H25 PolarHBondContact O-N 3.36Å; L22-H25 WeakPolarHBondContact O-CB 3.28Å; L22-H25 PolarHBondContact O-N 3.31Å; C23-H25 VanDerWaalsContact C-N 3.27Å; C23-H25 PolarHBondContact O-N 2.9Å; H25-S27 PolarHBondContact O-N 3.45Å; H25-Y28 AromaticContact ND1-CD2 3.99Å
26	W	59	Low	66.9	Low	217 Å²	217	120 Å²	120	82%	0.822	63%	0.628	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.9	70.9	169	-59.3	91	0	0	0	110.1	L22 C23 Q24	L22-W26 PolarHBondContact O-NE1 3.4Å; C23-W26 PolarHBondContact O-N 3.34Å; Q24-W26 PolarHBondContact O-N 2.99Å
27	S	54.9	Low	65.2	Low	58 Å²	58	118.8 Å²	118.8	41%	0.406	63%	0.627	S	S	.	*	T	Hydrogen-bonded Turn	trans	171.8	51.9	138.2	-166	0	0	0	0	111.7	H25 G29 W30	H25-S27 PolarHBondContact O-N 3.45Å; S27-G29 PolarHBondContact O-N 3.49Å; S27-W30 WeakPolarHBondContact OG-CB 3.05Å; S27-W30 PolarHBondContact OG-N 2.88Å
28	Y	53.4	Low	63.4	Low	194 Å²	194	118 Å²	118	76%	0.761	63%	0.626	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.6	-6.8	155.2	-79.7	-79.9	0	0	0	111.9	H25	H25-Y28 AromaticContact ND1-CD2 3.99Å
29	G	55.6	Low	62	Low	56 Å²	56	117.9 Å²	117.9	58%	0.577	63%	0.631	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.9	-4.6	177.3	0	0	0	0	0	115.7	S27	S27-G29 PolarHBondContact O-N 3.49Å
30	W	54.2	Low	60.5	Low	209 Å²	209	118.3 Å²	118.3	79%	0.792	63%	0.633	S	S	*	*			trans	-121.5	43.7	-179.1	-46.3	58.4	0	0	0	112.4	S27	S27-W30 WeakPolarHBondContact OG-CB 3.05Å; S27-W30 PolarHBondContact OG-N 2.88Å
31	L	54.8	Low	59.3	Low	135 Å²	135	120.5 Å²	120.5	71%	0.707	64%	0.641	S	S	*	*	S	Bend	trans	-53.3	138.7	148.4	-73.3	159.4	0	0	0	107.7	G33 G34	L31-G33 VanDerWaalsContact C-N 3.32Å; L31-G33 PolarHBondContact O-N 2.85Å; L31-G34 PolarHBondContact O-N 3.36Å
32	P	51.1	Low	58.3	Low	137 Å²	137	121.6 Å²	121.6	89%	0.89	64%	0.642	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.3	96.2	174.7	24.8	-30.7	0	0	0	108.2
33	G	62.4	Low	57.7	Low	74 Å²	74	118 Å²	118	76%	0.763	63%	0.629	S	S	*	*	T	Hydrogen-bonded Turn	trans	141.4	-4.5	-164.1	0	0	0	0	0	114.1	L31 K35	L31-G33 VanDerWaalsContact C-N 3.32Å; L31-G33 PolarHBondContact O-N 2.85Å; G33-K35 PolarHBondContact O-N 3.45Å
34	G	62.3	Low	57.1	Low	45 Å²	45	117.7 Å²	117.7	46%	0.464	63%	0.625	S	S	.	*	S	Bend	trans	-57.4	99.1	169.2	0	0	0	0	0	110.6	L31 R36	L31-G34 PolarHBondContact O-N 3.36Å; G34-R36 VanDerWaalsContact C-N 3.3Å; G34-R36 PolarHBondContact O-N 2.97Å
35	K	57.5	Low	56.7	Low	209 Å²	209	116.3 Å²	116.3	91%	0.909	62%	0.621	S	S	*	*			trans	6.9	70.9	172.8	-76.1	-177.2	170.6	-179.8	0	114.4	G33	G33-K35 PolarHBondContact O-N 3.45Å
36	R	53.5	Low	56.6	Low	202 Å²	202	119.8 Å²	119.8	76%	0.762	63%	0.629	S	S	*	*			trans	-79.8	121.3	144.2	-72.7	-167.3	177.9	93.6	2.3	104.1	G34 V38	G34-R36 VanDerWaalsContact C-N 3.3Å; G34-R36 PolarHBondContact O-N 2.97Å; R36-V38 HydrophobicContact CB-CG2 3.4Å; R36-V38 VanDerWaalsContact CB-CG2 3.4Å; R36-V38 PolarHBondContact O-N 3.43Å
37	S	56.4	Low	56.3	Low	61 Å²	61	117.3 Å²	117.3	43%	0.427	63%	0.629	S	S	.	*			trans	-65.2	61.7	159.6	-155.7	0	0	0	0	108.8	G39 E40 L41	S37-G39 PolarHBondContact O-N 2.84Å; S37-E40 VanDerWaalsContact CB-OE2 3.29Å; S37-E40 WeakPolarHBondContact CB-OE2 3.25Å; S37-E40 PolarHBondContact O-N 3.46Å; S37-E40 VanDerWaalsContact O-N 3.11Å; S37-E40 WeakPolarHBondContact OG-CB 3.29Å; S37-E40 VanDerWaalsContact OG-CG 3.26Å; S37-E40 WeakPolarHBondContact OG-CG 3.18Å; S37-E40 PolarHBondContact OG-N 3.19Å; S37-E40 PolarHBondContact OG-OE2 2.89Å; S37-L41 PolarHBondContact O-N 2.73Å
38	V	53.3	Low	56.2	Low	94 Å²	94	120.7 Å²	120.7	57%	0.57	64%	0.64	S	S	*	*	H	α-helix	trans	-62.7	-22.4	171.1	-173.6	0	0	0	0	108.8	R36 E42	R36-V38 HydrophobicContact CB-CG2 3.4Å; R36-V38 VanDerWaalsContact CB-CG2 3.4Å; R36-V38 PolarHBondContact O-N 3.43Å; V38-E42 VanDerWaalsContact O-CB 3.27Å; V38-E42 WeakPolarHBondContact O-CB 3.36Å; V38-E42 PolarHBondContact O-N 3.4Å
39	G	56.5	Low	56.4	Low	54 Å²	54	115.1 Å²	115.1	56%	0.557	64%	0.641	S	S	*	*	H	α-helix	trans	-71	-38.4	169	0	0	0	0	0	114.7	S37 A43	S37-G39 PolarHBondContact O-N 2.84Å; G39-A43 WeakPolarHBondContact O-CB 3.41Å; G39-A43 PolarHBondContact O-N 3.49Å
40	E	55.1	Low	56.5	Low	133 Å²	133	118.8 Å²	118.8	62%	0.621	65%	0.653	S	S	*	*	H	α-helix	trans	-76.3	-36.1	177.8	-84.4	173.5	121.4	0	0	112.6	S37 T44	S37-E40 VanDerWaalsContact CB-OE2 3.29Å; S37-E40 WeakPolarHBondContact CB-OE2 3.25Å; S37-E40 PolarHBondContact O-N 3.46Å; S37-E40 VanDerWaalsContact O-N 3.11Å; S37-E40 WeakPolarHBondContact OG-CB 3.29Å; S37-E40 VanDerWaalsContact OG-CG 3.26Å; S37-E40 WeakPolarHBondContact OG-CG 3.18Å; S37-E40 PolarHBondContact OG-N 3.19Å; S37-E40 PolarHBondContact OG-OE2 2.89Å; E40-T44 WeakPolarHBondContact O-CB 3.26Å; E40-T44 PolarHBondContact O-N 2.84Å; E40-T44 PolarHBondContact O-OG1 2.66Å
41	L	58.4	Low	56.7	Low	115 Å²	115	112.9 Å²	112.9	60%	0.602	66%	0.657	S	S	*	*	H	α-helix	trans	-70.9	-40.1	177.9	-175.2	60	0	0	0	111.2	S37 T44 I45	S37-L41 PolarHBondContact O-N 2.73Å; L41-T44 PolarHBondContact O-N 3.28Å; L41-I45 HydrophobicContact CD1-CD1 4.13Å; L41-I45 HydrophobicContact CD1-CG1 4.35Å; L41-I45 HydrophobicContact CG-CD1 3.9Å; L41-I45 WeakPolarHBondContact O-CB 3.13Å; L41-I45 WeakPolarHBondContact O-CD1 3.35Å; L41-I45 WeakPolarHBondContact O-CG1 3.2Å; L41-I45 PolarHBondContact O-N 2.59Å
42	E	57.8	Low	56.2	Low	99 Å²	99	109.9 Å²	109.9	46%	0.463	66%	0.658	S	S	.	*	H	α-helix	trans	-66.1	-41.5	173.8	-165.4	-161.6	157.3	0	0	111.8	V38 I45 R46	V38-E42 VanDerWaalsContact O-CB 3.27Å; V38-E42 WeakPolarHBondContact O-CB 3.36Å; V38-E42 PolarHBondContact O-N 3.4Å; E42-I45 PolarHBondContact O-N 2.8Å; E42-R46 WeakPolarHBondContact O-CB 3.24Å; E42-R46 WeakPolarHBondContact O-CG 3.14Å; E42-R46 PolarHBondContact O-N 2.86Å; E42-R46 IonicContact OE1-CZ 3.43Å; E42-R46 IonicContact OE1-NE 3.81Å; E42-R46 PolarHBondContact OE1-NE 2.82Å; E42-R46 IonicContact OE1-NH2 2.86Å; E42-R46 PolarHBondContact OE1-NH2 3.42Å
43	A	58.8	Low	56.4	Low	46 Å²	46	109.8 Å²	109.8	38%	0.38	66%	0.655	S	S	.	*	H	α-helix	trans	-66.6	-37	175.6	0	0	0	0	0	112.4	G39 R46 M47	G39-A43 WeakPolarHBondContact O-CB 3.41Å; G39-A43 PolarHBondContact O-N 3.49Å; A43-R46 PolarHBondContact O-N 2.92Å; A43-M47 VanDerWaalsContact O-CB 3.25Å; A43-M47 WeakPolarHBondContact O-CB 3.48Å; A43-M47 VanDerWaalsContact O-CG 3.24Å; A43-M47 WeakPolarHBondContact O-CG 3.44Å; A43-M47 PolarHBondContact O-N 2.97Å
44	T	56.7	Low	55.4	Low	71 Å²	71	113.2 Å²	113.2	44%	0.436	66%	0.661	S	S	.	*	H	α-helix	trans	-68	-39.6	175.1	-57.7	0	0	0	0	111.2	E40 L41 M47 M48	E40-T44 WeakPolarHBondContact O-CB 3.26Å; E40-T44 PolarHBondContact O-N 2.84Å; E40-T44 PolarHBondContact O-OG1 2.66Å; L41-T44 PolarHBondContact O-N 3.28Å; T44-M47 PolarHBondContact O-N 2.72Å; T44-M48 HydrophobicContact CG2-SD 4.22Å; T44-M48 WeakPolarHBondContact O-CG 3.27Å; T44-M48 PolarHBondContact O-N 2.79Å
45	I	57.6	Low	54.5	Low	112 Å²	112	115.8 Å²	115.8	57%	0.574	67%	0.671	S	S	*	*	H	α-helix	trans	-66.2	-39.8	175.1	-68.7	163.9	0	0	0	111.2	L41 E42 M47	L41-I45 HydrophobicContact CD1-CD1 4.13Å; L41-I45 HydrophobicContact CD1-CG1 4.35Å; L41-I45 HydrophobicContact CG-CD1 3.9Å; L41-I45 WeakPolarHBondContact O-CB 3.13Å; L41-I45 WeakPolarHBondContact O-CD1 3.35Å; L41-I45 WeakPolarHBondContact O-CG1 3.2Å; L41-I45 PolarHBondContact O-N 2.59Å; E42-I45 PolarHBondContact O-N 2.8Å; I45-M47 VanDerWaalsContact C-N 3.35Å
46	R	59.5	Low	54.4	Low	195 Å²	195	113.4 Å²	113.4	74%	0.736	67%	0.668	S	S	*	*	H	α-helix	trans	-71.8	-25.8	174.6	-73.3	179.3	178.5	-101.2	3.1	113.4	E42 A43	E42-R46 WeakPolarHBondContact O-CB 3.24Å; E42-R46 WeakPolarHBondContact O-CG 3.14Å; E42-R46 PolarHBondContact O-N 2.86Å; E42-R46 IonicContact OE1-CZ 3.43Å; E42-R46 IonicContact OE1-NE 3.81Å; E42-R46 PolarHBondContact OE1-NE 2.82Å; E42-R46 IonicContact OE1-NH2 2.86Å; E42-R46 PolarHBondContact OE1-NH2 3.42Å; A43-R46 PolarHBondContact O-N 2.92Å
47	M	53.1	Low	53.9	Low	164 Å²	164	109 Å²	109	81%	0.808	67%	0.666	S	S	*	*	H	α-helix	trans	-87.5	-21.1	177.8	-77.5	-175.9	61.8	0	0	114.1	A43 T44 I45 G49	A43-M47 VanDerWaalsContact O-CB 3.25Å; A43-M47 WeakPolarHBondContact O-CB 3.48Å; A43-M47 VanDerWaalsContact O-CG 3.24Å; A43-M47 WeakPolarHBondContact O-CG 3.44Å; A43-M47 PolarHBondContact O-N 2.97Å; T44-M47 PolarHBondContact O-N 2.72Å; I45-M47 VanDerWaalsContact C-N 3.35Å; M47-G49 VanDerWaalsContact C-N 3.3Å; M47-G49 PolarHBondContact O-N 3.11Å
48	M	52.5	Low	53.1	Low	130 Å²	130	113.5 Å²	113.5	64%	0.64	68%	0.68	S	S	*	*	S	Bend	trans	-78.7	82.8	166.9	-68.3	176.9	99.5	0	0	108.3	T44 T50	T44-M48 HydrophobicContact CG2-SD 4.22Å; T44-M48 WeakPolarHBondContact O-CG 3.27Å; T44-M48 PolarHBondContact O-N 2.79Å; M48-T50 VanDerWaalsContact C-N 3.31Å; M48-T50 PolarHBondContact O-N 3.2Å
49	G	58.3	Low	52.6	Low	77 Å²	77	117 Å²	117	79%	0.794	69%	0.69	S	S	*	*			trans	-61	79.8	-176.6	0	0	0	0	0	114.7	M47	M47-G49 VanDerWaalsContact C-N 3.3Å; M47-G49 PolarHBondContact O-N 3.11Å
50	T	57.5	Low	51.5	Low	133 Å²	133	119 Å²	119	82%	0.816	70%	0.701	S	S	*	*			trans	-108.7	90.7	163.1	53	0	0	0	0	108.4	M48	M48-T50 VanDerWaalsContact C-N 3.31Å; M48-T50 PolarHBondContact O-N 3.2Å
51	G	57.3	Low	50.9	Low	85 Å²	85	117.8 Å²	117.8	88%	0.876	71%	0.707	S	S	*	*			trans	-63.1	147.1	173.1	0	0	0	0	0	112.4
52	G	45.6	Very low	50.2	Low	71 Å²	71	116.8 Å²	116.8	73%	0.732	72%	0.716	S	S	*	*			trans	167.4	77.4	173.9	0	0	0	0	0	114.2
53	V	54.1	Low	49.3	Very low	136 Å²	136	120.9 Å²	120.9	82%	0.824	74%	0.735	S	S	*	*			trans	19.7	109.8	146.9	-178.6	0	0	0	0	117
54	V	42.2	Very low	48.3	Very low	146 Å²	146	124 Å²	124	89%	0.885	75%	0.749	S	S	*	*			trans	-142.6	129.1	141.7	-175.6	0	0	0	0	109.1
55	S	42	Very low	47.7	Very low	98 Å²	98	130 Å²	130	69%	0.685	77%	0.772	S	S	*	*			trans	-67.3	146.7	-161	-40.4	0	0	0	0	116.1
56	L	56.6	Low	46.8	Very low	160 Å²	160	131.8 Å²	131.8	84%	0.838	78%	0.778	S	S	*	*			trans	-59.2	138.8	153.1	-173.1	70.1	0	0	0	109.7
57	P	43.5	Very low	46.7	Very low	110 Å²	110	133 Å²	133	71%	0.714	78%	0.783	S	S	*	*				-130.7	127.2	122.8	26.1	-10.1	0	0	0	110
58	E	39.1	Very low	46.2	Very low	155 Å²	155	131.4 Å²	131.4	72%	0.724	78%	0.777	S	S	*	*				68.7	100.2	92.5	-164.8	86.8	160.4	0	0	111.9
59	E	42.7	Very low	46	Very low	167 Å²	167	134.7 Å²	134.7	78%	0.78	78%	0.782	S	S	*	*			trans	48	106.1	148.2	-61.6	-65.4	114.8	0	0	120.2
60	A	33.2	Very low	45.5	Very low	96 Å²	96	136.6 Å²	136.6	79%	0.793	78%	0.78	S	S	*	*			trans	-148.5	80.4	143.7	0	0	0	0	0	109.9
61	S	42	Very low	44.9	Very low	108 Å²	108	138.6 Å²	138.6	76%	0.755	78%	0.78	S	S	*	*			trans	32.6	127.6	139.5	54.5	0	0	0	0	120.3
62	A	44.9	Very low	44.6	Very low	94 Å²	94	141.7 Å²	141.7	78%	0.777	78%	0.777	S	S	*	*			trans	79	88.8	146.9	0	0	0	0	0	117.7
63	Q	39	Very low	45	Very low	184 Å²	184	145.3 Å²	145.3	86%	0.86	78%	0.778	S	S	*	*				-160.9	103.2	117.5	-126.2	167.6	-4.6	0	0	112.5
64	T	36.4	Very low	44.6	Very low	111 Å²	111	145.5 Å²	145.5	68%	0.681	77%	0.774	S	S	*	*			trans	57.4	80.1	135.6	-43.5	0	0	0	0	116.5	E66	T64-E66 HydrophobicContact CG2-CB 3.99Å; T64-E66 PolarHBondContact O-N 3.03Å
65	Q	44.9	Very low	45.1	Very low	198 Å²	198	145.6 Å²	145.6	93%	0.925	77%	0.77	S	S	*	*			trans	-55.1	87.4	140.7	-175.7	-171.2	19	0	0	109.6
66	E	38.8	Very low	45.3	Very low	150 Å²	150	143.8 Å²	143.8	70%	0.701	77%	0.767	S	S	*	*			trans	-116.1	95.7	156.6	-153.9	-169.7	160.7	0	0	110.5	T64 L68	T64-E66 HydrophobicContact CG2-CB 3.99Å; T64-E66 PolarHBondContact O-N 3.03Å; E66-L68 HydrophobicContact CG-CD1 4.32Å; E66-L68 PolarHBondContact O-N 2.93Å; E66-L68 VanDerWaalsContact OE1-CD1 3.23Å; E66-L68 WeakPolarHBondContact OE1-CD1 3.23Å
67	R	57.3	Low	45.2	Very low	221 Å²	221	141.8 Å²	141.8	83%	0.834	77%	0.766	S	S	*	*			trans	-53.5	109.5	163.4	173.2	-170.3	-170.6	163.3	3	110.7
68	L	42.2	Very low	45.5	Very low	129 Å²	129	141.3 Å²	141.3	68%	0.675	77%	0.765	S	S	*	*			trans	-151.5	96.9	157.5	-104.5	123.2	0	0	0	114.7	E66	E66-L68 HydrophobicContact CG-CD1 4.32Å; E66-L68 PolarHBondContact O-N 2.93Å; E66-L68 VanDerWaalsContact OE1-CD1 3.23Å; E66-L68 WeakPolarHBondContact OE1-CD1 3.23Å
69	R	47.5	Very low	46.1	Very low	199 Å²	199	140.7 Å²	140.7	75%	0.751	76%	0.762	S	S	*	*			trans	55.7	135	146.1	-66.9	-73.6	159.8	-179.6	-2.7	120.8	H71	R69-H71 PolarHBondContact O-N 3.29Å; R69-H71 PolarHBondContact O-ND1 2.91Å
70	P	49.1	Very low	46.3	Very low	117 Å²	117	142.9 Å²	142.9	76%	0.76	77%	0.769	S	S	*	*			trans	-63.6	120.2	166.7	14.5	-9.6	0	0	0	109.3	N72	P70-N72 PolarHBondContact O-N 3.12Å
71	H	43.5	Very low	47.1	Very low	175 Å²	175	143.8 Å²	143.8	81%	0.81	76%	0.761	S	S	*	*			trans	-69.8	110.1	169.5	-81.7	53.7	0	0	0	107.9	R69 I73	R69-H71 PolarHBondContact O-N 3.29Å; R69-H71 PolarHBondContact O-ND1 2.91Å; H71-I73 PolarHBondContact O-N 3.19Å; H71-I73 VanDerWaalsContact O-N 3.12Å
72	N	51.7	Low	47.8	Very low	151 Å²	151	149.6 Å²	149.6	81%	0.807	77%	0.766	S	S	*	*			trans	-61.7	109.3	170.4	-162.1	-22.6	0	0	0	107	P70 N74	P70-N72 PolarHBondContact O-N 3.12Å; N72-N74 PolarHBondContact O-N 3.43Å
73	I	53.8	Low	47.8	Very low	147 Å²	147	150.7 Å²	150.7	75%	0.754	76%	0.759	S	S	*	*			trans	-70	89	171.3	-58.5	174.8	0	0	0	105	H71 D75	H71-I73 PolarHBondContact O-N 3.19Å; H71-I73 VanDerWaalsContact O-N 3.12Å; I73-D75 PolarHBondContact O-N 2.89Å
74	N	46.9	Very low	48.7	Very low	140 Å²	140	151.3 Å²	151.3	75%	0.749	76%	0.759	S	S	*	*			trans	-59.1	104.7	168.2	-179.4	36.9	0	0	0	106.6	N72 G76	N72-N74 PolarHBondContact O-N 3.43Å; N74-G76 PolarHBondContact O-N 2.92Å
75	D	52.7	Low	49.4	Very low	148 Å²	148	155.8 Å²	155.8	79%	0.791	76%	0.763	S	S	*	*			trans	-58.8	79.3	168.2	-99.5	-31.4	0	0	0	108.8	I73 S77	I73-D75 PolarHBondContact O-N 2.89Å; D75-S77 PolarHBondContact O-N 3.38Å
76	G	45.9	Very low	49.9	Very low	60 Å²	60	155.4 Å²	155.4	62%	0.619	76%	0.759	S	S	*	*			trans	-74.4	64.9	166.8	0	0	0	0	0	109.3	N74 S78	N74-G76 PolarHBondContact O-N 2.92Å; G76-S78 PolarHBondContact O-N 3.21Å
77	S	53.9	Low	50.4	Low	118 Å²	118	157 Å²	157	83%	0.825	77%	0.771	S	S	*	*			trans	-63.4	79.9	160.2	174.8	0	0	0	0	108.1	D75	D75-S77 PolarHBondContact O-N 3.38Å
78	S	49.5	Very low	50	Low	99 Å²	99	153.8 Å²	153.8	69%	0.692	77%	0.771	S	S	*	*			trans	-108.5	84.2	164.9	66.6	0	0	0	0	108.8	G76 F80	G76-S78 PolarHBondContact O-N 3.21Å; S78-F80 PolarHBondContact O-N 3.05Å
79	H	51.2	Low	50.1	Low	142 Å²	142	160.7 Å²	160.7	66%	0.657	80%	0.795	S	S	*	*				61.9	63.5	120.5	-157.2	-86.6	0	0	0	115.4	D81	H79-D81 IonicContact CE1-OD2 3.39Å; H79-D81 PolarHBondContact CE1-OD2 3.19Å; H79-D81 IonicContact ND1-OD2 3.04Å; H79-D81 IonicContact NE2-OD2 3.66Å; H79-D81 PolarHBondContact NE2-OD2 3.49Å; H79-D81 PolarHBondContact O-N 2.76Å
80	F	48.7	Very low	50.3	Low	213 Å²	213	158.8 Å²	158.8	93%	0.934	80%	0.797	S	S	*	*			trans	-75.7	84.9	152.1	-98.5	-83.1	0	0	0	108.1	S78 R82	S78-F80 PolarHBondContact O-N 3.05Å; F80-R82 PolarHBondContact O-N 3.39Å
81	D	50.1	Low	50.3	Low	115 Å²	115	160.9 Å²	160.9	62%	0.615	80%	0.799	S	S	*	*			trans	-61.7	121.7	176.8	-141.5	-26	0	0	0	109.6	H79 N83	H79-D81 IonicContact CE1-OD2 3.39Å; H79-D81 PolarHBondContact CE1-OD2 3.19Å; H79-D81 IonicContact ND1-OD2 3.04Å; H79-D81 IonicContact NE2-OD2 3.66Å; H79-D81 PolarHBondContact NE2-OD2 3.49Å; H79-D81 PolarHBondContact O-N 2.76Å; D81-N83 PolarHBondContact O-N 3.04Å; D81-N83 VanDerWaalsContact O-N 3.12Å
82	R	54.9	Low	50.7	Low	231 Å²	231	160.2 Å²	160.2	87%	0.872	80%	0.799	S	S	*	*			trans	-76.7	94.4	-178	174.8	-174.8	171	-169.9	-1.6	107.3	F80	F80-R82 PolarHBondContact O-N 3.39Å
83	N	45.3	Very low	50.7	Low	116 Å²	116	160.7 Å²	160.7	62%	0.62	80%	0.798	S	S	*	*			trans	-130.7	64.8	166.3	-134.8	9.2	0	0	0	112.4	D81 R85	D81-N83 PolarHBondContact O-N 3.04Å; D81-N83 VanDerWaalsContact O-N 3.12Å; N83-R85 PolarHBondContact OD1-NE 3.3Å
84	K	58.2	Low	50.5	Low	198 Å²	198	161.6 Å²	161.6	86%	0.861	80%	0.801	S	S	*	*			trans	-95.6	75.5	146	-71.6	-175	-178.3	174.9	0	107.6
85	R	52.2	Low	50.7	Low	204 Å²	204	163 Å²	163	77%	0.77	80%	0.804	S	S	*	*			trans	-98.5	104.1	162.1	-83.9	-173.1	-78.7	-153.2	-2.1	107.8	N83	N83-R85 PolarHBondContact OD1-NE 3.3Å
86	F	54.6	Low	50.6	Low	191 Å²	191	164.1 Å²	164.1	84%	0.838	81%	0.805	S	S	*	*			trans	-6.2	119.7	163.9	-58.3	-86.5	0	0	0	116.1	N88	F86-N88 PolarHBondContact O-N 2.97Å
87	L	49.9	Very low	50.9	Low	183 Å²	183	172.1 Å²	172.1	96%	0.958	82%	0.819	S	S	*	*			trans	-56.4	114.1	151.2	-171.7	79.3	0	0	0	108.1
88	N	48.2	Very low	50.7	Low	154 Å²	154	176.6 Å²	176.6	82%	0.824	82%	0.819	S	S	*	*			trans	-151.3	125.8	156.3	-143.7	-31.6	0	0	0	111.1	F86	F86-N88 PolarHBondContact O-N 2.97Å
89	K	45.4	Very low	50.8	Low	273 Å²	273	183.6 Å²	183.6	100%	1.187	83%	0.831	S	S	*	*			trans	85.8	0	175.8	-144.6	169.4	-173.2	176.9	0	118.1

Retrieved 89 of 89 residues in 54.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).