A0A087YHB1_POEFO Loading...

Cytochrome c oxidase assembly protein COX16 homolog, mitochondrial

AlphaFold DB , UniProt , Accession A0A087YHB1, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 116 aa.

						>A0A087YHB1_POEFO|A0A087YHB1
MTTEEHVAEVMFSWKTLQRNKTVKYGVPMLLLVIGGSFGLREFTQIRYDAQKIRKRLDPSLEAKVNAEKQAVILEEEYEKLKEIHLDEWKNIRGPRPWEDSREYQEQQRSNLSKTH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.7	Low	74.8	Confident	209 Å²	209	115.9 Å²	115.9	100%	1.03	62%	0.616	S	S	*	*				0	105.8	0	-149.9	164.3	-176.7	0	0	106.1
2	T	78.6	Confident	74.5	Confident	85 Å²	85	118.9 Å²	118.9	52%	0.521	62%	0.62	S	S	.	*			trans	-93.1	153.7	-156.5	41.7	0	0	0	0	112.4	E4 E5	T2-E4 PolarHBondContact O-N 2.8Å; T2-E5 PolarHBondContact O-N 3.21Å; T2-E5 VanDerWaalsContact O-N 3.13Å
3	T	76.9	Confident	74.4	Confident	107 Å²	107	115.3 Å²	115.3	66%	0.656	61%	0.611	S	S	*	*	H	α-helix	trans	-55.2	-29.4	178.5	45	0	0	0	0	113.6	E5 H6 V7	T3-E5 VanDerWaalsContact C-N 3.32Å; T3-E5 PolarHBondContact O-N 3.41Å; T3-H6 PolarHBondContact O-N 3.45Å; T3-V7 WeakPolarHBondContact O-CG2 3.24Å; T3-V7 PolarHBondContact O-N 3.38Å; T3-V7 VanDerWaalsContact O-N 3.14Å
4	E	75.9	Confident	74.6	Confident	139 Å²	139	118.5 Å²	118.5	65%	0.65	61%	0.611	S	S	*	*	H	α-helix	trans	-61.5	-35.9	177.5	-63.4	-59.2	123.9	0	0	113	T2 V7 A8	T2-E4 PolarHBondContact O-N 2.8Å; E4-V7 PolarHBondContact O-N 3Å; E4-A8 WeakPolarHBondContact O-CB 3.46Å; E4-A8 PolarHBondContact O-N 3.28Å
5	E	78.3	Confident	74.6	Confident	119 Å²	119	121.3 Å²	121.3	56%	0.556	62%	0.616	S	S	*	*	H	α-helix	trans	-73.5	-35.6	-179.9	-61.9	-153.6	150.5	0	0	112	T2 T3 A8 E9	T2-E5 PolarHBondContact O-N 3.21Å; T2-E5 VanDerWaalsContact O-N 3.13Å; T3-E5 VanDerWaalsContact C-N 3.32Å; T3-E5 PolarHBondContact O-N 3.41Å; E5-A8 PolarHBondContact O-N 3.01Å; E5-E9 WeakPolarHBondContact O-CB 3.02Å; E5-E9 PolarHBondContact O-N 3.35Å
6	H	75.9	Confident	74.7	Confident	114 Å²	114	118.3 Å²	118.3	53%	0.528	61%	0.606	S	S	.	*	H	α-helix	trans	-65.8	-40.7	174.2	-78.9	65.9	0	0	0	111.6	T3 E9 V10	T3-H6 PolarHBondContact O-N 3.45Å; H6-E9 PolarHBondContact O-N 2.93Å; H6-V10 WeakPolarHBondContact O-CB 3.47Å; H6-V10 VanDerWaalsContact O-CG2 3.26Å; H6-V10 WeakPolarHBondContact O-CG2 3.44Å; H6-V10 PolarHBondContact O-N 3.34Å
7	V	78.9	Confident	74.7	Confident	78 Å²	78	116.4 Å²	116.4	47%	0.473	60%	0.597	S	S	.	*	H	α-helix	trans	-65.4	-43.9	176.9	173.2	0	0	0	0	110.3	T3 E4 E9 V10 M11	T3-V7 WeakPolarHBondContact O-CG2 3.24Å; T3-V7 PolarHBondContact O-N 3.38Å; T3-V7 VanDerWaalsContact O-N 3.14Å; E4-V7 PolarHBondContact O-N 3Å; V7-E9 PolarHBondContact O-N 3.43Å; V7-V10 PolarHBondContact O-N 3.31Å; V7-M11 HydrophobicContact CG1-CG 4.43Å; V7-M11 HydrophobicContact CG1-SD 3.92Å; V7-M11 WeakPolarHBondContact O-CB 3.43Å; V7-M11 VanDerWaalsContact O-CG 3.27Å; V7-M11 WeakPolarHBondContact O-CG 3.47Å; V7-M11 PolarHBondContact O-N 2.98Å
8	A	76.1	Confident	74.7	Confident	57 Å²	57	115.7 Å²	115.7	47%	0.471	59%	0.591	S	S	.	*	H	α-helix	trans	-62	-41.3	176.8	0	0	0	0	0	112.3	E4 E5 M11 F12	E4-A8 WeakPolarHBondContact O-CB 3.46Å; E4-A8 PolarHBondContact O-N 3.28Å; E5-A8 PolarHBondContact O-N 3.01Å; A8-M11 PolarHBondContact O-N 2.98Å; A8-F12 VanDerWaalsContact O-CB 3.29Å; A8-F12 WeakPolarHBondContact O-CB 3.36Å; A8-F12 PolarHBondContact O-N 2.88Å
9	E	78.4	Confident	75.1	Confident	136 Å²	136	121.1 Å²	121.1	64%	0.636	60%	0.603	S	S	*	*	H	α-helix	trans	-65.7	-43.6	178.4	-165.9	179.2	-168.5	0	0	112	E5 H6 V7 F12 S13	E5-E9 WeakPolarHBondContact O-CB 3.02Å; E5-E9 PolarHBondContact O-N 3.35Å; H6-E9 PolarHBondContact O-N 2.93Å; V7-E9 PolarHBondContact O-N 3.43Å; E9-F12 PolarHBondContact O-N 2.66Å; E9-S13 WeakPolarHBondContact O-CB 3.38Å; E9-S13 PolarHBondContact O-N 3.07Å
10	V	79	Confident	75.5	Confident	102 Å²	102	119.5 Å²	119.5	62%	0.618	60%	0.597	S	S	*	*	H	α-helix	trans	-63.6	-44.8	176	170.2	0	0	0	0	111.3	H6 V7 F12 S13 W14	H6-V10 WeakPolarHBondContact O-CB 3.47Å; H6-V10 VanDerWaalsContact O-CG2 3.26Å; H6-V10 WeakPolarHBondContact O-CG2 3.44Å; H6-V10 PolarHBondContact O-N 3.34Å; V7-V10 PolarHBondContact O-N 3.31Å; V10-F12 PolarHBondContact O-N 2.9Å; V10-S13 PolarHBondContact O-N 3.37Å; V10-W14 WeakPolarHBondContact O-CB 3.5Å; V10-W14 PolarHBondContact O-N 3.36Å
11	M	72.2	Confident	75.9	Confident	129 Å²	129	121.7 Å²	121.7	64%	0.635	60%	0.603	S	S	*	*	H	α-helix	trans	-65.2	-38.1	177.8	-72	-179.8	69.9	0	0	112.4	V7 A8 W14 K15	V7-M11 HydrophobicContact CG1-CG 4.43Å; V7-M11 HydrophobicContact CG1-SD 3.92Å; V7-M11 WeakPolarHBondContact O-CB 3.43Å; V7-M11 VanDerWaalsContact O-CG 3.27Å; V7-M11 WeakPolarHBondContact O-CG 3.47Å; V7-M11 PolarHBondContact O-N 2.98Å; A8-M11 PolarHBondContact O-N 2.98Å; M11-W14 PolarHBondContact O-N 3.49Å; M11-K15 PolarHBondContact O-N 2.92Å; M11-K15 VanDerWaalsContact O-N 3.12Å
12	F	70.9	Confident	77.5	Confident	152 Å²	152	117.2 Å²	117.2	67%	0.667	59%	0.587	S	S	*	*	H	α-helix	trans	-68	-42.4	176.5	-176.2	-99.3	0	0	0	112	A8 E9 V10 W14 K15 T16	A8-F12 VanDerWaalsContact O-CB 3.29Å; A8-F12 WeakPolarHBondContact O-CB 3.36Å; A8-F12 PolarHBondContact O-N 2.88Å; E9-F12 PolarHBondContact O-N 2.66Å; V10-F12 PolarHBondContact O-N 2.9Å; F12-W14 VanDerWaalsContact C-N 3.34Å; F12-W14 PolarHBondContact O-N 2.93Å; F12-K15 PolarHBondContact O-N 3.48Å; F12-T16 PolarHBondContact O-N 2.98Å; F12-T16 VanDerWaalsContact O-N 3.08Å; F12-T16 PolarHBondContact O-OG1 2.96Å
13	S	73.3	Confident	78	Confident	72 Å²	72	115.2 Å²	115.2	50%	0.503	58%	0.575	S	S	.	*	H	α-helix	trans	-61.3	-42.6	174.2	-175.7	0	0	0	0	111.4	E9 V10 K15 T16 L17	E9-S13 WeakPolarHBondContact O-CB 3.38Å; E9-S13 PolarHBondContact O-N 3.07Å; V10-S13 PolarHBondContact O-N 3.37Å; S13-K15 PolarHBondContact O-N 3.32Å; S13-T16 PolarHBondContact O-N 3.49Å; S13-L17 WeakPolarHBondContact O-CB 3.35Å; S13-L17 PolarHBondContact O-N 2.68Å
14	W	77.1	Confident	78.4	Confident	160 Å²	160	116.2 Å²	116.2	61%	0.606	57%	0.57	S	S	*	*	H	α-helix	trans	-59.9	-44.8	176.1	-173.2	-98.6	0	0	0	113	V10 M11 F12 T16 L17 Q18	V10-W14 WeakPolarHBondContact O-CB 3.5Å; V10-W14 PolarHBondContact O-N 3.36Å; M11-W14 PolarHBondContact O-N 3.49Å; F12-W14 VanDerWaalsContact C-N 3.34Å; F12-W14 PolarHBondContact O-N 2.93Å; W14-T16 VanDerWaalsContact C-N 3.29Å; W14-T16 PolarHBondContact O-N 3.34Å; W14-L17 PolarHBondContact O-N 2.98Å; W14-Q18 WeakPolarHBondContact O-CG 3.26Å; W14-Q18 PolarHBondContact O-N 3.11Å
15	K	75.1	Confident	79.1	Confident	160 Å²	160	117 Å²	117	70%	0.696	57%	0.568	S	S	*	*	H	α-helix	trans	-66	-33.6	178.7	-146.7	174.6	-171.4	179.4	0	112.1	M11 F12 S13	M11-K15 PolarHBondContact O-N 2.92Å; M11-K15 VanDerWaalsContact O-N 3.12Å; F12-K15 PolarHBondContact O-N 3.48Å; S13-K15 PolarHBondContact O-N 3.32Å
16	T	76.4	Confident	79.8	Confident	73 Å²	73	112.9 Å²	112.9	45%	0.448	56%	0.558	S	S	.	*	H	α-helix	trans	-72.8	-40.8	175.6	-53.7	0	0	0	0	111.3	F12 S13 W14 R19	F12-T16 PolarHBondContact O-N 2.98Å; F12-T16 VanDerWaalsContact O-N 3.08Å; F12-T16 PolarHBondContact O-OG1 2.96Å; S13-T16 PolarHBondContact O-N 3.49Å; W14-T16 VanDerWaalsContact C-N 3.29Å; W14-T16 PolarHBondContact O-N 3.34Å; T16-R19 VanDerWaalsContact O-CB 3.25Å; T16-R19 WeakPolarHBondContact O-CB 3.48Å; T16-R19 PolarHBondContact O-N 3.3Å; T16-R19 VanDerWaalsContact O-N 3.16Å
17	L	74.7	Confident	80.5	Confident	86 Å²	86	110.9 Å²	110.9	45%	0.45	55%	0.553	S	S	.	*	H	α-helix	trans	-66.4	-39	178.2	-169.8	64.9	0	0	0	112.4	S13 W14 R19 N20 V23	S13-L17 WeakPolarHBondContact O-CB 3.35Å; S13-L17 PolarHBondContact O-N 2.68Å; W14-L17 PolarHBondContact O-N 2.98Å; L17-R19 PolarHBondContact O-N 3.36Å; L17-N20 PolarHBondContact O-N 3.36Å; L17-V23 HydrophobicContact CD1-CG2 4.2Å; L17-V23 HydrophobicContact CG-CG1 4.36Å; L17-V23 HydrophobicContact CG-CG2 4.48Å
18	Q	74.9	Confident	81.2	Confident	105 Å²	105	110.3 Å²	110.3	49%	0.491	55%	0.551	S	S	.	*	T	Hydrogen-bonded Turn	trans	-67.8	-14.3	174	-74.5	-171.3	-36.4	0	0	114	W14 N20	W14-Q18 WeakPolarHBondContact O-CG 3.26Å; W14-Q18 PolarHBondContact O-N 3.11Å; Q18-N20 VanDerWaalsContact C-N 3.33Å
19	R	80.7	Confident	82	Confident	217 Å²	217	113.9 Å²	113.9	82%	0.819	56%	0.56	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.5	-20.5	178.7	-150.4	171.2	99.9	139.5	2	112.6	T16 L17	T16-R19 VanDerWaalsContact O-CB 3.25Å; T16-R19 WeakPolarHBondContact O-CB 3.48Å; T16-R19 PolarHBondContact O-N 3.3Å; T16-R19 VanDerWaalsContact O-N 3.16Å; L17-R19 PolarHBondContact O-N 3.36Å
20	N	83.5	Confident	82.7	Confident	90 Å²	90	112.4 Å²	112.4	48%	0.481	56%	0.556	S	S	.	*	S	Bend	trans	-75.8	125.7	178.1	-73.8	-12.9	0	0	0	111	L17 Q18 T22 V23 K24	L17-N20 PolarHBondContact O-N 3.36Å; Q18-N20 VanDerWaalsContact C-N 3.33Å; N20-T22 VanDerWaalsContact C-N 3.27Å; N20-T22 PolarHBondContact O-N 3.24Å; N20-V23 HydrophobicContact CB-CB 4.46Å; N20-V23 HydrophobicContact CB-CG2 4.14Å; N20-V23 PolarHBondContact O-N 3.1Å; N20-V23 VanDerWaalsContact O-N 3.1Å; N20-K24 PolarHBondContact O-N 3.38Å
21	K	83.5	Confident	83.5	Confident	166 Å²	166	113 Å²	113	72%	0.722	56%	0.555	S	S	*	*	H	α-helix	trans	-57.1	-40.2	-177.5	-63.2	-179.9	-177.4	179.5	0	111.9	V23 K24 Y25	K21-V23 PolarHBondContact O-N 3.23Å; K21-K24 PolarHBondContact O-N 2.88Å; K21-Y25 HydrophobicContact CB-CD2 4.35Å; K21-Y25 HydrophobicContact CB-CE2 4.36Å; K21-Y25 WeakPolarHBondContact O-CD2 3.15Å; K21-Y25 PolarHBondContact O-N 2.93Å
22	T	87.1	Confident	84.4	Confident	115 Å²	115	113.1 Å²	113.1	71%	0.706	56%	0.557	S	S	*	*	H	α-helix	trans	-61.3	-40.2	176.9	22.8	0	0	0	0	113.3	N20 G26	N20-T22 VanDerWaalsContact C-N 3.27Å; N20-T22 PolarHBondContact O-N 3.24Å; T22-G26 WeakPolarHBondContact O-CA 3.14Å; T22-G26 PolarHBondContact O-N 3.23Å
23	V	88.4	Confident	85.5	Confident	43 Å²	43	109.9 Å²	109.9	26%	0.261	55%	0.55	S	S	.	.	H	α-helix	trans	-73.6	-43.4	177.3	-178.9	0	0	0	0	110.2	L17 N20 K21 Y25 V27	L17-V23 HydrophobicContact CD1-CG2 4.2Å; L17-V23 HydrophobicContact CG-CG1 4.36Å; L17-V23 HydrophobicContact CG-CG2 4.48Å; N20-V23 HydrophobicContact CB-CB 4.46Å; N20-V23 HydrophobicContact CB-CG2 4.14Å; N20-V23 PolarHBondContact O-N 3.1Å; N20-V23 VanDerWaalsContact O-N 3.1Å; K21-V23 PolarHBondContact O-N 3.23Å; V23-Y25 VanDerWaalsContact C-N 3.31Å; V23-Y25 PolarHBondContact O-N 3.19Å; V23-V27 HydrophobicContact CG1-CG2 3.72Å; V23-V27 WeakPolarHBondContact O-CB 3.14Å; V23-V27 VanDerWaalsContact O-CG2 3.29Å; V23-V27 WeakPolarHBondContact O-CG2 3.41Å; V23-V27 PolarHBondContact O-N 2.9Å
24	K	86.3	Confident	86.4	Confident	128 Å²	128	111 Å²	111	56%	0.557	55%	0.549	S	S	*	.	H	α-helix	trans	-59.2	-38.2	-179.5	-174.1	176.9	179.9	-179.6	0	113.2	N20 K21 P28	N20-K24 PolarHBondContact O-N 3.38Å; K21-K24 PolarHBondContact O-N 2.88Å; K24-P28 WeakPolarHBondContact O-CD 3.41Å; K24-P28 VanDerWaalsContact O-CG 3.31Å; K24-P28 WeakPolarHBondContact O-CG 3.37Å
25	Y	90.9	Very high	87.2	Confident	155 Å²	155	105.4 Å²	105.4	61%	0.608	54%	0.541	S	S	*	.	H	α-helix	trans	-100.7	-28.3	-179.4	-60.2	-66	0	0	0	113.4	K21 V23 M29	K21-Y25 HydrophobicContact CB-CD2 4.35Å; K21-Y25 HydrophobicContact CB-CE2 4.36Å; K21-Y25 WeakPolarHBondContact O-CD2 3.15Å; K21-Y25 PolarHBondContact O-N 2.93Å; V23-Y25 VanDerWaalsContact C-N 3.31Å; V23-Y25 PolarHBondContact O-N 3.19Å; Y25-M29 PolarHBondContact O-N 3.23Å
26	G	91.8	Very high	87.9	Confident	33 Å²	33	99.1 Å²	99.1	34%	0.34	52%	0.522	S	S	.	.	H	α-helix	trans	-76.9	-37	-179.4	0	0	0	0	0	113.6	T22 M29 L30	T22-G26 WeakPolarHBondContact O-CA 3.14Å; T22-G26 PolarHBondContact O-N 3.23Å; G26-M29 PolarHBondContact O-N 3.18Å; G26-L30 WeakPolarHBondContact O-CB 3.42Å; G26-L30 PolarHBondContact O-N 3.3Å
27	V	91.9	Very high	88.4	Confident	72 Å²	72	99.6 Å²	99.6	44%	0.436	53%	0.529	S	S	.	.	H	α-helix	trans	-63.6	-47.2	178.2	172.6	0	0	0	0	111.7	V23 M29 L30 L31	V23-V27 HydrophobicContact CG1-CG2 3.72Å; V23-V27 WeakPolarHBondContact O-CB 3.14Å; V23-V27 VanDerWaalsContact O-CG2 3.29Å; V23-V27 WeakPolarHBondContact O-CG2 3.41Å; V23-V27 PolarHBondContact O-N 2.9Å; V27-M29 VanDerWaalsContact C-N 3.31Å; V27-M29 PolarHBondContact O-N 3.24Å; V27-L30 PolarHBondContact O-N 3.38Å; V27-L31 HydrophobicContact CG1-CD1 3.91Å; V27-L31 HydrophobicContact CG1-CG 4.34Å; V27-L31 WeakPolarHBondContact O-CB 3.27Å; V27-L31 VanDerWaalsContact O-CG 3.3Å; V27-L31 WeakPolarHBondContact O-CG 3.47Å; V27-L31 PolarHBondContact O-N 3.43Å
28	P	93.1	Very high	89	Confident	66 Å²	66	102.4 Å²	102.4	43%	0.429	54%	0.537	S	S	.	.	H	α-helix	trans	-59.6	-38.2	173.5	-25.4	34.9	0	0	0	113.6	K24 L32	K24-P28 WeakPolarHBondContact O-CD 3.41Å; K24-P28 VanDerWaalsContact O-CG 3.31Å; K24-P28 WeakPolarHBondContact O-CG 3.37Å; P28-L32 WeakPolarHBondContact O-CB 3.28Å; P28-L32 PolarHBondContact O-N 3.35Å
29	M	93.6	Very high	89.4	Confident	132 Å²	132	99.3 Å²	99.3	65%	0.65	53%	0.533	S	S	*	.	H	α-helix	trans	-65.8	-45.6	177.3	-171.7	-165.9	-177.2	0	0	111.6	Y25 G26 V27 L32 V33	Y25-M29 PolarHBondContact O-N 3.23Å; G26-M29 PolarHBondContact O-N 3.18Å; V27-M29 VanDerWaalsContact C-N 3.31Å; V27-M29 PolarHBondContact O-N 3.24Å; M29-L32 WeakPolarHBondContact O-CB 3.45Å; M29-L32 PolarHBondContact O-N 2.99Å; M29-V33 WeakPolarHBondContact O-CG2 3.22Å; M29-V33 PolarHBondContact O-N 2.94Å
30	L	93.2	Very high	89.2	Confident	105 Å²	105	94.2 Å²	94.2	55%	0.55	52%	0.522	S	S	.	.	H	α-helix	trans	-63.9	-42.2	178.3	-173.3	73.2	0	0	0	111.3	G26 V27 L32 V33 I34	G26-L30 WeakPolarHBondContact O-CB 3.42Å; G26-L30 PolarHBondContact O-N 3.3Å; V27-L30 PolarHBondContact O-N 3.38Å; L30-L32 VanDerWaalsContact C-N 3.31Å; L30-L32 PolarHBondContact O-N 2.97Å; L30-V33 PolarHBondContact O-N 3.37Å; L30-I34 HydrophobicContact CD1-CD1 4.17Å; L30-I34 HydrophobicContact CD2-CD1 4.33Å; L30-I34 HydrophobicContact CG-CD1 3.82Å; L30-I34 HydrophobicContact CG-CG1 4.5Å; L30-I34 WeakPolarHBondContact O-CG1 3.36Å; L30-I34 PolarHBondContact O-N 3.24Å
31	L	94.1	Very high	88.8	Confident	113 Å²	113	96.6 Å²	96.6	59%	0.592	52%	0.524	S	S	*	.	H	α-helix	trans	-61.2	-39.1	174.5	-74.7	172.7	0	0	0	111.9	V27 G35	V27-L31 HydrophobicContact CG1-CD1 3.91Å; V27-L31 HydrophobicContact CG1-CG 4.34Å; V27-L31 WeakPolarHBondContact O-CB 3.27Å; V27-L31 VanDerWaalsContact O-CG 3.3Å; V27-L31 WeakPolarHBondContact O-CG 3.47Å; V27-L31 PolarHBondContact O-N 3.43Å; L31-G35 WeakPolarHBondContact O-CA 3.3Å; L31-G35 PolarHBondContact O-N 3.05Å
32	L	93	Very high	88.1	Confident	133 Å²	133	94 Å²	94	70%	0.696	52%	0.515	S	S	*	.	H	α-helix	trans	-66	-40.6	174.4	-95.1	166.4	0	0	0	112.5	P28 M29 L30 G36	P28-L32 WeakPolarHBondContact O-CB 3.28Å; P28-L32 PolarHBondContact O-N 3.35Å; M29-L32 WeakPolarHBondContact O-CB 3.45Å; M29-L32 PolarHBondContact O-N 2.99Å; L30-L32 VanDerWaalsContact C-N 3.31Å; L30-L32 PolarHBondContact O-N 2.97Å; L32-G36 WeakPolarHBondContact O-CA 3.38Å; L32-G36 PolarHBondContact O-N 2.83Å
33	V	93.1	Very high	87.1	Confident	83 Å²	83	95.6 Å²	95.6	50%	0.503	51%	0.512	S	S	.	.	H	α-helix	trans	-66.6	-47.9	178.9	171.7	0	0	0	0	110.8	M29 L30 S37	M29-V33 WeakPolarHBondContact O-CG2 3.22Å; M29-V33 PolarHBondContact O-N 2.94Å; L30-V33 PolarHBondContact O-N 3.37Å; V33-S37 WeakPolarHBondContact O-CB 3.24Å; V33-S37 PolarHBondContact O-N 3.33Å; V33-S37 PolarHBondContact O-OG 3.43Å
34	I	93	Very high	86	Confident	95 Å²	95	97.4 Å²	97.4	49%	0.487	52%	0.523	S	S	.	.	H	α-helix	trans	-68.9	-47.1	179.5	-62.8	171.1	0	0	0	110.2	L30 S37 F38	L30-I34 HydrophobicContact CD1-CD1 4.17Å; L30-I34 HydrophobicContact CD2-CD1 4.33Å; L30-I34 HydrophobicContact CG-CD1 3.82Å; L30-I34 HydrophobicContact CG-CG1 4.5Å; L30-I34 WeakPolarHBondContact O-CG1 3.36Å; L30-I34 PolarHBondContact O-N 3.24Å; I34-S37 PolarHBondContact O-N 2.99Å; I34-F38 WeakPolarHBondContact O-CB 3.47Å; I34-F38 PolarHBondContact O-N 3.07Å
35	G	92.4	Very high	84.9	Confident	43 Å²	43	95.3 Å²	95.3	44%	0.443	52%	0.515	S	S	.	.	H	α-helix	trans	-65.4	-38.1	179.1	0	0	0	0	0	113	L31 G39	L31-G35 WeakPolarHBondContact O-CA 3.3Å; L31-G35 PolarHBondContact O-N 3.05Å; G35-G39 WeakPolarHBondContact O-CA 3.13Å; G35-G39 PolarHBondContact O-N 3.46Å
36	G	90.1	Very high	83.6	Confident	29 Å²	29	92.8 Å²	92.8	30%	0.299	51%	0.511	S	S	.	.	H	α-helix	trans	-66	-43.7	173.4	0	0	0	0	0	112.2	L32 F38 G39 L40	L32-G36 WeakPolarHBondContact O-CA 3.38Å; L32-G36 PolarHBondContact O-N 2.83Å; G36-F38 PolarHBondContact O-N 3.2Å; G36-G39 PolarHBondContact O-N 3Å; G36-L40 VanDerWaalsContact O-CB 3.32Å; G36-L40 WeakPolarHBondContact O-CB 3.44Å; G36-L40 WeakPolarHBondContact O-CD1 3.29Å; G36-L40 WeakPolarHBondContact O-CG 3.46Å; G36-L40 PolarHBondContact O-N 3.42Å
37	S	87.1	Confident	82.3	Confident	83 Å²	83	99 Å²	99	58%	0.58	52%	0.524	S	S	*	.	H	α-helix	trans	-64.6	-39.3	177.9	-57.8	0	0	0	0	112.3	V33 I34	V33-S37 WeakPolarHBondContact O-CB 3.24Å; V33-S37 PolarHBondContact O-N 3.33Å; V33-S37 PolarHBondContact O-OG 3.43Å; I34-S37 PolarHBondContact O-N 2.99Å
38	F	86.9	Confident	80.6	Confident	145 Å²	145	102.8 Å²	102.8	64%	0.636	53%	0.532	S	S	*	.	H	α-helix	trans	-78.2	-38.6	177.8	-132.5	-96.6	0	0	0	112.4	I34 G36 R41	I34-F38 WeakPolarHBondContact O-CB 3.47Å; I34-F38 PolarHBondContact O-N 3.07Å; G36-F38 PolarHBondContact O-N 3.2Å; F38-R41 WeakPolarHBondContact O-CB 3.46Å; F38-R41 PolarHBondContact O-N 3.46Å
39	G	83.3	Confident	79	Confident	39 Å²	39	103.7 Å²	103.7	40%	0.402	53%	0.533	S	S	.	.	H	α-helix	trans	-70.1	-41	-178.8	0	0	0	0	0	113.4	G35 G36 R41 F43	G35-G39 WeakPolarHBondContact O-CA 3.13Å; G35-G39 PolarHBondContact O-N 3.46Å; G36-G39 PolarHBondContact O-N 3Å; G39-R41 VanDerWaalsContact C-N 3.27Å; G39-R41 PolarHBondContact O-N 3.48Å; G39-F43 WeakPolarHBondContact O-CD2 3.43Å
40	L	78.1	Confident	77.4	Confident	110 Å²	110	99.7 Å²	99.7	58%	0.576	52%	0.521	S	S	*	.	H	α-helix	trans	-71.3	-21.7	177.8	-72.1	163.8	0	0	0	113	G36 E42 F43 T44	G36-L40 VanDerWaalsContact O-CB 3.32Å; G36-L40 WeakPolarHBondContact O-CB 3.44Å; G36-L40 WeakPolarHBondContact O-CD1 3.29Å; G36-L40 WeakPolarHBondContact O-CG 3.46Å; G36-L40 PolarHBondContact O-N 3.42Å; L40-E42 VanDerWaalsContact C-N 3.3Å; L40-E42 PolarHBondContact O-N 3.08Å; L40-F43 PolarHBondContact O-N 3.27Å; L40-F43 VanDerWaalsContact O-N 3.16Å; L40-T44 WeakPolarHBondContact O-CG2 3.38Å; L40-T44 PolarHBondContact O-N 2.9Å; L40-T44 PolarHBondContact O-OG1 2.93Å
41	R	73.6	Confident	75.8	Confident	141 Å²	141	99.2 Å²	99.2	53%	0.532	52%	0.516	S	S	.	.	H	α-helix	trans	-58	-41.2	-178.5	-173.5	177.2	178.3	177.6	-1.3	112.3	F38 G39 T44 Q45	F38-R41 WeakPolarHBondContact O-CB 3.46Å; F38-R41 PolarHBondContact O-N 3.46Å; G39-R41 VanDerWaalsContact C-N 3.27Å; G39-R41 PolarHBondContact O-N 3.48Å; R41-T44 PolarHBondContact O-OG1 3.03Å; R41-Q45 WeakPolarHBondContact O-CG 3.39Å; R41-Q45 PolarHBondContact O-NE2 2.79Å
42	E	68.5	Low	74.1	Confident	112 Å²	112	99.9 Å²	99.9	52%	0.523	51%	0.514	S	S	.	.	H	α-helix	trans	-69.9	-41.1	176.9	-63.7	-56.9	134.5	0	0	111.6	L40 T44 Q45 I46	L40-E42 VanDerWaalsContact C-N 3.3Å; L40-E42 PolarHBondContact O-N 3.08Å; E42-T44 PolarHBondContact O-N 3.36Å; E42-Q45 PolarHBondContact O-N 3.44Å; E42-I46 WeakPolarHBondContact O-CG1 3.44Å
43	F	67.4	Low	72.5	Confident	147 Å²	147	99.7 Å²	99.7	65%	0.645	51%	0.512	S	S	*	.	H	α-helix	trans	-67.3	-32.6	179	-74.8	-78.4	0	0	0	113.7	G39 L40 Q45 I46	G39-F43 WeakPolarHBondContact O-CD2 3.43Å; L40-F43 PolarHBondContact O-N 3.27Å; L40-F43 VanDerWaalsContact O-N 3.16Å; F43-Q45 VanDerWaalsContact C-N 3.33Å; F43-Q45 PolarHBondContact O-N 3.04Å; F43-I46 HydrophobicContact CD1-CD1 4.26Å
44	T	64.4	Low	70.7	Confident	81 Å²	81	106.4 Å²	106.4	50%	0.497	53%	0.529	S	S	.	.	H	α-helix	trans	-70.8	-27.4	177.7	58.6	0	0	0	0	113.3	L40 R41 E42 Y48	L40-T44 WeakPolarHBondContact O-CG2 3.38Å; L40-T44 PolarHBondContact O-N 2.9Å; L40-T44 PolarHBondContact O-OG1 2.93Å; R41-T44 PolarHBondContact O-OG1 3.03Å; E42-T44 PolarHBondContact O-N 3.36Å; T44-Y48 WeakPolarHBondContact O-CD2 3.45Å
45	Q	63.3	Low	69	Low	84 Å²	84	109.8 Å²	109.8	39%	0.393	54%	0.54	S	S	.	.	H	α-helix	trans	-73.9	-35	178.5	-68.6	174.2	34.5	0	0	112	R41 E42 F43 R47 Y48 D49	R41-Q45 WeakPolarHBondContact O-CG 3.39Å; R41-Q45 PolarHBondContact O-NE2 2.79Å; E42-Q45 PolarHBondContact O-N 3.44Å; F43-Q45 VanDerWaalsContact C-N 3.33Å; F43-Q45 PolarHBondContact O-N 3.04Å; Q45-R47 PolarHBondContact O-N 2.81Å; Q45-R47 VanDerWaalsContact O-N 3.13Å; Q45-Y48 PolarHBondContact O-N 2.96Å; Q45-Y48 VanDerWaalsContact O-N 3.07Å; Q45-D49 PolarHBondContact O-N 3.44Å
46	I	64.2	Low	67.3	Low	103 Å²	103	116.6 Å²	116.6	53%	0.528	55%	0.552	S	S	.	*	H	α-helix	trans	-56	-35.2	179.7	-63	170.9	0	0	0	111.8	E42 F43 A50	E42-I46 WeakPolarHBondContact O-CG1 3.44Å; F43-I46 HydrophobicContact CD1-CD1 4.26Å; I46-A50 WeakPolarHBondContact O-CB 3.46Å; I46-A50 PolarHBondContact O-N 3.06Å
47	R	63.2	Low	65.7	Low	162 Å²	162	119.7 Å²	119.7	61%	0.611	56%	0.561	S	S	*	*	H	α-helix	trans	-70.1	-36.2	-178.5	-154.3	-179.2	74	119.3	2.3	112.5	Q45 Q51	Q45-R47 PolarHBondContact O-N 2.81Å; Q45-R47 VanDerWaalsContact O-N 3.13Å; R47-Q51 PolarHBondContact O-N 3.36Å
48	Y	57.8	Low	64.5	Low	152 Å²	152	120.6 Å²	120.6	60%	0.596	56%	0.56	S	S	*	*	H	α-helix	trans	-76.1	-39.9	177.7	-73	-73.6	0	0	0	111.5	T44 Q45 Q51 K52	T44-Y48 WeakPolarHBondContact O-CD2 3.45Å; Q45-Y48 PolarHBondContact O-N 2.96Å; Q45-Y48 VanDerWaalsContact O-N 3.07Å; Y48-Q51 PolarHBondContact O-N 2.97Å; Y48-K52 VanDerWaalsContact O-CB 3.29Å; Y48-K52 WeakPolarHBondContact O-CB 3.38Å; Y48-K52 PolarHBondContact O-N 3.28Å
49	D	59.8	Low	63.3	Low	85 Å²	85	118.3 Å²	118.3	46%	0.455	56%	0.56	S	S	.	*	H	α-helix	trans	-68.4	-39.7	176.8	-75.2	-25	0	0	0	112.1	Q45 Q51 K52 I53	Q45-D49 PolarHBondContact O-N 3.44Å; D49-Q51 PolarHBondContact O-N 3.18Å; D49-K52 PolarHBondContact O-N 2.96Å; D49-I53 VanDerWaalsContact O-CG1 3.27Å; D49-I53 WeakPolarHBondContact O-CG1 3.48Å; D49-I53 PolarHBondContact O-N 3.16Å
50	A	59.9	Low	62.3	Low	48 Å²	48	119.7 Å²	119.7	40%	0.397	56%	0.563	S	S	.	*	H	α-helix	trans	-63.7	-39	173.6	0	0	0	0	0	112.5	I46 R54	I46-A50 WeakPolarHBondContact O-CB 3.46Å; I46-A50 PolarHBondContact O-N 3.06Å; A50-R54 WeakPolarHBondContact O-CG 3.48Å; A50-R54 PolarHBondContact O-N 3.42Å
51	Q	59	Low	61.5	Low	95 Å²	95	118.4 Å²	118.4	44%	0.444	56%	0.556	S	S	.	*	H	α-helix	trans	-69.9	-35.5	173.3	-81.2	-170.5	-62.9	0	0	112.6	R47 Y48 D49 I53 R54 K55	R47-Q51 PolarHBondContact O-N 3.36Å; Y48-Q51 PolarHBondContact O-N 2.97Å; D49-Q51 PolarHBondContact O-N 3.18Å; Q51-I53 VanDerWaalsContact C-N 3.35Å; Q51-R54 PolarHBondContact O-N 3.48Å; Q51-K55 WeakPolarHBondContact O-CB 3.4Å; Q51-K55 WeakPolarHBondContact O-CG 3.46Å; Q51-K55 PolarHBondContact O-N 3.14Å
52	K	58.3	Low	60.9	Low	128 Å²	128	116.8 Å²	116.8	56%	0.557	56%	0.555	S	S	*	*	H	α-helix	trans	-66.8	-36.5	176.6	-171.3	174.6	178.9	-176.5	0	111.7	Y48 D49 R56	Y48-K52 VanDerWaalsContact O-CB 3.29Å; Y48-K52 WeakPolarHBondContact O-CB 3.38Å; Y48-K52 PolarHBondContact O-N 3.28Å; D49-K52 PolarHBondContact O-N 2.96Å; K52-R56 VanDerWaalsContact O-CG 3.23Å; K52-R56 WeakPolarHBondContact O-CG 3.29Å; K52-R56 PolarHBondContact O-N 3.14Å
53	I	58.2	Low	60.5	Low	128 Å²	128	115.1 Å²	115.1	66%	0.656	56%	0.56	S	S	*	*	H	α-helix	trans	-68.3	-41.2	172.3	-66.6	164.2	0	0	0	111	D49 Q51 K55 R56	D49-I53 VanDerWaalsContact O-CG1 3.27Å; D49-I53 WeakPolarHBondContact O-CG1 3.48Å; D49-I53 PolarHBondContact O-N 3.16Å; Q51-I53 VanDerWaalsContact C-N 3.35Å; I53-K55 VanDerWaalsContact C-N 3.34Å; I53-K55 PolarHBondContact O-N 3.4Å; I53-R56 PolarHBondContact O-N 3.25Å
54	R	56.6	Low	60.3	Low	224 Å²	224	116.4 Å²	116.4	85%	0.845	57%	0.565	S	S	*	*	H	α-helix	trans	-71.3	-24.1	176.2	-68.8	-173.9	100.8	-173.3	6.7	114.4	A50 Q51	A50-R54 WeakPolarHBondContact O-CG 3.48Å; A50-R54 PolarHBondContact O-N 3.42Å; Q51-R54 PolarHBondContact O-N 3.48Å
55	K	56.8	Low	60.2	Low	166 Å²	166	116.6 Å²	116.6	72%	0.722	57%	0.566	S	S	*	*	H	α-helix	trans	-85	-17.7	175.5	-78.7	-172.8	177.6	-171.3	0	113.8	Q51 I53 L57	Q51-K55 WeakPolarHBondContact O-CB 3.4Å; Q51-K55 WeakPolarHBondContact O-CG 3.46Å; Q51-K55 PolarHBondContact O-N 3.14Å; I53-K55 VanDerWaalsContact C-N 3.34Å; I53-K55 PolarHBondContact O-N 3.4Å; K55-L57 PolarHBondContact O-N 3.15Å
56	R	57.5	Low	60.4	Low	186 Å²	186	115.9 Å²	115.9	70%	0.702	57%	0.565	S	S	*	*	S	Bend	trans	-71.2	91.8	165.1	-68.2	-99.9	-179.4	134.8	-3	105.5	K52 I53 D58	K52-R56 VanDerWaalsContact O-CG 3.23Å; K52-R56 WeakPolarHBondContact O-CG 3.29Å; K52-R56 PolarHBondContact O-N 3.14Å; I53-R56 PolarHBondContact O-N 3.25Å; R56-D58 PolarHBondContact O-N 3.14Å
57	L	55.5	Low	60.5	Low	94 Å²	94	114.3 Å²	114.3	49%	0.492	57%	0.568	S	S	.	*			trans	-48.9	138	168.3	-85.7	138.1	0	0	0	107.8	K55 L61 E62	K55-L57 PolarHBondContact O-N 3.15Å; L57-L61 HydrophobicContact CD2-CB 3.96Å; L57-L61 HydrophobicContact CD2-CD1 4.48Å; L57-E62 HydrophobicContact CB-CG 3.53Å; L57-E62 HydrophobicContact CD1-CG 4.23Å; L57-E62 HydrophobicContact CG-CG 4.43Å
58	D	62.1	Low	60.6	Low	103 Å²	103	114 Å²	114	55%	0.551	57%	0.573	S	S	*	*			trans	-51.5	128	172.1	-145.2	-36.8	0	0	0	107.4	R56 S60 L61 E62	R56-D58 PolarHBondContact O-N 3.14Å; D58-S60 PolarHBondContact O-N 3.26Å; D58-L61 HydrophobicContact CB-CD1 3.97Å; D58-L61 HydrophobicContact CB-CG 4.46Å; D58-L61 WeakPolarHBondContact O-CA 3.23Å; D58-L61 WeakPolarHBondContact O-CB 3.27Å; D58-L61 PolarHBondContact O-N 3.33Å; D58-E62 PolarHBondContact O-N 2.91Å
59	P	62.5	Low	61.1	Low	97 Å²	97	113.3 Å²	113.3	63%	0.63	57%	0.573	S	S	*	*	H	α-helix	trans	-55.6	-20.2	-175.8	15.7	-30	0	0	0	113.4	A63	P59-A63 WeakPolarHBondContact O-CB 3.42Å; P59-A63 PolarHBondContact O-N 3.28Å
60	S	61.9	Low	61.6	Low	68 Å²	68	114.3 Å²	114.3	48%	0.476	58%	0.575	S	S	.	*	H	α-helix	trans	-69.4	-27.6	170.9	65.1	0	0	0	0	114.8	D58 K64	D58-S60 PolarHBondContact O-N 3.26Å; S60-K64 WeakPolarHBondContact O-CG 3.18Å
61	L	60.5	Low	62.1	Low	83 Å²	83	114.2 Å²	114.2	44%	0.435	58%	0.575	S	S	.	*	H	α-helix	trans	-86.8	-38.2	176.6	-77	160.2	0	0	0	111.7	L57 D58 A63 K64 V65	L57-L61 HydrophobicContact CD2-CB 3.96Å; L57-L61 HydrophobicContact CD2-CD1 4.48Å; D58-L61 HydrophobicContact CB-CD1 3.97Å; D58-L61 HydrophobicContact CB-CG 4.46Å; D58-L61 WeakPolarHBondContact O-CA 3.23Å; D58-L61 WeakPolarHBondContact O-CB 3.27Å; D58-L61 PolarHBondContact O-N 3.33Å; L61-A63 VanDerWaalsContact C-N 3.31Å; L61-A63 PolarHBondContact O-N 3.01Å; L61-K64 WeakPolarHBondContact O-CB 3.41Å; L61-K64 PolarHBondContact O-N 3.12Å; L61-K64 VanDerWaalsContact O-N 3.12Å; L61-V65 WeakPolarHBondContact O-CG2 3.36Å; L61-V65 PolarHBondContact O-N 3.47Å
62	E	61.4	Low	62.9	Low	107 Å²	107	114 Å²	114	50%	0.5	58%	0.58	S	S	.	*	H	α-helix	trans	-62.3	-39.4	172.2	-72.3	-177.8	171	0	0	111.4	L57 D58 K64 V65	L57-E62 HydrophobicContact CB-CG 3.53Å; L57-E62 HydrophobicContact CD1-CG 4.23Å; L57-E62 HydrophobicContact CG-CG 4.43Å; D58-E62 PolarHBondContact O-N 2.91Å; E62-K64 PolarHBondContact O-N 3.47Å; E62-V65 CarbonylContact O-C 3.34Å; E62-V65 PolarHBondContact O-N 2.97Å; E62-V65 VanDerWaalsContact O-N 3.14Å
63	A	61.1	Low	63.9	Low	77 Å²	77	112.2 Å²	112.2	64%	0.636	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.4	-25.8	174.5	0	0	0	0	0	113.5	P59 L61	P59-A63 WeakPolarHBondContact O-CB 3.42Å; P59-A63 PolarHBondContact O-N 3.28Å; L61-A63 VanDerWaalsContact C-N 3.31Å; L61-A63 PolarHBondContact O-N 3.01Å
64	K	62.7	Low	65.3	Low	173 Å²	173	111.8 Å²	111.8	75%	0.752	57%	0.573	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.1	-31.8	174.2	-73.6	177.6	179.8	-177.3	0	112.3	S60 L61 E62 N66	S60-K64 WeakPolarHBondContact O-CG 3.18Å; L61-K64 WeakPolarHBondContact O-CB 3.41Å; L61-K64 PolarHBondContact O-N 3.12Å; L61-K64 VanDerWaalsContact O-N 3.12Å; E62-K64 PolarHBondContact O-N 3.47Å; K64-N66 VanDerWaalsContact C-N 3.31Å; K64-N66 PolarHBondContact O-N 3.2Å
65	V	62.3	Low	66.5	Low	85 Å²	85	107.7 Å²	107.7	52%	0.515	56%	0.564	S	S	.	*			trans	-93.9	66.2	178	-173.5	0	0	0	0	108.9	L61 E62 A67	L61-V65 WeakPolarHBondContact O-CG2 3.36Å; L61-V65 PolarHBondContact O-N 3.47Å; E62-V65 CarbonylContact O-C 3.34Å; E62-V65 PolarHBondContact O-N 2.97Å; E62-V65 VanDerWaalsContact O-N 3.14Å; V65-A67 PolarHBondContact O-N 3.41Å; V65-A67 VanDerWaalsContact O-N 3.14Å
66	N	67.5	Low	68	Low	69 Å²	69	104.6 Å²	104.6	37%	0.369	55%	0.552	S	S	.	*			trans	-76.2	102.3	172.4	-156.1	-45.6	0	0	0	107.8	K64 E68 K69 Q70	K64-N66 VanDerWaalsContact C-N 3.31Å; K64-N66 PolarHBondContact O-N 3.2Å; N66-E68 PolarHBondContact O-N 3.05Å; N66-E68 VanDerWaalsContact O-N 3.14Å; N66-K69 HydrophobicContact CB-CB 4.28Å; N66-K69 HydrophobicContact CB-CD 4Å; N66-K69 HydrophobicContact CB-CG 4Å; N66-K69 WeakPolarHBondContact O-CB 3.47Å; N66-K69 PolarHBondContact O-N 3.2Å; N66-Q70 PolarHBondContact O-N 3.22Å; N66-Q70 VanDerWaalsContact O-N 3.15Å
67	A	66.3	Low	69.3	Low	70 Å²	70	100 Å²	100	58%	0.579	54%	0.539	S	S	*	.	H	α-helix	trans	-56	-32.1	-171.4	0	0	0	0	0	113.3	V65 Q70 A71	V65-A67 PolarHBondContact O-N 3.41Å; V65-A67 VanDerWaalsContact O-N 3.14Å; A67-Q70 PolarHBondContact O-N 2.96Å; A67-A71 PolarHBondContact O-N 3.37Å
68	E	64.9	Low	70.8	Confident	155 Å²	155	102.3 Å²	102.3	72%	0.724	54%	0.542	S	S	*	.	H	α-helix	trans	-65.1	-42.5	175.2	-63.1	-178.7	174.8	0	0	111.9	N66 Q70 A71 V72	N66-E68 PolarHBondContact O-N 3.05Å; N66-E68 VanDerWaalsContact O-N 3.14Å; E68-Q70 VanDerWaalsContact C-N 3.26Å; E68-Q70 PolarHBondContact O-N 3.07Å; E68-A71 PolarHBondContact O-N 2.91Å; E68-V72 WeakPolarHBondContact O-CG2 3.33Å; E68-V72 PolarHBondContact O-N 3.17Å
69	K	68.5	Low	72	Confident	138 Å²	138	101.4 Å²	101.4	60%	0.6	53%	0.534	S	S	*	.	H	α-helix	trans	-64.5	-35.4	175.2	-64.1	-173.4	-179.5	-178.4	0	111.3	N66 V72 I73	N66-K69 HydrophobicContact CB-CB 4.28Å; N66-K69 HydrophobicContact CB-CD 4Å; N66-K69 HydrophobicContact CB-CG 4Å; N66-K69 WeakPolarHBondContact O-CB 3.47Å; N66-K69 PolarHBondContact O-N 3.2Å; K69-V72 PolarHBondContact O-N 3.42Å; K69-I73 WeakPolarHBondContact O-CB 3.45Å; K69-I73 VanDerWaalsContact O-CD1 3.29Å; K69-I73 WeakPolarHBondContact O-CD1 3.46Å; K69-I73 WeakPolarHBondContact O-CG1 3.38Å; K69-I73 PolarHBondContact O-N 3.42Å
70	Q	71.1	Confident	73.2	Confident	106 Å²	106	100.9 Å²	100.9	50%	0.495	52%	0.522	S	S	.	.	H	α-helix	trans	-69.7	-37.1	-179.8	-157.1	165.3	11.8	0	0	112	N66 A67 E68 I73 L74	N66-Q70 PolarHBondContact O-N 3.22Å; N66-Q70 VanDerWaalsContact O-N 3.15Å; A67-Q70 PolarHBondContact O-N 2.96Å; E68-Q70 VanDerWaalsContact C-N 3.26Å; E68-Q70 PolarHBondContact O-N 3.07Å; Q70-I73 PolarHBondContact O-N 2.86Å; Q70-L74 WeakPolarHBondContact O-CB 3.06Å; Q70-L74 VanDerWaalsContact O-CG 3.22Å; Q70-L74 WeakPolarHBondContact O-CG 3.47Å; Q70-L74 PolarHBondContact O-N 3.46Å
71	A	69.8	Low	74.2	Confident	47 Å²	47	102.8 Å²	102.8	39%	0.388	53%	0.526	S	S	.	.	H	α-helix	trans	-63.2	-46.6	173.1	0	0	0	0	0	111.9	A67 E68 I73 L74 E75	A67-A71 PolarHBondContact O-N 3.37Å; E68-A71 PolarHBondContact O-N 2.91Å; A71-I73 VanDerWaalsContact C-N 3.33Å; A71-I73 PolarHBondContact O-N 2.9Å; A71-L74 PolarHBondContact O-N 2.74Å; A71-L74 VanDerWaalsContact O-N 3.16Å; A71-E75 PolarHBondContact O-N 2.92Å
72	V	74.5	Confident	75.3	Confident	91 Å²	91	104.8 Å²	104.8	55%	0.552	53%	0.531	S	S	*	.	H	α-helix	trans	-60.6	-42	176.3	174.8	0	0	0	0	111.5	E68 K69 E75 E76	E68-V72 WeakPolarHBondContact O-CG2 3.33Å; E68-V72 PolarHBondContact O-N 3.17Å; K69-V72 PolarHBondContact O-N 3.42Å; V72-E75 PolarHBondContact O-N 3.07Å; V72-E76 WeakPolarHBondContact O-CB 3.37Å; V72-E76 PolarHBondContact O-N 3.23Å
73	I	81.1	Confident	76.2	Confident	90 Å²	90	106.8 Å²	106.8	46%	0.462	54%	0.541	S	S	.	.	H	α-helix	trans	-63.8	-40.8	176	-68.4	161.6	0	0	0	111.1	K69 Q70 A71 E76 E77	K69-I73 WeakPolarHBondContact O-CB 3.45Å; K69-I73 VanDerWaalsContact O-CD1 3.29Å; K69-I73 WeakPolarHBondContact O-CD1 3.46Å; K69-I73 WeakPolarHBondContact O-CG1 3.38Å; K69-I73 PolarHBondContact O-N 3.42Å; Q70-I73 PolarHBondContact O-N 2.86Å; A71-I73 VanDerWaalsContact C-N 3.33Å; A71-I73 PolarHBondContact O-N 2.9Å; I73-E76 PolarHBondContact O-N 2.97Å; I73-E77 HydrophobicContact CG2-CG 4.25Å; I73-E77 WeakPolarHBondContact O-CB 3.34Å; I73-E77 VanDerWaalsContact O-CG 3.3Å; I73-E77 WeakPolarHBondContact O-CG 3.32Å; I73-E77 PolarHBondContact O-N 2.72Å
74	L	85.7	Confident	77.2	Confident	118 Å²	118	107.1 Å²	107.1	62%	0.618	53%	0.531	S	S	*	.	H	α-helix	trans	-65	-40.3	179.4	-75.5	166.9	0	0	0	112.3	Q70 A71 Y78	Q70-L74 WeakPolarHBondContact O-CB 3.06Å; Q70-L74 VanDerWaalsContact O-CG 3.22Å; Q70-L74 WeakPolarHBondContact O-CG 3.47Å; Q70-L74 PolarHBondContact O-N 3.46Å; A71-L74 PolarHBondContact O-N 2.74Å; A71-L74 VanDerWaalsContact O-N 3.16Å; L74-Y78 VanDerWaalsContact O-CB 3.28Å; L74-Y78 WeakPolarHBondContact O-CB 3.36Å; L74-Y78 PolarHBondContact O-N 3.33Å
75	E	82.9	Confident	77.8	Confident	138 Å²	138	105.8 Å²	105.8	65%	0.645	53%	0.527	S	S	*	.	H	α-helix	trans	-65.6	-42.1	174.8	-71	176.6	-177.1	0	0	111.7	A71 V72 Y78 E79	A71-E75 PolarHBondContact O-N 2.92Å; V72-E75 PolarHBondContact O-N 3.07Å; E75-Y78 WeakPolarHBondContact O-CB 3.49Å; E75-Y78 PolarHBondContact O-N 3.49Å; E75-E79 PolarHBondContact O-N 3.34Å
76	E	87.3	Confident	78.4	Confident	102 Å²	102	107.6 Å²	107.6	48%	0.477	53%	0.533	S	S	.	.	H	α-helix	trans	-63.1	-45.9	176.6	-166.3	-165.8	141.4	0	0	111.8	V72 I73 Y78 E79 K80	V72-E76 WeakPolarHBondContact O-CB 3.37Å; V72-E76 PolarHBondContact O-N 3.23Å; I73-E76 PolarHBondContact O-N 2.97Å; E76-Y78 VanDerWaalsContact C-N 3.29Å; E76-Y78 PolarHBondContact O-N 3.5Å; E76-E79 PolarHBondContact O-N 3.47Å; E76-K80 WeakPolarHBondContact O-CG 3.44Å; E76-K80 PolarHBondContact O-N 3.16Å; E76-K80 VanDerWaalsContact O-N 3.08Å; E76-K80 VanDerWaalsContact OE1-CE 3.24Å; E76-K80 WeakPolarHBondContact OE1-CE 3.41Å; E76-K80 IonicContact OE1-NZ 2.83Å; E76-K80 PolarHBondContact OE1-NZ 3.41Å
77	E	86.5	Confident	78.9	Confident	90 Å²	90	112 Å²	112	42%	0.421	56%	0.557	S	S	.	*	H	α-helix	trans	-65	-34.5	175.5	-70.1	-61.3	126.3	0	0	111.8	I73 K80 L81	I73-E77 HydrophobicContact CG2-CG 4.25Å; I73-E77 WeakPolarHBondContact O-CB 3.34Å; I73-E77 VanDerWaalsContact O-CG 3.3Å; I73-E77 WeakPolarHBondContact O-CG 3.32Å; I73-E77 PolarHBondContact O-N 2.72Å; E77-K80 PolarHBondContact O-N 3.02Å; E77-K80 IonicContact OE1-NZ 2.79Å; E77-K80 PolarHBondContact OE1-NZ 3.24Å; E77-L81 VanDerWaalsContact O-CG 3.27Å; E77-L81 WeakPolarHBondContact O-CG 3.33Å; E77-L81 PolarHBondContact O-N 3.43Å
78	Y	86.6	Confident	79.5	Confident	142 Å²	142	116.4 Å²	116.4	56%	0.557	57%	0.565	S	S	*	*	H	α-helix	trans	-64.7	-47.3	175.2	173.9	-97	0	0	0	112.4	L74 E75 E76 K80 L81 K82	L74-Y78 VanDerWaalsContact O-CB 3.28Å; L74-Y78 WeakPolarHBondContact O-CB 3.36Å; L74-Y78 PolarHBondContact O-N 3.33Å; E75-Y78 WeakPolarHBondContact O-CB 3.49Å; E75-Y78 PolarHBondContact O-N 3.49Å; E76-Y78 VanDerWaalsContact C-N 3.29Å; E76-Y78 PolarHBondContact O-N 3.5Å; Y78-K80 VanDerWaalsContact C-N 3.33Å; Y78-K80 PolarHBondContact O-N 2.99Å; Y78-L81 PolarHBondContact O-N 3.31Å; Y78-K82 HydrophobicContact CE1-CD 4.08Å; Y78-K82 WeakPolarHBondContact O-CB 3.5Å; Y78-K82 PolarHBondContact O-N 3.13Å
79	E	87.9	Confident	80.1	Confident	83 Å²	83	118.4 Å²	118.4	39%	0.388	57%	0.566	S	S	.	*	H	α-helix	trans	-64.2	-38.4	177.3	-71.2	-64	149.4	0	0	111.2	E75 E76 L81 K82 E83	E75-E79 PolarHBondContact O-N 3.34Å; E76-E79 PolarHBondContact O-N 3.47Å; E79-L81 PolarHBondContact O-N 3.5Å; E79-K82 PolarHBondContact O-N 3.47Å; E79-K82 IonicContact OE1-NZ 2.81Å; E79-K82 PolarHBondContact OE1-NZ 3.4Å; E79-K82 IonicContact OE2-NZ 3.05Å; E79-K82 PolarHBondContact OE2-NZ 2.76Å; E79-E83 WeakPolarHBondContact O-CG 3.21Å; E79-E83 PolarHBondContact O-N 3.26Å
80	K	86.3	Confident	80.5	Confident	87 Å²	87	117.4 Å²	117.4	38%	0.378	56%	0.562	S	S	.	*	H	α-helix	trans	-56.9	-47.3	171.2	-71.7	173	-166.6	161	0	112	E76 E77 Y78 K82 E83 I84	E76-K80 WeakPolarHBondContact O-CG 3.44Å; E76-K80 PolarHBondContact O-N 3.16Å; E76-K80 VanDerWaalsContact O-N 3.08Å; E76-K80 VanDerWaalsContact OE1-CE 3.24Å; E76-K80 WeakPolarHBondContact OE1-CE 3.41Å; E76-K80 IonicContact OE1-NZ 2.83Å; E76-K80 PolarHBondContact OE1-NZ 3.41Å; E77-K80 PolarHBondContact O-N 3.02Å; E77-K80 IonicContact OE1-NZ 2.79Å; E77-K80 PolarHBondContact OE1-NZ 3.24Å; Y78-K80 VanDerWaalsContact C-N 3.33Å; Y78-K80 PolarHBondContact O-N 2.99Å; K80-K82 VanDerWaalsContact C-N 3.3Å; K80-K82 PolarHBondContact O-N 3.38Å; K80-E83 PolarHBondContact O-N 3.46Å; K80-I84 WeakPolarHBondContact O-CG1 3.19Å; K80-I84 PolarHBondContact O-N 3.1Å
81	L	83.3	Confident	81	Confident	107 Å²	107	119.4 Å²	119.4	56%	0.56	58%	0.576	S	S	*	*	H	α-helix	trans	-66.3	-32.5	-179.5	-72.6	174.2	0	0	0	112.9	E77 Y78 E79 I84	E77-L81 VanDerWaalsContact O-CG 3.27Å; E77-L81 WeakPolarHBondContact O-CG 3.33Å; E77-L81 PolarHBondContact O-N 3.43Å; Y78-L81 PolarHBondContact O-N 3.31Å; E79-L81 PolarHBondContact O-N 3.5Å; L81-I84 HydrophobicContact CD2-CD1 3.98Å; L81-I84 PolarHBondContact O-N 2.96Å
82	K	83.3	Confident	81.4	Confident	125 Å²	125	122.1 Å²	122.1	54%	0.543	58%	0.583	S	S	.	*	H	α-helix	trans	-72.2	-30.3	177.6	-179.5	-176.8	162.9	-153.3	0	112.7	Y78 E79 K80 I84	Y78-K82 HydrophobicContact CE1-CD 4.08Å; Y78-K82 WeakPolarHBondContact O-CB 3.5Å; Y78-K82 PolarHBondContact O-N 3.13Å; E79-K82 PolarHBondContact O-N 3.47Å; E79-K82 IonicContact OE1-NZ 2.81Å; E79-K82 PolarHBondContact OE1-NZ 3.4Å; E79-K82 IonicContact OE2-NZ 3.05Å; E79-K82 PolarHBondContact OE2-NZ 2.76Å; K80-K82 VanDerWaalsContact C-N 3.3Å; K80-K82 PolarHBondContact O-N 3.38Å; K82-I84 VanDerWaalsContact C-N 3.3Å
83	E	81.6	Confident	81.8	Confident	149 Å²	149	123.4 Å²	123.4	70%	0.696	58%	0.578	S	S	*	*	H	α-helix	trans	-75.7	-16.7	173	-71.2	179.7	177.3	0	0	113.2	E79 K80 H85	E79-E83 WeakPolarHBondContact O-CG 3.21Å; E79-E83 PolarHBondContact O-N 3.26Å; K80-E83 PolarHBondContact O-N 3.46Å; E83-H85 PolarHBondContact O-N 2.79Å
84	I	81.2	Confident	81.9	Confident	84 Å²	84	121.7 Å²	121.7	43%	0.431	58%	0.582	S	S	.	*	S	Bend	trans	-74.2	121.2	177.3	-65.6	168	0	0	0	109.9	K80 L81 K82 L86	K80-I84 WeakPolarHBondContact O-CG1 3.19Å; K80-I84 PolarHBondContact O-N 3.1Å; L81-I84 HydrophobicContact CD2-CD1 3.98Å; L81-I84 PolarHBondContact O-N 2.96Å; K82-I84 VanDerWaalsContact C-N 3.3Å; I84-L86 HydrophobicContact CG2-CD2 4.42Å; I84-L86 PolarHBondContact O-N 3.05Å
85	H	74.9	Confident	82	Confident	145 Å²	145	118.7 Å²	118.7	67%	0.671	57%	0.57	S	S	*	*			trans	-69	91.3	170.5	-69.4	-70.9	0	0	0	110.9	E83 D87 E88	E83-H85 PolarHBondContact O-N 2.79Å; H85-D87 PolarHBondContact O-N 2.88Å; H85-E88 PolarHBondContact O-N 2.94Å
86	L	74.9	Confident	82.3	Confident	124 Å²	124	117.6 Å²	117.6	65%	0.649	56%	0.56	S	S	*	*	G	3₁₀ helix	trans	-63.6	-21.7	179.4	-66.9	168.4	0	0	0	113.3	I84 E88 W89	I84-L86 HydrophobicContact CG2-CD2 4.42Å; I84-L86 PolarHBondContact O-N 3.05Å; L86-E88 VanDerWaalsContact C-N 3.26Å; L86-E88 PolarHBondContact O-N 3.45Å; L86-W89 VanDerWaalsContact O-CB 3.26Å; L86-W89 WeakPolarHBondContact O-CB 3.31Å; L86-W89 PolarHBondContact O-N 3.28Å
87	D	78.4	Confident	82.5	Confident	162 Å²	162	119 Å²	119	87%	0.866	58%	0.578	S	S	*	*	G	3₁₀ helix	trans	-68.9	-23	-178.4	-60.4	-37.5	0	0	0	113.1	H85	H85-D87 PolarHBondContact O-N 2.88Å
88	E	77.9	Confident	82.5	Confident	161 Å²	161	124.2 Å²	124.2	75%	0.752	59%	0.594	S	S	*	*	G	3₁₀ helix	trans	-95.7	7.1	177.6	-66.3	-176.7	-172	0	0	113.1	H85 L86 K90	H85-E88 PolarHBondContact O-N 2.94Å; L86-E88 VanDerWaalsContact C-N 3.26Å; L86-E88 PolarHBondContact O-N 3.45Å; E88-K90 PolarHBondContact O-N 2.94Å; E88-K90 VanDerWaalsContact O-N 3.1Å
89	W	79.4	Confident	82.5	Confident	197 Å²	197	119.6 Å²	119.6	75%	0.746	58%	0.577	S	S	*	*			trans	-62.2	115.6	-176.7	-177.8	-92.1	0	0	0	111.9	L86	L86-W89 VanDerWaalsContact O-CB 3.26Å; L86-W89 WeakPolarHBondContact O-CB 3.31Å; L86-W89 PolarHBondContact O-N 3.28Å
90	K	76.3	Confident	82.4	Confident	117 Å²	117	120 Å²	120	51%	0.509	58%	0.582	S	S	.	*			trans	-102.3	126.5	174.2	-73.3	-177.9	-179.1	177.2	0	110.7	E88 I92 L112	E88-K90 PolarHBondContact O-N 2.94Å; E88-K90 VanDerWaalsContact O-N 3.1Å; K90-I92 PolarHBondContact O-N 3.33Å; K90-L112 HydrophobicContact CD-CD1 4.14Å
91	N	80.4	Confident	82.4	Confident	149 Å²	149	118.5 Å²	118.5	80%	0.797	58%	0.583	S	S	*	*			trans	-75	107.2	173.5	-173.6	-11.5	0	0	0	110.3
92	I	78.7	Confident	82.5	Confident	104 Å²	104	122.6 Å²	122.6	53%	0.533	59%	0.591	S	S	.	*	P	Polyproline II helix	trans	-98	120.8	175.7	-56.2	174.5	0	0	0	108.6	K90 Q108	K90-I92 PolarHBondContact O-N 3.33Å; I92-Q108 HydrophobicContact CG2-CG 4.17Å
93	R	82.2	Confident	82.5	Confident	118 Å²	118	122.3 Å²	122.3	45%	0.445	59%	0.591	S	S	.	*	P	Polyproline II helix	trans	-67.9	140.3	171.3	25.1	164.3	-65.8	-142.5	8	110.4	E99 Y104	R93-E99 VanDerWaalsContact NH2-CD 3.29Å; R93-E99 IonicContact NH2-OE1 2.93Å; R93-E99 PolarHBondContact NH2-OE1 2.77Å; R93-E99 IonicContact NH2-OE2 2.9Å; R93-E99 PolarHBondContact NH2-OE2 2.95Å; R93-Y104 WeakPolarHBondContact CB-OH 3.32Å; R93-Y104 WeakPolarHBondContact CD-OH 3.25Å; R93-Y104 WeakPolarHBondContact CG-OH 3.3Å; R93-Y104 VanDerWaalsContact CZ-CE2 3.45Å; R93-Y104 PolarHBondContact NE-OH 3.08Å; R93-Y104 VanDerWaalsContact NH2-CE2 3.27Å; R93-Y104 WeakPolarHBondContact O-CE1 3.29Å; R93-Y104 PolarHBondContact O-OH 3.22Å
94	G	85	Confident	82.6	Confident	53 Å²	53	115.9 Å²	115.9	55%	0.546	56%	0.561	S	S	.	*	P	Polyproline II helix	trans	-69.2	162.6	166.5	0	0	0	0	0	112.6
95	P	87.9	Confident	82.6	Confident	55 Å²	55	116.7 Å²	116.7	36%	0.357	56%	0.563	S	S	.	*	P	Polyproline II helix	trans	-66.3	139.7	173.5	27.9	-32.3	0	0	0	110	E99 Y104	P95-E99 HydrophobicContact CB-CB 4.38Å; P95-Y104 HydrophobicContact CB-CD1 3.84Å; P95-Y104 HydrophobicContact CB-CE1 4.39Å; P95-Y104 HydrophobicContact CB-CG 4.21Å; P95-Y104 HydrophobicContact CG-CD1 4.47Å
96	R	88	Confident	83.1	Confident	116 Å²	116	116 Å²	116	44%	0.438	56%	0.56	S	S	.	*	P	Polyproline II helix	trans	-68.1	157.2	170.6	-59.1	-172.6	179	108.8	-9.4	109.9	W98 E99	R96-W98 HydrophobicContact CB-CD2 3.9Å; R96-W98 HydrophobicContact CB-CE3 4.18Å; R96-W98 HydrophobicContact CB-CG 4.47Å; R96-W98 HydrophobicContact CB-CH2 4.25Å; R96-W98 HydrophobicContact CB-CZ2 3.99Å; R96-W98 HydrophobicContact CB-CZ3 4.33Å; R96-W98 HydrophobicContact CG-CZ2 4.19Å; R96-W98 PolarHBondContact O-N 2.98Å; R96-E99 HydrophobicContact CB-CB 4.34Å; R96-E99 HydrophobicContact CB-CG 3.89Å; R96-E99 HydrophobicContact CG-CG 4.37Å; R96-E99 WeakPolarHBondContact CG-OE2 3.41Å; R96-E99 IonicContact CZ-OE1 3.64Å; R96-E99 PolarHBondContact N-OE2 3.37Å; R96-E99 IonicContact NE-OE1 3.93Å; R96-E99 IonicContact NH1-OE1 2.68Å; R96-E99 PolarHBondContact NH1-OE1 3.05Å; R96-E99 PolarHBondContact O-N 3.31Å
97	P	90.9	Very high	83.5	Confident	131 Å²	131	115.1 Å²	115.1	85%	0.851	55%	0.553	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.2	-20.2	-179.6	-26.9	34.8	0	0	0	115
98	W	87.9	Confident	83.7	Confident	200 Å²	200	110 Å²	110	76%	0.758	52%	0.523	S	S	*	.	T	Hydrogen-bonded Turn	trans	-106.7	3.7	178.2	60.6	85.4	0	0	0	114	R96	R96-W98 HydrophobicContact CB-CD2 3.9Å; R96-W98 HydrophobicContact CB-CE3 4.18Å; R96-W98 HydrophobicContact CB-CG 4.47Å; R96-W98 HydrophobicContact CB-CH2 4.25Å; R96-W98 HydrophobicContact CB-CZ2 3.99Å; R96-W98 HydrophobicContact CB-CZ3 4.33Å; R96-W98 HydrophobicContact CG-CZ2 4.19Å; R96-W98 PolarHBondContact O-N 2.98Å
99	E	85.8	Confident	83.9	Confident	45 Å²	45	111.1 Å²	111.1	21%	0.21	52%	0.521	C	S	.	.	S	Bend	trans	-95.6	133.1	174	-71.6	171.8	175.7	0	0	109	R93 P95 R96 S101	R93-E99 VanDerWaalsContact NH2-CD 3.29Å; R93-E99 IonicContact NH2-OE1 2.93Å; R93-E99 PolarHBondContact NH2-OE1 2.77Å; R93-E99 IonicContact NH2-OE2 2.9Å; R93-E99 PolarHBondContact NH2-OE2 2.95Å; P95-E99 HydrophobicContact CB-CB 4.38Å; R96-E99 HydrophobicContact CB-CB 4.34Å; R96-E99 HydrophobicContact CB-CG 3.89Å; R96-E99 HydrophobicContact CG-CG 4.37Å; R96-E99 WeakPolarHBondContact CG-OE2 3.41Å; R96-E99 IonicContact CZ-OE1 3.64Å; R96-E99 PolarHBondContact N-OE2 3.37Å; R96-E99 IonicContact NE-OE1 3.93Å; R96-E99 IonicContact NH1-OE1 2.68Å; R96-E99 PolarHBondContact NH1-OE1 3.05Å; R96-E99 PolarHBondContact O-N 3.31Å; E99-S101 PolarHBondContact O-N 2.99Å
100	D	86.8	Confident	84.2	Confident	91 Å²	91	103.8 Å²	103.8	49%	0.487	50%	0.499	S	S	.	.			trans	-64.4	123.5	173.2	-169.1	-32.8	0	0	0	109.3	R102 E103 Y104	D100-R102 PolarHBondContact O-N 3.36Å; D100-R102 PolarHBondContact OD1-N 3.26Å; D100-E103 HydrophobicContact CB-CB 4.45Å; D100-E103 HydrophobicContact CB-CG 4.38Å; D100-Y104 WeakPolarHBondContact O-CB 3.33Å; D100-Y104 PolarHBondContact O-N 2.98Å; D100-Y104 VanDerWaalsContact O-N 3.11Å
101	S	86.1	Confident	84.3	Confident	56 Å²	56	102 Å²	102	39%	0.392	50%	0.495	S	S	.	.	H	α-helix	trans	-62.6	-30.4	-177.3	-64.5	0	0	0	0	112.9	E99 Q105	E99-S101 PolarHBondContact O-N 2.99Å; S101-Q105 WeakPolarHBondContact O-CB 3.43Å; S101-Q105 WeakPolarHBondContact O-CG 3.36Å; S101-Q105 PolarHBondContact O-N 3.42Å; S101-Q105 PolarHBondContact O-NE2 2.79Å
102	R	84	Confident	84.2	Confident	192 Å²	192	99.5 Å²	99.5	73%	0.725	48%	0.481	S	S	*	.	H	α-helix	trans	-75.5	-54.8	-177.4	-68.2	-178.2	179	174.8	0.7	111.3	D100 Y104 Q105 E106	D100-R102 PolarHBondContact O-N 3.36Å; D100-R102 PolarHBondContact OD1-N 3.26Å; R102-Y104 PolarHBondContact O-N 2.87Å; R102-Q105 PolarHBondContact O-N 3.44Å; R102-E106 WeakPolarHBondContact O-CG 3.33Å; R102-E106 PolarHBondContact O-N 3.35Å
103	E	83.9	Confident	84	Confident	120 Å²	120	98.6 Å²	98.6	56%	0.561	48%	0.484	S	S	*	.	H	α-helix	trans	-58.9	-39.7	178.1	-64.7	-172.5	163.3	0	0	111.5	D100 E106 Q107	D100-E103 HydrophobicContact CB-CB 4.45Å; D100-E103 HydrophobicContact CB-CG 4.38Å; E103-E106 PolarHBondContact O-N 3.16Å; E103-Q107 WeakPolarHBondContact O-CG 3.29Å; E103-Q107 PolarHBondContact O-N 3.12Å
104	Y	82.9	Confident	83.5	Confident	13 Å²	13	100.5 Å²	100.5	5%	0.051	50%	0.496	C	S	.	.	H	α-helix	trans	-64.7	-43.7	178.5	-177.2	-101.1	0	0	0	112.4	R93 P95 D100 R102 Q107 Q108	R93-Y104 WeakPolarHBondContact CB-OH 3.32Å; R93-Y104 WeakPolarHBondContact CD-OH 3.25Å; R93-Y104 WeakPolarHBondContact CG-OH 3.3Å; R93-Y104 VanDerWaalsContact CZ-CE2 3.45Å; R93-Y104 PolarHBondContact NE-OH 3.08Å; R93-Y104 VanDerWaalsContact NH2-CE2 3.27Å; R93-Y104 WeakPolarHBondContact O-CE1 3.29Å; R93-Y104 PolarHBondContact O-OH 3.22Å; P95-Y104 HydrophobicContact CB-CD1 3.84Å; P95-Y104 HydrophobicContact CB-CE1 4.39Å; P95-Y104 HydrophobicContact CB-CG 4.21Å; P95-Y104 HydrophobicContact CG-CD1 4.47Å; D100-Y104 WeakPolarHBondContact O-CB 3.33Å; D100-Y104 PolarHBondContact O-N 2.98Å; D100-Y104 VanDerWaalsContact O-N 3.11Å; R102-Y104 PolarHBondContact O-N 2.87Å; Y104-Q107 PolarHBondContact O-N 3.3Å; Y104-Q108 HydrophobicContact CD1-CG 4.49Å; Y104-Q108 HydrophobicContact CE1-CG 4.09Å; Y104-Q108 WeakPolarHBondContact O-CG 3.4Å; Y104-Q108 PolarHBondContact O-N 2.89Å
105	Q	82.8	Confident	82.5	Confident	102 Å²	102	102.8 Å²	102.8	48%	0.477	50%	0.499	S	S	.	.	H	α-helix	trans	-64.7	-38.4	175.3	-75.9	173.2	46	0	0	112.4	S101 R102 Q108 R109	S101-Q105 WeakPolarHBondContact O-CB 3.43Å; S101-Q105 WeakPolarHBondContact O-CG 3.36Å; S101-Q105 PolarHBondContact O-N 3.42Å; S101-Q105 PolarHBondContact O-NE2 2.79Å; R102-Q105 PolarHBondContact O-N 3.44Å; Q105-Q108 PolarHBondContact O-N 2.92Å; Q105-R109 WeakPolarHBondContact O-CG 3.34Å; Q105-R109 PolarHBondContact O-N 3.38Å
106	E	85.4	Confident	80.9	Confident	129 Å²	129	110.9 Å²	110.9	60%	0.603	53%	0.532	S	S	*	.	H	α-helix	trans	-63.9	-41.9	175.9	-73.2	174.6	-172	0	0	111.6	R102 E103 Q108 R109 S110	R102-E106 WeakPolarHBondContact O-CG 3.33Å; R102-E106 PolarHBondContact O-N 3.35Å; E103-E106 PolarHBondContact O-N 3.16Å; E106-Q108 PolarHBondContact O-N 3.41Å; E106-R109 PolarHBondContact O-N 2.94Å; E106-S110 WeakPolarHBondContact O-CB 3.26Å; E106-S110 PolarHBondContact O-N 2.93Å; E106-S110 PolarHBondContact O-OG 3.47Å
107	Q	82.6	Confident	80.5	Confident	107 Å²	107	110.6 Å²	110.6	50%	0.5	54%	0.537	S	S	.	.	H	α-helix	trans	-60.6	-45	173.3	-73.7	175.6	29.6	0	0	111.8	E103 Y104 R109 S110 N111	E103-Q107 WeakPolarHBondContact O-CG 3.29Å; E103-Q107 PolarHBondContact O-N 3.12Å; Y104-Q107 PolarHBondContact O-N 3.3Å; Q107-R109 PolarHBondContact O-N 3.49Å; Q107-S110 PolarHBondContact O-N 2.96Å; Q107-S110 PolarHBondContact O-OG 3.44Å; Q107-N111 WeakPolarHBondContact O-CB 3.49Å; Q107-N111 VanDerWaalsContact O-CG 3.27Å; Q107-N111 PolarHBondContact O-N 3.42Å; Q107-N111 PolarHBondContact O-ND2 3.4Å
108	Q	82.9	Confident	79.9	Confident	55 Å²	55	109.5 Å²	109.5	26%	0.257	52%	0.52	S	S	.	.	H	α-helix	trans	-60	-45.9	176.3	-65.4	-54.3	-54.4	0	0	111.7	I92 Y104 Q105 E106 S110 N111 L112	I92-Q108 HydrophobicContact CG2-CG 4.17Å; Y104-Q108 HydrophobicContact CD1-CG 4.49Å; Y104-Q108 HydrophobicContact CE1-CG 4.09Å; Y104-Q108 WeakPolarHBondContact O-CG 3.4Å; Y104-Q108 PolarHBondContact O-N 2.89Å; Q105-Q108 PolarHBondContact O-N 2.92Å; E106-Q108 PolarHBondContact O-N 3.41Å; Q108-S110 PolarHBondContact O-N 3.49Å; Q108-N111 PolarHBondContact O-N 3.03Å; Q108-L112 WeakPolarHBondContact O-CB 3.27Å; Q108-L112 PolarHBondContact O-N 3.13Å
109	R	82.8	Confident	79.5	Confident	183 Å²	183	104.5 Å²	104.5	69%	0.691	51%	0.507	S	S	*	.	H	α-helix	trans	-61.5	-44.2	177.8	-73.1	174.4	-176.2	-112.1	2.3	112.1	Q105 E106 Q107 L112 S113	Q105-R109 WeakPolarHBondContact O-CG 3.34Å; Q105-R109 PolarHBondContact O-N 3.38Å; E106-R109 PolarHBondContact O-N 2.94Å; Q107-R109 PolarHBondContact O-N 3.49Å; R109-L112 WeakPolarHBondContact O-CB 3.43Å; R109-L112 PolarHBondContact O-N 3.41Å; R109-S113 PolarHBondContact O-N 3.48Å
110	S	83.9	Confident	79.1	Confident	43 Å²	43	108 Å²	108	30%	0.301	52%	0.524	S	S	.	.	H	α-helix	trans	-68	-33.7	-179.9	75	0	0	0	0	113.2	E106 Q107 Q108 S113 K114	E106-S110 WeakPolarHBondContact O-CB 3.26Å; E106-S110 PolarHBondContact O-N 2.93Å; E106-S110 PolarHBondContact O-OG 3.47Å; Q107-S110 PolarHBondContact O-N 2.96Å; Q107-S110 PolarHBondContact O-OG 3.44Å; Q108-S110 PolarHBondContact O-N 3.49Å; S110-S113 PolarHBondContact O-OG 3.47Å; S110-K114 WeakPolarHBondContact O-CD 3.4Å; S110-K114 VanDerWaalsContact O-CG 3.24Å; S110-K114 WeakPolarHBondContact O-CG 3.36Å; S110-K114 PolarHBondContact O-N 2.92Å
111	N	79.6	Confident	78.7	Confident	79 Å²	79	109.1 Å²	109.1	42%	0.422	53%	0.527	S	S	.	.	H	α-helix	trans	-72.8	-36.1	175.1	-70.5	-19.5	0	0	0	111.2	Q107 Q108 K114 T115	Q107-N111 WeakPolarHBondContact O-CB 3.49Å; Q107-N111 VanDerWaalsContact O-CG 3.27Å; Q107-N111 PolarHBondContact O-N 3.42Å; Q107-N111 PolarHBondContact O-ND2 3.4Å; Q108-N111 PolarHBondContact O-N 3.03Å; N111-K114 PolarHBondContact O-N 2.98Å; N111-T115 PolarHBondContact O-N 3.14Å; N111-T115 PolarHBondContact O-OG1 3.17Å
112	L	77.4	Confident	78.2	Confident	97 Å²	97	112.6 Å²	112.6	51%	0.508	54%	0.536	S	S	.	.	H	α-helix	trans	-63	-46.1	174	-152.4	87	0	0	0	111.2	K90 Q108 R109 K114 T115	K90-L112 HydrophobicContact CD-CD1 4.14Å; Q108-L112 WeakPolarHBondContact O-CB 3.27Å; Q108-L112 PolarHBondContact O-N 3.13Å; R109-L112 WeakPolarHBondContact O-CB 3.43Å; R109-L112 PolarHBondContact O-N 3.41Å; L112-K114 VanDerWaalsContact C-N 3.27Å; L112-K114 PolarHBondContact O-N 3.48Å; L112-T115 PolarHBondContact O-N 3.35Å
113	S	75.3	Confident	77.7	Confident	85 Å²	85	106.9 Å²	106.9	59%	0.594	52%	0.522	S	S	*	.	H	α-helix	trans	-68.3	-22.5	-179.5	68.3	0	0	0	0	114.2	R109 S110	R109-S113 PolarHBondContact O-N 3.48Å; S110-S113 PolarHBondContact O-OG 3.47Å
114	K	71.9	Confident	77.3	Confident	159 Å²	159	105.9 Å²	105.9	69%	0.691	52%	0.519	S	S	*	.	H	α-helix	trans	-82.9	-16.6	175.7	-73.4	169.5	-173.6	172.1	0	113.6	S110 N111 L112 H116	S110-K114 WeakPolarHBondContact O-CD 3.4Å; S110-K114 VanDerWaalsContact O-CG 3.24Å; S110-K114 WeakPolarHBondContact O-CG 3.36Å; S110-K114 PolarHBondContact O-N 2.92Å; N111-K114 PolarHBondContact O-N 2.98Å; L112-K114 VanDerWaalsContact C-N 3.27Å; L112-K114 PolarHBondContact O-N 3.48Å; K114-H116 VanDerWaalsContact C-N 3.29Å
115	T	64.3	Low	76.8	Confident	100 Å²	100	113.7 Å²	113.7	61%	0.613	56%	0.558	S	S	*	*			trans	-88.8	0.6	-176.4	-53.4	0	0	0	0	111.9	N111 L112	N111-T115 PolarHBondContact O-N 3.14Å; N111-T115 PolarHBondContact O-OG1 3.17Å; L112-T115 PolarHBondContact O-N 3.35Å
116	H	52.8	Low	76.2	Confident	225 Å²	225	114.7 Å²	114.7	100%	1.042	57%	0.566	S	S	*	*			trans	-121.9	0	-174	-151	-51.2	0	0	0	112	K114	K114-H116 VanDerWaalsContact C-N 3.29Å

Retrieved 116 of 116 residues in 166.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).