A0A087YHI9_POEFO Loading...

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

AlphaFold DB , UniProt , Accession A0A087YHI9, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 70 aa.

						>A0A087YHI9_POEFO|A0A087YHI9
MWYEILPAFGLMTACMIIPGILTTHIHKFTNGGKEKRIARNPWQWYLMERDKRVSGTNQYFNSKGLENIK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	76.1	Confident	91.2	Very high	195 Å²	195	115.5 Å²	115.5	96%	0.961	59%	0.59	S	S	*	*				0	-6	0	-62.6	-163	76.5	0	0	116.3	E4	M1-E4 WeakPolarHBondContact CA-OE1 3.45Å; M1-E4 PolarHBondContact N-OE1 3.46Å
2	W	83.8	Confident	91.7	Very high	161 Å²	161	114.1 Å²	114.1	61%	0.61	58%	0.581	S	S	*	*			trans	-127.7	-32.5	152.5	71.3	-95.8	0	0	0	111.7	E4 I5 L6	W2-E4 PolarHBondContact O-N 3.33Å; W2-E4 VanDerWaalsContact O-N 3.08Å; W2-I5 VanDerWaalsContact O-CG2 3.31Å; W2-I5 WeakPolarHBondContact O-CG2 3.39Å; W2-I5 PolarHBondContact O-N 3.42Å; W2-L6 HydrophobicContact CZ3-CD1 4.47Å
3	Y	89.3	Confident	92	Very high	140 Å²	140	109.1 Å²	109.1	55%	0.549	56%	0.559	S	S	.	*	T	Hydrogen-bonded Turn	trans	-60.2	-15.7	173.3	-39	-84.2	0	0	0	114.5	I5 L6 P7	Y3-I5 PolarHBondContact O-N 3.39Å; Y3-L6 HydrophobicContact CD1-CD1 4.23Å; Y3-L6 VanDerWaalsContact O-CB 3.23Å; Y3-L6 WeakPolarHBondContact O-CB 3.35Å; Y3-L6 WeakPolarHBondContact O-CG 3.49Å; Y3-L6 PolarHBondContact O-N 2.74Å; Y3-P7 WeakPolarHBondContact O-CD 2.78Å
4	E	91.9	Very high	92.4	Very high	140 Å²	140	104.4 Å²	104.4	65%	0.654	55%	0.546	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.3	-16.3	179.6	-75.2	161.8	-135.1	0	0	112.9	M1 W2 P7	M1-E4 WeakPolarHBondContact CA-OE1 3.45Å; M1-E4 PolarHBondContact N-OE1 3.46Å; W2-E4 PolarHBondContact O-N 3.33Å; W2-E4 VanDerWaalsContact O-N 3.08Å; E4-P7 WeakPolarHBondContact O-CD 3.29Å
5	I	93.1	Very high	92.6	Very high	114 Å²	114	102.4 Å²	102.4	59%	0.585	54%	0.542	S	S	*	.	H	α-helix	trans	-79.3	-21.7	171	-158.9	162.9	0	0	0	112.8	W2 Y3 A8 F9	W2-I5 VanDerWaalsContact O-CG2 3.31Å; W2-I5 WeakPolarHBondContact O-CG2 3.39Å; W2-I5 PolarHBondContact O-N 3.42Å; Y3-I5 PolarHBondContact O-N 3.39Å; I5-A8 PolarHBondContact O-N 3Å; I5-F9 VanDerWaalsContact O-CB 3.3Å; I5-F9 WeakPolarHBondContact O-CB 3.49Å; I5-F9 PolarHBondContact O-N 3.29Å
6	L	93.9	Very high	92.9	Very high	85 Å²	85	104.9 Å²	104.9	45%	0.445	55%	0.553	S	S	.	*	H	α-helix	trans	-62.5	-38.5	-174.8	-59.8	174.6	0	0	0	113.1	W2 Y3 G10	W2-L6 HydrophobicContact CZ3-CD1 4.47Å; Y3-L6 HydrophobicContact CD1-CD1 4.23Å; Y3-L6 VanDerWaalsContact O-CB 3.23Å; Y3-L6 WeakPolarHBondContact O-CB 3.35Å; Y3-L6 WeakPolarHBondContact O-CG 3.49Å; Y3-L6 PolarHBondContact O-N 2.74Å; L6-G10 WeakPolarHBondContact O-CA 3.49Å; L6-G10 PolarHBondContact O-N 3.13Å
7	P	93.6	Very high	93.2	Very high	93 Å²	93	104 Å²	104	60%	0.604	55%	0.547	S	S	*	.	H	α-helix	trans	-62.4	-45.9	173.9	-24.3	34.6	0	0	0	113.1	Y3 E4 G10 L11	Y3-P7 WeakPolarHBondContact O-CD 2.78Å; E4-P7 WeakPolarHBondContact O-CD 3.29Å; P7-G10 PolarHBondContact O-N 3.27Å; P7-L11 WeakPolarHBondContact O-CB 3.44Å; P7-L11 PolarHBondContact O-N 3.38Å
8	A	93.7	Very high	93.4	Very high	67 Å²	67	103.2 Å²	103.2	55%	0.554	54%	0.542	S	S	*	.	H	α-helix	trans	-66.7	-42.4	179.1	0	0	0	0	0	111.5	I5 L11 M12	I5-A8 PolarHBondContact O-N 3Å; A8-L11 PolarHBondContact O-N 2.91Å; A8-M12 WeakPolarHBondContact O-CB 3.32Å; A8-M12 PolarHBondContact O-N 2.93Å
9	F	95.4	Very high	93.6	Very high	116 Å²	116	101.4 Å²	101.4	51%	0.509	54%	0.537	S	S	.	.	H	α-helix	trans	-64.6	-40.7	175.1	-177.4	-101.9	0	0	0	112.1	I5 M12 T13	I5-F9 VanDerWaalsContact O-CB 3.3Å; I5-F9 WeakPolarHBondContact O-CB 3.49Å; I5-F9 PolarHBondContact O-N 3.29Å; F9-M12 HydrophobicContact CD2-CE 3.67Å; F9-M12 HydrophobicContact CE2-CE 3.83Å; F9-M12 PolarHBondContact O-N 3.42Å; F9-T13 VanDerWaalsContact O-CB 3.3Å; F9-T13 WeakPolarHBondContact O-CB 3.15Å; F9-T13 PolarHBondContact O-N 3.32Å; F9-T13 PolarHBondContact O-OG1 3.4Å
10	G	96	Very high	93.6	Very high	36 Å²	36	98.3 Å²	98.3	37%	0.371	53%	0.53	S	S	.	.	H	α-helix	trans	-63.4	-43.1	176.3	0	0	0	0	0	112.1	L6 P7 T13 A14	L6-G10 WeakPolarHBondContact O-CA 3.49Å; L6-G10 PolarHBondContact O-N 3.13Å; P7-G10 PolarHBondContact O-N 3.27Å; G10-T13 PolarHBondContact O-N 2.97Å; G10-A14 WeakPolarHBondContact O-CB 3.38Å; G10-A14 PolarHBondContact O-N 3.08Å
11	L	96.6	Very high	93.8	Very high	124 Å²	124	97.7 Å²	97.7	65%	0.649	53%	0.526	S	S	*	.	H	α-helix	trans	-63.9	-47.6	175.9	-169.1	120.3	0	0	0	111.5	P7 A8 T13 A14 C15	P7-L11 WeakPolarHBondContact O-CB 3.44Å; P7-L11 PolarHBondContact O-N 3.38Å; A8-L11 PolarHBondContact O-N 2.91Å; L11-T13 VanDerWaalsContact C-N 3.32Å; L11-T13 PolarHBondContact O-N 2.91Å; L11-A14 PolarHBondContact O-N 3.33Å; L11-C15 WeakPolarHBondContact O-CB 3.1Å; L11-C15 PolarHBondContact O-N 3.47Å; L11-C15 PolarHBondContact O-SG 3.38Å
12	M	96.8	Very high	94.7	Very high	98 Å²	98	92.8 Å²	92.8	48%	0.483	50%	0.503	S	S	.	.	H	α-helix	trans	-57.8	-46.2	175.8	-177.7	-177.2	72.3	0	0	111.5	A8 F9 C15 M16	A8-M12 WeakPolarHBondContact O-CB 3.32Å; A8-M12 PolarHBondContact O-N 2.93Å; F9-M12 HydrophobicContact CD2-CE 3.67Å; F9-M12 HydrophobicContact CE2-CE 3.83Å; F9-M12 PolarHBondContact O-N 3.42Å; M12-C15 PolarHBondContact O-N 3.06Å; M12-M16 WeakPolarHBondContact O-CG 3.41Å; M12-M16 PolarHBondContact O-N 2.97Å
13	T	96.1	Very high	95.3	Very high	49 Å²	49	88.3 Å²	88.3	30%	0.301	49%	0.494	S	S	.	.	H	α-helix	trans	-62.7	-45.2	179.1	-59.2	0	0	0	0	111.1	F9 G10 L11 C15 M16 I17	F9-T13 VanDerWaalsContact O-CB 3.3Å; F9-T13 WeakPolarHBondContact O-CB 3.15Å; F9-T13 PolarHBondContact O-N 3.32Å; F9-T13 PolarHBondContact O-OG1 3.4Å; G10-T13 PolarHBondContact O-N 2.97Å; L11-T13 VanDerWaalsContact C-N 3.32Å; L11-T13 PolarHBondContact O-N 2.91Å; T13-C15 PolarHBondContact O-N 3.26Å; T13-M16 PolarHBondContact O-N 3.1Å; T13-I17 HydrophobicContact CG2-CD1 3.66Å; T13-I17 HydrophobicContact CG2-CG1 4.37Å; T13-I17 VanDerWaalsContact O-CG1 3.27Å; T13-I17 WeakPolarHBondContact O-CG1 3.39Å; T13-I17 PolarHBondContact O-N 2.91Å
14	A	97.1	Very high	95.6	Very high	44 Å²	44	84.4 Å²	84.4	36%	0.364	49%	0.485	S	S	.	.	H	α-helix	trans	-60	-47.9	175.9	0	0	0	0	0	111.3	G10 L11 M16 I17 I18	G10-A14 WeakPolarHBondContact O-CB 3.38Å; G10-A14 PolarHBondContact O-N 3.08Å; L11-A14 PolarHBondContact O-N 3.33Å; A14-M16 PolarHBondContact O-N 3.08Å; A14-I17 PolarHBondContact O-N 3.44Å; A14-I17 VanDerWaalsContact O-N 3.15Å; A14-I18 WeakPolarHBondContact O-CB 3.5Å; A14-I18 WeakPolarHBondContact O-CD1 3.46Å; A14-I18 WeakPolarHBondContact O-CG1 3.36Å; A14-I18 PolarHBondContact O-N 3.19Å
15	C	96.3	Very high	95.7	Very high	74 Å²	74	83.5 Å²	83.5	50%	0.5	48%	0.48	S	S	.	.	H	α-helix	trans	-59.9	-32.1	177.1	-70.6	0	0	0	0	113.1	L11 M12 T13 P19	L11-C15 WeakPolarHBondContact O-CB 3.1Å; L11-C15 PolarHBondContact O-N 3.47Å; L11-C15 PolarHBondContact O-SG 3.38Å; M12-C15 PolarHBondContact O-N 3.06Å; T13-C15 PolarHBondContact O-N 3.26Å; C15-P19 WeakPolarHBondContact O-CD 3.49Å
16	M	96.7	Very high	95.9	Very high	143 Å²	143	82.3 Å²	82.3	70%	0.704	47%	0.474	S	S	*	.	H	α-helix	trans	-78.5	-33.1	175.2	-73.6	-166	70	0	0	113.7	M12 T13 A14	M12-M16 WeakPolarHBondContact O-CG 3.41Å; M12-M16 PolarHBondContact O-N 2.97Å; T13-M16 PolarHBondContact O-N 3.1Å; A14-M16 PolarHBondContact O-N 3.08Å
17	I	97.5	Very high	96	Very high	89 Å²	89	81.1 Å²	81.1	46%	0.456	47%	0.466	S	S	.	.	H	α-helix	trans	-74	-39.5	179.7	-70.9	170.2	0	0	0	111.2	T13 A14 G20 I21	T13-I17 HydrophobicContact CG2-CD1 3.66Å; T13-I17 HydrophobicContact CG2-CG1 4.37Å; T13-I17 VanDerWaalsContact O-CG1 3.27Å; T13-I17 WeakPolarHBondContact O-CG1 3.39Å; T13-I17 PolarHBondContact O-N 2.91Å; A14-I17 PolarHBondContact O-N 3.44Å; A14-I17 VanDerWaalsContact O-N 3.15Å; I17-G20 PolarHBondContact O-N 3.09Å; I17-I21 HydrophobicContact CG2-CD1 3.42Å; I17-I21 VanDerWaalsContact CG2-CD1 3.42Å; I17-I21 HydrophobicContact CG2-CG1 3.9Å; I17-I21 PolarHBondContact O-N 3.19Å; I17-I21 VanDerWaalsContact O-N 3.1Å
18	I	97.5	Very high	96	Very high	89 Å²	89	81 Å²	81	46%	0.456	46%	0.456	S	S	.	.	H	α-helix	trans	-52.3	-49.3	-174.1	-76.8	162.7	0	0	0	112.8	A14 G20 I21 L22	A14-I18 WeakPolarHBondContact O-CB 3.5Å; A14-I18 WeakPolarHBondContact O-CD1 3.46Å; A14-I18 WeakPolarHBondContact O-CG1 3.36Å; A14-I18 PolarHBondContact O-N 3.19Å; I18-G20 VanDerWaalsContact C-N 3.32Å; I18-G20 PolarHBondContact O-N 3.16Å; I18-I21 PolarHBondContact O-N 3.39Å; I18-L22 HydrophobicContact CG2-CD1 3.42Å; I18-L22 VanDerWaalsContact CG2-CD1 3.42Å; I18-L22 HydrophobicContact CG2-CG 4.4Å; I18-L22 WeakPolarHBondContact O-CB 3.39Å; I18-L22 PolarHBondContact O-N 3.48Å
19	P	96.5	Very high	96	Very high	70 Å²	70	86.4 Å²	86.4	46%	0.455	47%	0.467	S	S	.	.	H	α-helix	trans	-59.6	-38.3	177.6	-26	34	0	0	0	113.8	C15 T23	C15-P19 WeakPolarHBondContact O-CD 3.49Å; P19-T23 WeakPolarHBondContact O-CB 3.49Å; P19-T23 VanDerWaalsContact O-CG2 3.25Å; P19-T23 WeakPolarHBondContact O-CG2 3.45Å; P19-T23 PolarHBondContact O-N 2.93Å; P19-T23 PolarHBondContact O-OG1 2.98Å
20	G	95.1	Very high	95.8	Very high	38 Å²	38	84.2 Å²	84.2	39%	0.392	46%	0.464	S	S	.	.	H	α-helix	trans	-63.8	-49.4	177.3	0	0	0	0	0	111.4	I17 I18 T23 T24	I17-G20 PolarHBondContact O-N 3.09Å; I18-G20 VanDerWaalsContact C-N 3.32Å; I18-G20 PolarHBondContact O-N 3.16Å; G20-T23 PolarHBondContact O-N 3.3Å; G20-T23 PolarHBondContact O-OG1 3.02Å; G20-T24 WeakPolarHBondContact O-CG2 3.42Å; G20-T24 PolarHBondContact O-N 2.64Å; G20-T24 VanDerWaalsContact O-N 3.15Å
21	I	96.1	Very high	95.7	Very high	87 Å²	87	82.7 Å²	82.7	45%	0.446	45%	0.447	S	S	.	.	H	α-helix	trans	-61.4	-50	177.8	-65.2	-179.9	0	0	0	110.3	I17 I18 T23 T24 H25	I17-I21 HydrophobicContact CG2-CD1 3.42Å; I17-I21 VanDerWaalsContact CG2-CD1 3.42Å; I17-I21 HydrophobicContact CG2-CG1 3.9Å; I17-I21 PolarHBondContact O-N 3.19Å; I17-I21 VanDerWaalsContact O-N 3.1Å; I18-I21 PolarHBondContact O-N 3.39Å; I21-T23 PolarHBondContact O-N 2.93Å; I21-T24 PolarHBondContact O-N 2.79Å; I21-T24 PolarHBondContact O-OG1 2.77Å; I21-H25 PolarHBondContact O-CD2 3.42Å; I21-H25 PolarHBondContact O-N 2.56Å; I21-H25 VanDerWaalsContact O-N 3.09Å
22	L	96.4	Very high	95.5	Very high	91 Å²	91	79.1 Å²	79.1	48%	0.476	44%	0.44	S	S	.	.	H	α-helix	trans	-55.3	-49.2	178.6	-86.6	159.2	0	0	0	112.1	I18 T24 H25 I26	I18-L22 HydrophobicContact CG2-CD1 3.42Å; I18-L22 VanDerWaalsContact CG2-CD1 3.42Å; I18-L22 HydrophobicContact CG2-CG 4.4Å; I18-L22 WeakPolarHBondContact O-CB 3.39Å; I18-L22 PolarHBondContact O-N 3.48Å; L22-T24 VanDerWaalsContact C-N 3.33Å; L22-T24 PolarHBondContact O-N 3.28Å; L22-H25 PolarHBondContact O-N 2.93Å; L22-I26 HydrophobicContact CB-CD1 4.48Å; L22-I26 WeakPolarHBondContact O-CB 3.36Å; L22-I26 WeakPolarHBondContact O-CD1 3.37Å; L22-I26 WeakPolarHBondContact O-CG1 3.44Å; L22-I26 PolarHBondContact O-N 3.08Å
23	T	95.7	Very high	95.3	Very high	67 Å²	67	77.2 Å²	77.2	41%	0.411	45%	0.446	S	S	.	.	H	α-helix	trans	-62.8	-38.7	-178.6	50.4	0	0	0	0	112.3	P19 G20 I21 I26 H27	P19-T23 WeakPolarHBondContact O-CB 3.49Å; P19-T23 VanDerWaalsContact O-CG2 3.25Å; P19-T23 WeakPolarHBondContact O-CG2 3.45Å; P19-T23 PolarHBondContact O-N 2.93Å; P19-T23 PolarHBondContact O-OG1 2.98Å; G20-T23 PolarHBondContact O-N 3.3Å; G20-T23 PolarHBondContact O-OG1 3.02Å; I21-T23 PolarHBondContact O-N 2.93Å; T23-I26 PolarHBondContact O-N 3.47Å; T23-H27 WeakPolarHBondContact O-CB 3.35Å; T23-H27 PolarHBondContact O-N 3.06Å
24	T	95.1	Very high	95.1	Very high	59 Å²	59	79.1 Å²	79.1	36%	0.362	45%	0.45	S	S	.	.	H	α-helix	trans	-64.2	-41.7	174.9	64.1	0	0	0	0	112.6	G20 I21 L22 H27 K28	G20-T24 WeakPolarHBondContact O-CG2 3.42Å; G20-T24 PolarHBondContact O-N 2.64Å; G20-T24 VanDerWaalsContact O-N 3.15Å; I21-T24 PolarHBondContact O-N 2.79Å; I21-T24 PolarHBondContact O-OG1 2.77Å; L22-T24 VanDerWaalsContact C-N 3.33Å; L22-T24 PolarHBondContact O-N 3.28Å; T24-H27 PolarHBondContact O-N 3.18Å; T24-K28 WeakPolarHBondContact O-CG 3.32Å; T24-K28 PolarHBondContact O-N 3.31Å
25	H	95.3	Very high	94.9	Very high	120 Å²	120	82.5 Å²	82.5	56%	0.556	46%	0.458	S	S	*	.	H	α-helix	trans	-67.6	-41.9	176.5	-76.9	-69.9	0	0	0	112.1	I21 L22 H27 K28 F29	I21-H25 PolarHBondContact O-CD2 3.42Å; I21-H25 PolarHBondContact O-N 2.56Å; I21-H25 VanDerWaalsContact O-N 3.09Å; L22-H25 PolarHBondContact O-N 2.93Å; H25-H27 VanDerWaalsContact C-N 3.34Å; H25-H27 PolarHBondContact O-N 2.97Å; H25-K28 PolarHBondContact O-N 3.44Å; H25-F29 WeakPolarHBondContact O-CB 3.5Å; H25-F29 PolarHBondContact O-N 3.34Å
26	I	95.8	Very high	94.8	Very high	89 Å²	89	84.1 Å²	84.1	46%	0.456	46%	0.457	S	S	.	.	H	α-helix	trans	-62.3	-43	176.2	-69.1	165.3	0	0	0	110.5	L22 T23 F29 T30	L22-I26 HydrophobicContact CB-CD1 4.48Å; L22-I26 WeakPolarHBondContact O-CB 3.36Å; L22-I26 WeakPolarHBondContact O-CD1 3.37Å; L22-I26 WeakPolarHBondContact O-CG1 3.44Å; L22-I26 PolarHBondContact O-N 3.08Å; T23-I26 PolarHBondContact O-N 3.47Å; I26-F29 PolarHBondContact O-N 2.71Å; I26-T30 HydrophobicContact CG2-CG2 4.32Å; I26-T30 WeakPolarHBondContact O-CB 3.25Å; I26-T30 WeakPolarHBondContact O-CG2 3.35Å; I26-T30 PolarHBondContact O-N 2.77Å; I26-T30 PolarHBondContact O-OG1 3.45Å
27	H	95.9	Very high	94.6	Very high	60 Å²	60	81.4 Å²	81.4	28%	0.278	44%	0.438	S	S	.	.	H	α-helix	trans	-61.4	-45.9	176.3	-75.3	178.6	0	0	0	111.6	T23 T24 H25 F29 T30 N31 K36	T23-H27 WeakPolarHBondContact O-CB 3.35Å; T23-H27 PolarHBondContact O-N 3.06Å; T24-H27 PolarHBondContact O-N 3.18Å; H25-H27 VanDerWaalsContact C-N 3.34Å; H25-H27 PolarHBondContact O-N 2.97Å; H27-F29 PolarHBondContact O-N 3.31Å; H27-T30 PolarHBondContact O-N 3.12Å; H27-T30 PolarHBondContact O-OG1 3.39Å; H27-N31 WeakPolarHBondContact O-CB 3.4Å; H27-N31 PolarHBondContact O-N 3.33Å; H27-N31 VanDerWaalsContact O-N 3.08Å; H27-N31 PolarHBondContact O-ND2 2.87Å; H27-K36 HydrophobicContact CB-CB 4.17Å
28	K	93.7	Very high	94.5	Very high	90 Å²	90	82.5 Å²	82.5	39%	0.391	44%	0.444	S	S	.	.	H	α-helix	trans	-62.5	-42.6	176.2	-72.7	174.9	177.4	177.4	0	112.1	T24 H25 G33 K34 E35	T24-K28 WeakPolarHBondContact O-CG 3.32Å; T24-K28 PolarHBondContact O-N 3.31Å; H25-K28 PolarHBondContact O-N 3.44Å; K28-G33 VanDerWaalsContact O-CA 3.26Å; K28-G33 WeakPolarHBondContact O-CA 3.03Å; K28-G33 PolarHBondContact O-N 3.37Å; K28-K34 WeakPolarHBondContact CA-O 3.32Å; K28-E35 WeakPolarHBondContact CE-OE1 3.42Å; K28-E35 IonicContact NZ-OE1 3.9Å
29	F	93.7	Very high	94.4	Very high	182 Å²	182	80 Å²	80	80%	0.798	44%	0.437	S	S	*	.	H	α-helix	trans	-63.3	-45	179	-176.6	-104.1	0	0	0	112.3	H25 I26 H27	H25-F29 WeakPolarHBondContact O-CB 3.5Å; H25-F29 PolarHBondContact O-N 3.34Å; I26-F29 PolarHBondContact O-N 2.71Å; H27-F29 PolarHBondContact O-N 3.31Å
30	T	93.1	Very high	94.3	Very high	70 Å²	70	86.4 Å²	86.4	43%	0.429	45%	0.452	S	S	.	.	H	α-helix	trans	-78.6	-17.5	-176.2	53.6	0	0	0	0	114.4	I26 H27 F61	I26-T30 HydrophobicContact CG2-CG2 4.32Å; I26-T30 WeakPolarHBondContact O-CB 3.25Å; I26-T30 WeakPolarHBondContact O-CG2 3.35Å; I26-T30 PolarHBondContact O-N 2.77Å; I26-T30 PolarHBondContact O-OG1 3.45Å; H27-T30 PolarHBondContact O-N 3.12Å; H27-T30 PolarHBondContact O-OG1 3.39Å; T30-F61 WeakPolarHBondContact O-CE1 3.17Å
31	N	93.9	Very high	94.4	Very high	3 Å²	3	89.2 Å²	89.2	2%	0.016	46%	0.458	C	S	.	.	T	Hydrogen-bonded Turn	trans	-113.9	26.3	-176.2	-63.6	-76.2	0	0	0	113.7	H27 K34 K36 Y60 F61	H27-N31 WeakPolarHBondContact O-CB 3.4Å; H27-N31 PolarHBondContact O-N 3.33Å; H27-N31 VanDerWaalsContact O-N 3.08Å; H27-N31 PolarHBondContact O-ND2 2.87Å; N31-K34 WeakPolarHBondContact CB-O 3.5Å; N31-K34 PolarHBondContact O-N 3.43Å; N31-K36 WeakPolarHBondContact ND2-CB 3.21Å; N31-Y60 WeakPolarHBondContact OD1-CE2 3.3Å; N31-Y60 VanDerWaalsContact OD1-CZ 3.27Å; N31-Y60 PolarHBondContact OD1-OH 3.43Å; N31-F61 HydrophobicContact CB-CB 4.36Å; N31-F61 WeakPolarHBondContact O-CB 3.36Å
32	G	91.2	Very high	94.4	Very high	50 Å²	50	90.5 Å²	90.5	52%	0.515	47%	0.472	S	S	.	.	T	Hydrogen-bonded Turn	trans	67.1	41.1	175.7	0	0	0	0	0	113.5	K34	G32-K34 VanDerWaalsContact C-N 3.28Å; G32-K34 PolarHBondContact O-N 3.43Å
33	G	92.1	Very high	94.4	Very high	58 Å²	58	94.1 Å²	94.1	60%	0.598	48%	0.48	S	S	*	.	T	Hydrogen-bonded Turn	trans	82.4	-0.5	179.6	0	0	0	0	0	114.8	K28	K28-G33 VanDerWaalsContact O-CA 3.26Å; K28-G33 WeakPolarHBondContact O-CA 3.03Å; K28-G33 PolarHBondContact O-N 3.37Å
34	K	92.1	Very high	94.4	Very high	88 Å²	88	94.1 Å²	94.1	38%	0.383	48%	0.475	S	S	.	.	S	Bend	trans	-105.5	166.7	-177.2	-66.4	179.5	-72.4	-166.1	0	111.9	K28 N31 G32 F61 S63	K28-K34 WeakPolarHBondContact CA-O 3.32Å; N31-K34 WeakPolarHBondContact CB-O 3.5Å; N31-K34 PolarHBondContact O-N 3.43Å; G32-K34 VanDerWaalsContact C-N 3.28Å; G32-K34 PolarHBondContact O-N 3.43Å; K34-F61 VanDerWaalsContact CE-O 3.32Å; K34-F61 WeakPolarHBondContact CE-O 3.31Å; K34-F61 PolarHBondContact NZ-O 3.26Å; K34-S63 PolarHBondContact NZ-OG 2.78Å
35	E	92.8	Very high	94.5	Very high	115 Å²	115	97.9 Å²	97.9	54%	0.537	48%	0.483	S	S	.	.	P	Polyproline II helix	trans	-65.1	148.4	171	-65.7	-57	146.2	0	0	111.5	K28 R37	K28-E35 WeakPolarHBondContact CE-OE1 3.42Å; K28-E35 IonicContact NZ-OE1 3.9Å; E35-R37 PolarHBondContact O-N 3.38Å
36	K	94.4	Very high	94.5	Very high	109 Å²	109	97.5 Å²	97.5	47%	0.474	48%	0.477	S	S	.	.	P	Polyproline II helix	trans	-64.9	126.4	174.5	-177.7	179	176.9	179.9	0	109.4	H27 N31 I38	H27-K36 HydrophobicContact CB-CB 4.17Å; N31-K36 WeakPolarHBondContact ND2-CB 3.21Å; K36-I38 PolarHBondContact O-N 3.46Å
37	R	93.3	Very high	94.5	Very high	85 Å²	85	95.7 Å²	95.7	32%	0.321	47%	0.468	S	S	.	.	P	Polyproline II helix	trans	-70.1	126.5	176.9	-177.6	175.6	-171.2	153.7	-1.6	110.5	E35 L47 M48 D51 Y60	E35-R37 PolarHBondContact O-N 3.38Å; R37-L47 VanDerWaalsContact NH2-CB 3.33Å; R37-M48 HydrophobicContact CB-CE 3.68Å; R37-M48 HydrophobicContact CG-CE 3.52Å; R37-M48 WeakPolarHBondContact O-CE 3.4Å; R37-D51 IonicContact CZ-OD2 3.62Å; R37-D51 IonicContact NH1-OD2 2.64Å; R37-D51 PolarHBondContact NH1-OD2 2.93Å; R37-D51 IonicContact NH2-OD2 3.8Å; R37-Y60 HydrophobicContact CB-CE2 4.47Å
38	I	94.8	Very high	94.5	Very high	112 Å²	112	93.7 Å²	93.7	57%	0.574	46%	0.459	S	S	*	.	P	Polyproline II helix	trans	-101.3	116.4	-179.9	-52.6	174.6	0	0	0	108.3	K36 R40 Q44	K36-I38 PolarHBondContact O-N 3.46Å; I38-R40 HydrophobicContact CG2-CG 3.78Å; I38-Q44 PolarHBondContact O-OE1 3.48Å
39	A	94.7	Very high	94.6	Very high	38 Å²	38	93.3 Å²	93.3	31%	0.314	46%	0.459	S	S	.	.			trans	-101.3	91	174.8	0	0	0	0	0	109.6	Q44 W45 M48	A39-Q44 HydrophobicContact CB-CB 4Å; A39-W45 HydrophobicContact CB-CB 4.22Å; A39-W45 HydrophobicContact CB-CE3 4.01Å; A39-M48 HydrophobicContact CB-CE 4.28Å
40	R	95.5	Very high	94.6	Very high	204 Å²	204	90.4 Å²	90.4	77%	0.77	44%	0.443	S	S	*	.			trans	-81.9	-30.9	174.4	-61.3	-176.2	177.8	155.4	-1	111.9	I38	I38-R40 HydrophobicContact CG2-CG 3.78Å
41	N	96.5	Very high	94.7	Very high	97 Å²	97	89.2 Å²	89.2	52%	0.519	43%	0.434	S	S	.	.	S	Bend	trans	-111.7	149.3	-177.7	-61.7	-9.4	0	0	0	110.8	W43 Q44 W45	N41-W43 PolarHBondContact O-N 3.48Å; N41-W43 VanDerWaalsContact O-N 3.16Å; N41-Q44 HydrophobicContact CB-CG 4.34Å; N41-Q44 VanDerWaalsContact N-OE1 3.11Å; N41-Q44 WeakPolarHBondContact O-CB 3.26Å; N41-Q44 PolarHBondContact O-N 2.85Å; N41-W45 PolarHBondContact O-N 2.87Å
42	P	96.3	Very high	94.7	Very high	114 Å²	114	93.1 Å²	93.1	74%	0.74	45%	0.45	S	S	*	.	H	α-helix	trans	-55.9	-35.2	177.9	-26.7	34.7	0	0	0	113.4	Q44 W45 Y46	P42-Q44 VanDerWaalsContact C-N 3.31Å; P42-Q44 PolarHBondContact O-N 3.31Å; P42-W45 WeakPolarHBondContact O-CB 3.45Å; P42-W45 PolarHBondContact O-N 3.22Å; P42-Y46 PolarHBondContact O-N 3.09Å
43	W	96.1	Very high	94.8	Very high	167 Å²	167	98.3 Å²	98.3	63%	0.633	45%	0.454	S	S	*	.	H	α-helix	trans	-61	-38.6	175.2	-178.7	-113.2	0	0	0	113	N41 W45 Y46 L47	N41-W43 PolarHBondContact O-N 3.48Å; N41-W43 VanDerWaalsContact O-N 3.16Å; W43-W45 VanDerWaalsContact C-N 3.3Å; W43-W45 PolarHBondContact O-N 3.04Å; W43-Y46 HydrophobicContact CE3-CD1 4.06Å; W43-Y46 HydrophobicContact CH2-CD1 4.3Å; W43-Y46 HydrophobicContact CH2-CE1 4.43Å; W43-Y46 AromaticContact CZ3-CD1 3.74Å; W43-Y46 HydrophobicContact CZ3-CD1 3.74Å; W43-Y46 HydrophobicContact CZ3-CE1 4.09Å; W43-Y46 PolarHBondContact O-N 3.31Å; W43-L47 HydrophobicContact CZ2-CD1 4.43Å; W43-L47 HydrophobicContact CZ2-CD2 4.1Å; W43-L47 HydrophobicContact CZ2-CG 4.33Å; W43-L47 WeakPolarHBondContact O-CG 3.46Å; W43-L47 PolarHBondContact O-N 3.06Å
44	Q	96.6	Very high	94.9	Very high	66 Å²	66	98.7 Å²	98.7	31%	0.308	45%	0.445	S	S	.	.	H	α-helix	trans	-68.3	-33.9	178	-66.3	172.5	-29	0	0	111.5	I38 A39 N41 P42 M48	I38-Q44 PolarHBondContact O-OE1 3.48Å; A39-Q44 HydrophobicContact CB-CB 4Å; N41-Q44 HydrophobicContact CB-CG 4.34Å; N41-Q44 VanDerWaalsContact N-OE1 3.11Å; N41-Q44 WeakPolarHBondContact O-CB 3.26Å; N41-Q44 PolarHBondContact O-N 2.85Å; P42-Q44 VanDerWaalsContact C-N 3.31Å; P42-Q44 PolarHBondContact O-N 3.31Å; Q44-M48 WeakPolarHBondContact O-CB 3.41Å; Q44-M48 PolarHBondContact O-N 2.78Å
45	W	96.1	Very high	94.8	Very high	138 Å²	138	94.6 Å²	94.6	52%	0.523	43%	0.427	S	S	.	.	H	α-helix	trans	-66.8	-48.4	173.1	-174.1	-96.8	0	0	0	111.3	A39 N41 P42 W43 L47 M48 E49	A39-W45 HydrophobicContact CB-CB 4.22Å; A39-W45 HydrophobicContact CB-CE3 4.01Å; N41-W45 PolarHBondContact O-N 2.87Å; P42-W45 WeakPolarHBondContact O-CB 3.45Å; P42-W45 PolarHBondContact O-N 3.22Å; W43-W45 VanDerWaalsContact C-N 3.3Å; W43-W45 PolarHBondContact O-N 3.04Å; W45-L47 VanDerWaalsContact C-N 3.28Å; W45-L47 PolarHBondContact O-N 3.42Å; W45-M48 HydrophobicContact CE3-SD 4.27Å; W45-M48 HydrophobicContact CZ3-SD 4.09Å; W45-M48 WeakPolarHBondContact O-CA 3.43Å; W45-M48 WeakPolarHBondContact O-CB 3Å; W45-M48 PolarHBondContact O-N 3.28Å; W45-E49 PolarHBondContact NE1-OE1 3.39Å; W45-E49 PolarHBondContact O-N 2.97Å
46	Y	96.7	Very high	94.6	Very high	113 Å²	113	92.5 Å²	92.5	44%	0.443	44%	0.436	S	S	.	.	H	α-helix	trans	-55.6	-43	176.4	178.2	-103.9	0	0	0	112.3	P42 W43 E49 R50	P42-Y46 PolarHBondContact O-N 3.09Å; W43-Y46 HydrophobicContact CE3-CD1 4.06Å; W43-Y46 HydrophobicContact CH2-CD1 4.3Å; W43-Y46 HydrophobicContact CH2-CE1 4.43Å; W43-Y46 AromaticContact CZ3-CD1 3.74Å; W43-Y46 HydrophobicContact CZ3-CD1 3.74Å; W43-Y46 HydrophobicContact CZ3-CE1 4.09Å; W43-Y46 PolarHBondContact O-N 3.31Å; Y46-E49 PolarHBondContact O-N 3.1Å; Y46-R50 PolarHBondContact O-N 3.35Å
47	L	95.9	Very high	94.3	Very high	50 Å²	50	90.6 Å²	90.6	26%	0.262	43%	0.434	S	S	.	.	H	α-helix	trans	-66.4	-37.7	174.9	-70	176.1	0	0	0	112.8	R37 W43 W45 R50 D51	R37-L47 VanDerWaalsContact NH2-CB 3.33Å; W43-L47 HydrophobicContact CZ2-CD1 4.43Å; W43-L47 HydrophobicContact CZ2-CD2 4.1Å; W43-L47 HydrophobicContact CZ2-CG 4.33Å; W43-L47 WeakPolarHBondContact O-CG 3.46Å; W43-L47 PolarHBondContact O-N 3.06Å; W45-L47 VanDerWaalsContact C-N 3.28Å; W45-L47 PolarHBondContact O-N 3.42Å; L47-R50 WeakPolarHBondContact O-CB 3.06Å; L47-R50 PolarHBondContact O-N 2.94Å; L47-D51 VanDerWaalsContact O-CG 3.26Å; L47-D51 PolarHBondContact O-N 2.89Å
48	M	95.5	Very high	94.2	Very high	18 Å²	18	92 Å²	92	9%	0.089	45%	0.448	C	S	.	.	H	α-helix	trans	-64	-41.6	175.4	-176.4	-172.3	-70.2	0	0	111.6	R37 A39 Q44 W45 D51 K52 Y60	R37-M48 HydrophobicContact CB-CE 3.68Å; R37-M48 HydrophobicContact CG-CE 3.52Å; R37-M48 WeakPolarHBondContact O-CE 3.4Å; A39-M48 HydrophobicContact CB-CE 4.28Å; Q44-M48 WeakPolarHBondContact O-CB 3.41Å; Q44-M48 PolarHBondContact O-N 2.78Å; W45-M48 HydrophobicContact CE3-SD 4.27Å; W45-M48 HydrophobicContact CZ3-SD 4.09Å; W45-M48 WeakPolarHBondContact O-CA 3.43Å; W45-M48 WeakPolarHBondContact O-CB 3Å; W45-M48 PolarHBondContact O-N 3.28Å; M48-D51 PolarHBondContact O-N 2.85Å; M48-K52 WeakPolarHBondContact O-CB 3.35Å; M48-K52 PolarHBondContact O-N 2.89Å; M48-Y60 HydrophobicContact CG-CD1 4.22Å; M48-Y60 HydrophobicContact CG-CD2 4.3Å; M48-Y60 HydrophobicContact CG-CG 3.86Å; M48-Y60 HydrophobicContact SD-CD1 4.22Å; M48-Y60 HydrophobicContact SD-CE1 4.43Å; M48-Y60 HydrophobicContact SD-CG 4.34Å
49	E	95.1	Very high	94.1	Very high	83 Å²	83	90.9 Å²	90.9	39%	0.388	44%	0.44	S	S	.	.	H	α-helix	trans	-67.1	-36	175	-71.9	-174.8	159.4	0	0	112.5	W45 Y46 K52 R53	W45-E49 PolarHBondContact NE1-OE1 3.39Å; W45-E49 PolarHBondContact O-N 2.97Å; Y46-E49 PolarHBondContact O-N 3.1Å; E49-K52 PolarHBondContact O-N 3.15Å; E49-R53 WeakPolarHBondContact O-CG 3.27Å; E49-R53 PolarHBondContact O-N 3.24Å; E49-R53 PolarHBondContact O-NE 2.87Å
50	R	94.7	Very high	93.9	Very high	121 Å²	121	92 Å²	92	46%	0.457	44%	0.437	S	S	.	.	H	α-helix	trans	-59	-49.5	170.7	-179.9	-172.1	174.9	-79.7	-0.2	110.5	Y46 L47 K52 R53 V54	Y46-R50 PolarHBondContact O-N 3.35Å; L47-R50 WeakPolarHBondContact O-CB 3.06Å; L47-R50 PolarHBondContact O-N 2.94Å; R50-K52 VanDerWaalsContact C-N 3.3Å; R50-K52 PolarHBondContact O-N 3.22Å; R50-R53 WeakPolarHBondContact O-CB 3.45Å; R50-R53 PolarHBondContact O-N 2.76Å; R50-R53 VanDerWaalsContact O-N 3.08Å; R50-V54 HydrophobicContact CG-CG2 4.25Å; R50-V54 WeakPolarHBondContact O-CG2 3.44Å; R50-V54 PolarHBondContact O-N 3.33Å
51	D	94.5	Very high	93.8	Very high	45 Å²	45	84.7 Å²	84.7	24%	0.241	41%	0.41	C	S	.	.	H	α-helix	trans	-64.1	-37.7	-178.5	-66.2	-16.4	0	0	0	111.5	R37 L47 M48 R53 V54 S55	R37-D51 IonicContact CZ-OD2 3.62Å; R37-D51 IonicContact NH1-OD2 2.64Å; R37-D51 PolarHBondContact NH1-OD2 2.93Å; R37-D51 IonicContact NH2-OD2 3.8Å; L47-D51 VanDerWaalsContact O-CG 3.26Å; L47-D51 PolarHBondContact O-N 2.89Å; M48-D51 PolarHBondContact O-N 2.85Å; D51-R53 VanDerWaalsContact C-N 3.32Å; D51-R53 PolarHBondContact O-N 3.5Å; D51-V54 PolarHBondContact O-N 3.41Å; D51-S55 WeakPolarHBondContact O-CB 3.46Å; D51-S55 PolarHBondContact O-N 3.4Å
52	K	94.3	Very high	93.6	Very high	85 Å²	85	82.6 Å²	82.6	37%	0.37	40%	0.399	S	S	.	.	H	α-helix	trans	-58.8	-40.4	171.8	-174.4	173.4	171	177	0	112.8	M48 E49 R50 N58	M48-K52 WeakPolarHBondContact O-CB 3.35Å; M48-K52 PolarHBondContact O-N 2.89Å; E49-K52 PolarHBondContact O-N 3.15Å; R50-K52 VanDerWaalsContact C-N 3.3Å; R50-K52 PolarHBondContact O-N 3.22Å; K52-N58 VanDerWaalsContact CE-CG 3.49Å; K52-N58 VanDerWaalsContact CE-O 3.29Å; K52-N58 WeakPolarHBondContact CE-O 3.15Å; K52-N58 WeakPolarHBondContact CE-OD1 3.3Å; K52-N58 WeakPolarHBondContact CG-O 3.34Å
53	R	93.4	Very high	93.3	Very high	159 Å²	159	81 Å²	81	60%	0.6	39%	0.391	S	S	*	.	H	α-helix	trans	-71.7	-45.8	177.7	-73.3	-179.6	-74.1	168	-4.4	112.3	E49 R50 D51 S55	E49-R53 WeakPolarHBondContact O-CG 3.27Å; E49-R53 PolarHBondContact O-N 3.24Å; E49-R53 PolarHBondContact O-NE 2.87Å; R50-R53 WeakPolarHBondContact O-CB 3.45Å; R50-R53 PolarHBondContact O-N 2.76Å; R50-R53 VanDerWaalsContact O-N 3.08Å; D51-R53 VanDerWaalsContact C-N 3.32Å; D51-R53 PolarHBondContact O-N 3.5Å; R53-S55 VanDerWaalsContact C-N 3.31Å; R53-S55 PolarHBondContact O-N 3.29Å
54	V	93.7	Very high	93.1	Very high	65 Å²	65	77.4 Å²	77.4	39%	0.394	38%	0.38	S	S	.	.	H	α-helix	trans	-69.7	-30	-178.5	175.2	0	0	0	0	112	R50 D51 G56 K64	R50-V54 HydrophobicContact CG-CG2 4.25Å; R50-V54 WeakPolarHBondContact O-CG2 3.44Å; R50-V54 PolarHBondContact O-N 3.33Å; D51-V54 PolarHBondContact O-N 3.41Å; V54-G56 PolarHBondContact O-N 2.88Å; V54-K64 HydrophobicContact CG1-CB 4.38Å; V54-K64 HydrophobicContact CG1-CG 4.25Å
55	S	90.2	Very high	92.8	Very high	3 Å²	3	76 Å²	76	2%	0.021	38%	0.383	C	S	.	.	H	α-helix	trans	-57.9	-33.7	178.8	163.3	0	0	0	0	113.8	D51 R53 T57 Q59 N62 K64	D51-S55 WeakPolarHBondContact O-CB 3.46Å; D51-S55 PolarHBondContact O-N 3.4Å; R53-S55 VanDerWaalsContact C-N 3.31Å; R53-S55 PolarHBondContact O-N 3.29Å; S55-T57 PolarHBondContact O-N 2.98Å; S55-T57 VanDerWaalsContact O-N 3.13Å; S55-T57 PolarHBondContact OG-N 3.45Å; S55-T57 PolarHBondContact OG-OG1 2.99Å; S55-Q59 WeakPolarHBondContact CB-O 3.48Å; S55-Q59 PolarHBondContact OG-O 2.95Å; S55-Q59 VanDerWaalsContact OG-O 3.1Å; S55-N62 WeakPolarHBondContact OG-CB 3.39Å; S55-K64 WeakPolarHBondContact O-CE 3.35Å
56	G	88.8	Confident	92.7	Very high	70 Å²	70	76.4 Å²	76.4	72%	0.722	40%	0.395	S	S	*	.	S	Bend	trans	73.5	-13.4	-174.8	0	0	0	0	0	115	V54	V54-G56 PolarHBondContact O-N 2.88Å
57	T	88.7	Confident	92.5	Very high	69 Å²	69	78 Å²	78	42%	0.423	41%	0.406	S	S	.	.	S	Bend	trans	-103	10.9	177.2	65.4	0	0	0	0	113.3	S55 Q59 N62	S55-T57 PolarHBondContact O-N 2.98Å; S55-T57 VanDerWaalsContact O-N 3.13Å; S55-T57 PolarHBondContact OG-N 3.45Å; S55-T57 PolarHBondContact OG-OG1 2.99Å; T57-Q59 PolarHBondContact O-N 3.15Å; T57-Q59 VanDerWaalsContact O-N 3.08Å; T57-Q59 PolarHBondContact OG1-OE1 2.87Å; T57-N62 PolarHBondContact OG1-ND2 3.38Å
58	N	90.1	Very high	92.3	Very high	114 Å²	114	80.4 Å²	80.4	61%	0.61	42%	0.419	S	S	*	.	S	Bend	trans	58.4	17.5	-176.5	-151.3	26.5	0	0	0	113.9	K52	K52-N58 VanDerWaalsContact CE-CG 3.49Å; K52-N58 VanDerWaalsContact CE-O 3.29Å; K52-N58 WeakPolarHBondContact CE-O 3.15Å; K52-N58 WeakPolarHBondContact CE-OD1 3.3Å; K52-N58 WeakPolarHBondContact CG-O 3.34Å
59	Q	92.1	Very high	92	Very high	89 Å²	89	85.4 Å²	85.4	42%	0.416	45%	0.445	S	S	.	.			trans	-116.1	118.3	-179.2	-70.5	171.7	-19.6	0	0	109.6	S55 T57 F61 N62	S55-Q59 WeakPolarHBondContact CB-O 3.48Å; S55-Q59 PolarHBondContact OG-O 2.95Å; S55-Q59 VanDerWaalsContact OG-O 3.1Å; T57-Q59 PolarHBondContact O-N 3.15Å; T57-Q59 VanDerWaalsContact O-N 3.08Å; T57-Q59 PolarHBondContact OG1-OE1 2.87Å; Q59-F61 HydrophobicContact CB-CD1 4.31Å; Q59-F61 HydrophobicContact CB-CE1 3.86Å; Q59-F61 HydrophobicContact CB-CE2 4.34Å; Q59-F61 HydrophobicContact CB-CZ 3.88Å; Q59-F61 HydrophobicContact CG-CE1 4.03Å; Q59-F61 HydrophobicContact CG-CZ 3.9Å; Q59-F61 PolarHBondContact O-N 3.27Å; Q59-N62 PolarHBondContact O-N 3.21Å
60	Y	92.3	Very high	91.4	Very high	63 Å²	63	94.3 Å²	94.3	25%	0.247	48%	0.483	C	S	.	.	T	Hydrogen-bonded Turn	trans	-68.1	-21.8	-176	62	-101.6	0	0	0	114.1	N31 R37 M48 N62	N31-Y60 WeakPolarHBondContact OD1-CE2 3.3Å; N31-Y60 VanDerWaalsContact OD1-CZ 3.27Å; N31-Y60 PolarHBondContact OD1-OH 3.43Å; R37-Y60 HydrophobicContact CB-CE2 4.47Å; M48-Y60 HydrophobicContact CG-CD1 4.22Å; M48-Y60 HydrophobicContact CG-CD2 4.3Å; M48-Y60 HydrophobicContact CG-CG 3.86Å; M48-Y60 HydrophobicContact SD-CD1 4.22Å; M48-Y60 HydrophobicContact SD-CE1 4.43Å; M48-Y60 HydrophobicContact SD-CG 4.34Å; Y60-N62 VanDerWaalsContact C-N 3.33Å
61	F	91.9	Very high	91.2	Very high	49 Å²	49	93 Å²	93	22%	0.215	48%	0.484	C	S	.	.	T	Hydrogen-bonded Turn	trans	-83.9	-9.5	-176.7	58.5	-100.2	0	0	0	112.8	T30 N31 K34 Q59 S63	T30-F61 WeakPolarHBondContact O-CE1 3.17Å; N31-F61 HydrophobicContact CB-CB 4.36Å; N31-F61 WeakPolarHBondContact O-CB 3.36Å; K34-F61 VanDerWaalsContact CE-O 3.32Å; K34-F61 WeakPolarHBondContact CE-O 3.31Å; K34-F61 PolarHBondContact NZ-O 3.26Å; Q59-F61 HydrophobicContact CB-CD1 4.31Å; Q59-F61 HydrophobicContact CB-CE1 3.86Å; Q59-F61 HydrophobicContact CB-CE2 4.34Å; Q59-F61 HydrophobicContact CB-CZ 3.88Å; Q59-F61 HydrophobicContact CG-CE1 4.03Å; Q59-F61 HydrophobicContact CG-CZ 3.9Å; Q59-F61 PolarHBondContact O-N 3.27Å; F61-S63 PolarHBondContact O-N 2.94Å
62	N	91.9	Very high	91	Very high	53 Å²	53	95.5 Å²	95.5	28%	0.283	50%	0.497	S	S	.	.	S	Bend	trans	-83.5	94.4	176.9	-175.2	6.8	0	0	0	109.6	S55 T57 Q59 Y60	S55-N62 WeakPolarHBondContact OG-CB 3.39Å; T57-N62 PolarHBondContact OG1-ND2 3.38Å; Q59-N62 PolarHBondContact O-N 3.21Å; Y60-N62 VanDerWaalsContact C-N 3.33Å
63	S	90.4	Very high	90.9	Very high	82 Å²	82	96.1 Å²	96.1	57%	0.573	50%	0.504	S	S	*	.			trans	-76.2	138.5	-174.4	-60	0	0	0	0	111.2	K34 F61	K34-S63 PolarHBondContact NZ-OG 2.78Å; F61-S63 PolarHBondContact O-N 2.94Å
64	K	92.1	Very high	90.7	Very high	90 Å²	90	92.4 Å²	92.4	39%	0.391	50%	0.498	S	S	.	.			trans	-108.2	123.1	171.1	-59	-61.2	-176.7	178.5	0	108.6	V54 S55 N68	V54-K64 HydrophobicContact CG1-CB 4.38Å; V54-K64 HydrophobicContact CG1-CG 4.25Å; S55-K64 WeakPolarHBondContact O-CE 3.35Å; K64-N68 HydrophobicContact CB-CB 4.17Å
65	G	91.1	Very high	90.5	Very high	37 Å²	37	94.1 Å²	94.1	38%	0.381	51%	0.505	S	S	.	.			trans	-94	-153.9	175.9	0	0	0	0	0	112.5	E67 N68	G65-E67 WeakPolarHBondContact CA-OE1 3.36Å; G65-E67 WeakPolarHBondContact CA-OE2 3.23Å; G65-E67 VanDerWaalsContact N-CD 3.32Å; G65-E67 PolarHBondContact N-OE1 2.76Å; G65-E67 PolarHBondContact N-OE2 2.67Å; G65-E67 PolarHBondContact O-N 3.21Å; G65-N68 PolarHBondContact O-N 3.34Å
66	L	93.6	Very high	90.6	Very high	147 Å²	147	100.2 Å²	100.2	77%	0.77	54%	0.537	S	S	*	.	G	3₁₀ helix	trans	-68.6	-18.1	-179.5	-63.9	175	0	0	0	112.6	N68 I69	L66-N68 PolarHBondContact O-N 3.08Å; L66-N68 VanDerWaalsContact O-N 3.12Å; L66-I69 HydrophobicContact CD2-CD1 4.13Å; L66-I69 PolarHBondContact O-N 2.98Å; L66-I69 VanDerWaalsContact O-N 3.09Å
67	E	93	Very high	90.7	Very high	146 Å²	146	102.4 Å²	102.4	68%	0.682	52%	0.524	S	S	*	.	G	3₁₀ helix	trans	-62.3	-16.4	175.9	71	-76.8	175.4	0	0	113.7	G65	G65-E67 WeakPolarHBondContact CA-OE1 3.36Å; G65-E67 WeakPolarHBondContact CA-OE2 3.23Å; G65-E67 VanDerWaalsContact N-CD 3.32Å; G65-E67 PolarHBondContact N-OE1 2.76Å; G65-E67 PolarHBondContact N-OE2 2.67Å; G65-E67 PolarHBondContact O-N 3.21Å
68	N	91	Very high	90.8	Very high	100 Å²	100	104.9 Å²	104.9	54%	0.535	53%	0.532	S	S	.	.	G	3₁₀ helix	trans	-90.4	-2	178.6	-164.6	65.6	0	0	0	113.3	K64 G65 L66	K64-N68 HydrophobicContact CB-CB 4.17Å; G65-N68 PolarHBondContact O-N 3.34Å; L66-N68 PolarHBondContact O-N 3.08Å; L66-N68 VanDerWaalsContact O-N 3.12Å
69	I	89.9	Confident	90.9	Very high	124 Å²	124	104.2 Å²	104.2	64%	0.636	53%	0.525	S	S	*	.			trans	-108.9	135	-178.3	-53.8	171.8	0	0	0	108.1	L66	L66-I69 HydrophobicContact CD2-CD1 4.13Å; L66-I69 PolarHBondContact O-N 2.98Å; L66-I69 VanDerWaalsContact O-N 3.09Å
70	K	81.5	Confident	90.8	Very high	270 Å²	270	105.5 Å²	105.5	100%	1.174	54%	0.535	S	S	*	.			trans	-101.4	0	179	-174.3	177.9	-179.8	-179	0	110.9

Retrieved 70 of 70 residues in 13.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).