A0A087YHS8_POEFO Loading...

ALMS motif domain-containing protein

AlphaFold DB , UniProt , Accession A0A087YHS8, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 85 aa.

						>A0A087YHS8_POEFO|A0A087YHS8
GLTEEQGKQKRHCTTPDPLSVDNLFKPRERSISGREMQLRSRRIYNKLPEVTKKKEEEKKRAISQTNRLRAEVFKKKVLDQILQR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	G	31.9	Very low	42.8	Very low	127 Å²	127	153.6 Å²	153.6	100%	1.309	82%	0.815	S	S	*	*				0	129.6	0	0	0	0	0	0	108.6
2	L	35	Very low	43.7	Very low	172 Å²	172	156.3 Å²	156.3	90%	0.901	82%	0.819	S	S	*	*			trans	72.5	89.4	156.2	-52.9	175.5	0	0	0	118
3	T	42.9	Very low	44.7	Very low	113 Å²	113	151.5 Å²	151.5	69%	0.693	81%	0.805	S	S	*	*			trans	-38.8	130.4	145.7	-16.6	0	0	0	0	112.3
4	E	40.8	Very low	45.7	Very low	192 Å²	192	145.5 Å²	145.5	90%	0.897	78%	0.777	S	S	*	*			trans	-123.2	105.3	150.7	-78.3	-165.5	157.3	0	0	108.8
5	E	35.8	Very low	46.8	Very low	163 Å²	163	142.6 Å²	142.6	76%	0.762	77%	0.767	S	S	*	*			trans	-52.7	127.3	-176.7	-68.9	-81.6	104.3	0	0	111.7	G7	E5-G7 PolarHBondContact O-N 3.46Å
6	Q	40.6	Very low	48	Very low	166 Å²	166	134.8 Å²	134.8	78%	0.776	73%	0.726	S	S	*	*			trans	-65.1	78.5	163.2	-68.4	-178.3	2.6	0	0	109.6	K8	Q6-K8 PolarHBondContact O-N 2.88Å
7	G	37.5	Very low	49.1	Very low	67 Å²	67	129.5 Å²	129.5	69%	0.691	70%	0.698	S	S	*	*			trans	-71.9	70.7	163.7	0	0	0	0	0	109.5	E5 Q9	E5-G7 PolarHBondContact O-N 3.46Å; G7-Q9 PolarHBondContact O-N 3.19Å
8	K	46.7	Very low	49.8	Very low	177 Å²	177	127.7 Å²	127.7	77%	0.77	69%	0.694	S	S	*	*			trans	-63.1	83.6	160.9	-68.5	-177.9	-175	178.3	0	106.1	Q6 K10	Q6-K8 PolarHBondContact O-N 2.88Å; K8-K10 VanDerWaalsContact C-N 3.27Å; K8-K10 PolarHBondContact O-N 3.39Å
9	Q	50.5	Low	50.4	Low	139 Å²	139	129 Å²	129	65%	0.65	70%	0.699	S	S	*	*			trans	-50.8	105.7	160	-82.5	-176.9	-26.2	0	0	104.3	G7 R11	G7-Q9 PolarHBondContact O-N 3.19Å; Q9-R11 PolarHBondContact O-N 3.02Å
10	K	50.9	Low	51	Low	190 Å²	190	123.8 Å²	123.8	83%	0.826	67%	0.673	S	S	*	*			trans	-59.2	84.8	162.5	-103.6	177.9	173.8	174.6	0	104.1	K8 H12	K8-K10 VanDerWaalsContact C-N 3.27Å; K8-K10 PolarHBondContact O-N 3.39Å; K10-H12 PolarHBondContact O-N 3.04Å
11	R	58.4	Low	51.4	Low	184 Å²	184	124.3 Å²	124.3	69%	0.694	68%	0.68	S	S	*	*			trans	-51.4	117.5	163.4	-62	-77.5	174.3	160.6	-5.2	101.3	Q9 C13	Q9-R11 PolarHBondContact O-N 3.02Å; R11-C13 PolarHBondContact O-N 3.46Å; R11-C13 PolarHBondContact O-SG 3.35Å
12	H	53.3	Low	52.7	Low	185 Å²	185	123.7 Å²	123.7	86%	0.856	65%	0.647	S	S	*	*			trans	-65.8	70.7	172.6	-70.6	-76.6	0	0	0	107	K10	K10-H12 PolarHBondContact O-N 3.04Å
13	C	56.1	Low	53.7	Low	95 Å²	95	115.9 Å²	115.9	64%	0.642	61%	0.606	S	S	*	*			trans	-82.3	123.5	178.8	58.1	0	0	0	0	105.1	R11	R11-C13 PolarHBondContact O-N 3.46Å; R11-C13 PolarHBondContact O-SG 3.35Å
14	T	59.7	Low	54.7	Low	67 Å²	67	116.5 Å²	116.5	41%	0.411	60%	0.604	S	S	.	*			trans	-101.1	154.5	173.3	41.1	0	0	0	0	104.9	P16 R40	T14-P16 WeakPolarHBondContact O-CD 3.42Å; T14-P16 VanDerWaalsContact O-N 3.12Å; T14-R40 PolarHBondContact O-NH1 3.32Å; T14-R40 WeakPolarHBondContact OG1-CD 3.31Å; T14-R40 PolarHBondContact OG1-NE 2.86Å; T14-R40 PolarHBondContact OG1-NH1 3.17Å; T14-R40 VanDerWaalsContact OG1-NH1 3.07Å; T14-R40 PolarHBondContact OG1-NH2 3.41Å
15	T	62.6	Low	55.6	Low	102 Å²	102	116.5 Å²	116.5	63%	0.626	60%	0.601	S	S	*	*			trans	-58.2	113.9	-175	-46.5	0	0	0	0	112.7	P27 R40	T15-P27 HydrophobicContact CG2-CB 4.15Å; T15-P27 HydrophobicContact CG2-CG 3.89Å; T15-R40 VanDerWaalsContact C-NH1 3.26Å; T15-R40 VanDerWaalsContact C-NH2 3.33Å; T15-R40 PolarHBondContact O-NH1 3.36Å; T15-R40 PolarHBondContact O-NH2 3.2Å
16	P	66	Low	56.8	Low	18 Å²	18	116.8 Å²	116.8	12%	0.117	60%	0.6	C	S	.	*			trans	-58.1	162.4	-174.3	26	-35.8	0	0	0	112.3	T14 N23 P27	T14-P16 WeakPolarHBondContact O-CD 3.42Å; T14-P16 VanDerWaalsContact O-N 3.12Å; P16-N23 WeakPolarHBondContact CB-ND2 3.49Å; P16-P27 HydrophobicContact CG-CB 3.99Å
17	D	65.8	Low	58	Low	45 Å²	45	112.7 Å²	112.7	24%	0.241	59%	0.588	C	S	.	*			trans	-55.1	128.2	-179.7	-162.6	-45.7	0	0	0	110.7	L19 S20 N23 R43	D17-L19 PolarHBondContact O-N 2.98Å; D17-L19 VanDerWaalsContact O-N 3.11Å; D17-L19 PolarHBondContact OD1-N 3.13Å; D17-S20 WeakPolarHBondContact O-CB 3.38Å; D17-S20 PolarHBondContact O-N 3.03Å; D17-N23 PolarHBondContact O-ND2 3.42Å; D17-R43 IonicContact OD2-CZ 3.27Å; D17-R43 VanDerWaalsContact OD2-CZ 3.25Å; D17-R43 IonicContact OD2-NH1 3.24Å; D17-R43 PolarHBondContact OD2-NH1 3.24Å; D17-R43 IonicContact OD2-NH2 2.63Å; D17-R43 PolarHBondContact OD2-NH2 2.94Å
18	P	62.6	Low	59.4	Low	97 Å²	97	118.5 Å²	118.5	63%	0.63	59%	0.589	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.5	-22.2	179.8	23.6	-34.6	0	0	0	113.2
19	L	60.2	Low	60.4	Low	152 Å²	152	119 Å²	119	80%	0.796	59%	0.594	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.6	12.5	179.2	-58	179.3	0	0	0	113.6	D17 V21	D17-L19 PolarHBondContact O-N 2.98Å; D17-L19 VanDerWaalsContact O-N 3.11Å; D17-L19 PolarHBondContact OD1-N 3.13Å; L19-V21 PolarHBondContact O-N 3.35Å
20	S	62.9	Low	61.4	Low	24 Å²	24	115.9 Å²	115.9	17%	0.168	58%	0.576	C	S	.	*	S	Bend	trans	-64.3	135.2	168.3	117.2	0	0	0	0	108.3	D17 D22 N23	D17-S20 WeakPolarHBondContact O-CB 3.38Å; D17-S20 PolarHBondContact O-N 3.03Å; S20-D22 PolarHBondContact O-N 3.33Å; S20-N23 WeakPolarHBondContact O-CB 3.42Å; S20-N23 PolarHBondContact O-N 2.87Å; S20-N23 PolarHBondContact OG-ND2 3.07Å; S20-N23 VanDerWaalsContact OG-ND2 3.1Å
21	V	59.8	Low	62.5	Low	136 Å²	136	112.1 Å²	112.1	82%	0.824	57%	0.574	S	S	*	*	G	3₁₀ helix	trans	-48.1	-29.9	-173.5	174.5	0	0	0	0	113.6	L19	L19-V21 PolarHBondContact O-N 3.35Å
22	D	58.2	Low	63.2	Low	114 Å²	114	105.9 Å²	105.9	61%	0.61	55%	0.554	S	S	*	*	G	3₁₀ helix	trans	-80.7	-5.3	176.7	-84	-21.5	0	0	0	115.9	S20	S20-D22 PolarHBondContact O-N 3.33Å
23	N	56.4	Low	64.6	Low	8 Å²	8	100.1 Å²	100.1	4%	0.043	54%	0.535	C	S	.	.	G	3₁₀ helix	trans	-112.9	23.5	-169.6	-72.9	-34.1	0	0	0	114.1	P16 D17 S20 F25 P27 R28	P16-N23 WeakPolarHBondContact CB-ND2 3.49Å; D17-N23 PolarHBondContact O-ND2 3.42Å; S20-N23 WeakPolarHBondContact O-CB 3.42Å; S20-N23 PolarHBondContact O-N 2.87Å; S20-N23 PolarHBondContact OG-ND2 3.07Å; S20-N23 VanDerWaalsContact OG-ND2 3.1Å; N23-F25 PolarHBondContact O-N 3.21Å; N23-P27 WeakPolarHBondContact OD1-CA 3.34Å; N23-R28 PolarHBondContact OD1-N 3.5Å
24	L	63.6	Low	65.9	Low	126 Å²	126	98 Å²	98	66%	0.66	53%	0.528	S	S	*	.	S	Bend	trans	-56.5	-17.3	-172.5	-109.9	66.7	0	0	0	115.2
25	F	60.4	Low	67.2	Low	191 Å²	191	104.9 Å²	104.9	84%	0.838	55%	0.547	S	S	*	.	S	Bend	trans	-140.1	-24.5	177.1	-67.2	-78.5	0	0	0	116.2	N23	N23-F25 PolarHBondContact O-N 3.21Å
26	K	61.3	Low	68.2	Low	169 Å²	169	101.9 Å²	101.9	74%	0.735	53%	0.526	S	S	*	.	S	Bend	trans	-153.1	142.2	174.8	-63.8	-174.4	-178	176.9	0	110	R28	K26-R28 PolarHBondContact O-N 3.18Å
27	P	65.9	Low	69.1	Low	80 Å²	80	106.3 Å²	106.3	52%	0.519	55%	0.546	S	S	.	.			trans	-57.5	104.1	168.7	-22.7	33.8	0	0	0	109.7	T15 P16 N23	T15-P27 HydrophobicContact CG2-CB 4.15Å; T15-P27 HydrophobicContact CG2-CG 3.89Å; P16-P27 HydrophobicContact CG-CB 3.99Å; N23-P27 WeakPolarHBondContact OD1-CA 3.34Å
28	R	67.1	Low	70.2	Confident	189 Å²	189	110.6 Å²	110.6	71%	0.713	57%	0.565	S	S	*	*			trans	-81.6	138.6	174.9	-173.2	172.9	176.5	-127.6	-0.9	108.5	N23 K26 R30	N23-R28 PolarHBondContact OD1-N 3.5Å; K26-R28 PolarHBondContact O-N 3.18Å; R28-R30 PolarHBondContact O-N 3.39Å; R28-R30 VanDerWaalsContact O-N 3.12Å
29	E	66.5	Low	71.4	Confident	189 Å²	189	109.4 Å²	109.4	88%	0.883	55%	0.553	S	S	*	*			trans	-60	118.2	170.4	-68.1	-169.8	173	0	0	109.2
30	R	72.6	Confident	72.6	Confident	72 Å²	72	104 Å²	104	27%	0.272	52%	0.522	S	S	.	.			trans	-144	159.9	176.4	69.3	170	179.7	76.6	-1.4	111.9	R28 I32 E36	R28-R30 PolarHBondContact O-N 3.39Å; R28-R30 VanDerWaalsContact O-N 3.12Å; R30-I32 PolarHBondContact O-N 3.02Å; R30-E36 IonicContact CZ-OE1 2.93Å; R30-E36 IonicContact CZ-OE2 3.25Å; R30-E36 VanDerWaalsContact CZ-OE2 3.31Å; R30-E36 IonicContact NH1-OE1 3.58Å; R30-E36 IonicContact NH1-OE2 2.72Å; R30-E36 PolarHBondContact NH1-OE2 3.45Å; R30-E36 IonicContact NH2-OE1 2.69Å; R30-E36 PolarHBondContact NH2-OE1 3.44Å; R30-E36 IonicContact NH2-OE2 3.01Å; R30-E36 PolarHBondContact NH2-OE2 3.27Å
31	S	72.9	Confident	73.8	Confident	112 Å²	112	106.1 Å²	106.1	78%	0.783	54%	0.537	S	S	*	.	P	Polyproline II helix	trans	-66.4	130.5	168.9	54.4	0	0	0	0	110.4
32	I	73.1	Confident	75.3	Confident	52 Å²	52	106 Å²	106	27%	0.267	52%	0.521	S	S	.	.	P	Polyproline II helix	trans	-94	128.3	175.1	-62.6	175.3	0	0	0	107.9	R30 E36 M37	R30-I32 PolarHBondContact O-N 3.02Å; I32-E36 HydrophobicContact CG2-CB 3.9Å; I32-E36 HydrophobicContact CG2-CG 3.93Å; I32-M37 HydrophobicContact CG2-CB 4.06Å
33	S	82.7	Confident	76.9	Confident	65 Å²	65	105 Å²	105	46%	0.455	51%	0.509	S	S	.	.	P	Polyproline II helix	trans	-70.9	154.5	174.9	71.7	0	0	0	0	111.3	R35 E36 M37	S33-R35 PolarHBondContact O-N 2.91Å; S33-E36 PolarHBondContact O-N 3.47Å; S33-E36 VanDerWaalsContact O-N 3.11Å; S33-E36 WeakPolarHBondContact OG-CB 3.41Å; S33-E36 PolarHBondContact OG-N 3.18Å; S33-M37 PolarHBondContact O-N 2.93Å
34	G	84.6	Confident	78.5	Confident	49 Å²	49	108.6 Å²	108.6	51%	0.505	53%	0.527	S	S	.	.	H	α-helix	trans	-56.9	-37.2	176.6	0	0	0	0	0	113.4	M37 Q38	G34-M37 WeakPolarHBondContact O-CB 3.31Å; G34-M37 PolarHBondContact O-N 2.99Å; G34-Q38 PolarHBondContact O-N 3.44Å
35	R	85.6	Confident	80	Confident	213 Å²	213	109.3 Å²	109.3	80%	0.804	52%	0.523	S	S	*	.	H	α-helix	trans	-62.9	-45	175.6	178.6	179.7	-74.5	-100.6	0.6	111.9	S33 Q38 L39	S33-R35 PolarHBondContact O-N 2.91Å; R35-Q38 PolarHBondContact O-N 3.01Å; R35-L39 PolarHBondContact O-N 3.42Å
36	E	84.8	Confident	81.5	Confident	39 Å²	39	103 Å²	103	18%	0.182	50%	0.497	C	S	.	.	H	α-helix	trans	-65.9	-43.8	177.9	-177.1	-175	167.8	0	0	111.3	R30 I32 S33 Q38 L39 R40	R30-E36 IonicContact CZ-OE1 2.93Å; R30-E36 IonicContact CZ-OE2 3.25Å; R30-E36 VanDerWaalsContact CZ-OE2 3.31Å; R30-E36 IonicContact NH1-OE1 3.58Å; R30-E36 IonicContact NH1-OE2 2.72Å; R30-E36 PolarHBondContact NH1-OE2 3.45Å; R30-E36 IonicContact NH2-OE1 2.69Å; R30-E36 PolarHBondContact NH2-OE1 3.44Å; R30-E36 IonicContact NH2-OE2 3.01Å; R30-E36 PolarHBondContact NH2-OE2 3.27Å; I32-E36 HydrophobicContact CG2-CB 3.9Å; I32-E36 HydrophobicContact CG2-CG 3.93Å; S33-E36 PolarHBondContact O-N 3.47Å; S33-E36 VanDerWaalsContact O-N 3.11Å; S33-E36 WeakPolarHBondContact OG-CB 3.41Å; S33-E36 PolarHBondContact OG-N 3.18Å; E36-Q38 VanDerWaalsContact C-N 3.33Å; E36-Q38 PolarHBondContact O-N 2.94Å; E36-L39 PolarHBondContact O-N 2.88Å; E36-R40 VanDerWaalsContact O-CB 3.26Å; E36-R40 WeakPolarHBondContact O-CB 3.37Å; E36-R40 PolarHBondContact O-N 2.94Å
37	M	85.1	Confident	83	Confident	111 Å²	111	103 Å²	103	55%	0.547	50%	0.497	S	S	.	.	H	α-helix	trans	-55	-49.1	174.5	-179.3	-177.5	69.8	0	0	111	I32 S33 G34 R40 S41	I32-M37 HydrophobicContact CG2-CB 4.06Å; S33-M37 PolarHBondContact O-N 2.93Å; G34-M37 WeakPolarHBondContact O-CB 3.31Å; G34-M37 PolarHBondContact O-N 2.99Å; M37-R40 WeakPolarHBondContact O-CB 3.26Å; M37-R40 PolarHBondContact O-N 3.49Å; M37-S41 PolarHBondContact O-N 3.43Å; M37-S41 PolarHBondContact O-OG 2.8Å; M37-S41 VanDerWaalsContact O-OG 3.12Å
38	Q	87.8	Confident	84.4	Confident	135 Å²	135	102.4 Å²	102.4	63%	0.631	49%	0.489	S	S	*	.	H	α-helix	trans	-63.1	-45.3	179.1	-170.4	-174.9	10.9	0	0	112.5	G34 R35 E36 R40 S41 R42	G34-Q38 PolarHBondContact O-N 3.44Å; R35-Q38 PolarHBondContact O-N 3.01Å; E36-Q38 VanDerWaalsContact C-N 3.33Å; E36-Q38 PolarHBondContact O-N 2.94Å; Q38-R40 PolarHBondContact O-N 3.31Å; Q38-S41 PolarHBondContact O-N 3.11Å; Q38-R42 WeakPolarHBondContact O-CB 3.34Å; Q38-R42 PolarHBondContact O-N 3.3Å
39	L	88.4	Confident	85.8	Confident	72 Å²	72	96.6 Å²	96.6	38%	0.377	48%	0.476	S	S	.	.	H	α-helix	trans	-58.4	-42.1	176.3	175.6	61.8	0	0	0	110.8	R35 E36 R43	R35-L39 PolarHBondContact O-N 3.42Å; E36-L39 PolarHBondContact O-N 2.88Å; L39-R43 WeakPolarHBondContact O-CG 3.37Å; L39-R43 PolarHBondContact O-N 3.32Å
40	R	84.4	Confident	87.2	Confident	37 Å²	37	93.7 Å²	93.7	14%	0.14	46%	0.463	C	S	.	.	H	α-helix	trans	-66.7	-49.7	179.2	-172.7	-170.4	-177.2	136.7	7.7	112.6	T14 T15 E36 M37 Q38 R42 R43 I44	T14-R40 PolarHBondContact O-NH1 3.32Å; T14-R40 WeakPolarHBondContact OG1-CD 3.31Å; T14-R40 PolarHBondContact OG1-NE 2.86Å; T14-R40 PolarHBondContact OG1-NH1 3.17Å; T14-R40 VanDerWaalsContact OG1-NH1 3.07Å; T14-R40 PolarHBondContact OG1-NH2 3.41Å; T15-R40 VanDerWaalsContact C-NH1 3.26Å; T15-R40 VanDerWaalsContact C-NH2 3.33Å; T15-R40 PolarHBondContact O-NH1 3.36Å; T15-R40 PolarHBondContact O-NH2 3.2Å; E36-R40 VanDerWaalsContact O-CB 3.26Å; E36-R40 WeakPolarHBondContact O-CB 3.37Å; E36-R40 PolarHBondContact O-N 2.94Å; M37-R40 WeakPolarHBondContact O-CB 3.26Å; M37-R40 PolarHBondContact O-N 3.49Å; Q38-R40 PolarHBondContact O-N 3.31Å; R40-R42 PolarHBondContact O-N 3.45Å; R40-R43 WeakPolarHBondContact O-CB 3.47Å; R40-R43 PolarHBondContact O-N 2.89Å; R40-I44 HydrophobicContact CG-CD1 3.93Å; R40-I44 HydrophobicContact CG-CG1 4.44Å; R40-I44 WeakPolarHBondContact O-CG1 3.47Å; R40-I44 PolarHBondContact O-N 3.27Å
41	S	87.6	Confident	88.4	Confident	69 Å²	69	91.1 Å²	91.1	48%	0.483	46%	0.455	S	S	.	.	H	α-helix	trans	-56.6	-40.7	177.4	-61.3	0	0	0	0	110.9	M37 Q38 R43 I44 Y45	M37-S41 PolarHBondContact O-N 3.43Å; M37-S41 PolarHBondContact O-OG 2.8Å; M37-S41 VanDerWaalsContact O-OG 3.12Å; Q38-S41 PolarHBondContact O-N 3.11Å; S41-R43 PolarHBondContact O-N 2.95Å; S41-I44 PolarHBondContact O-N 2.98Å; S41-Y45 WeakPolarHBondContact O-CB 3.48Å; S41-Y45 PolarHBondContact O-N 3.45Å
42	R	92.2	Very high	89.5	Confident	133 Å²	133	88.1 Å²	88.1	50%	0.502	43%	0.432	S	S	.	.	H	α-helix	trans	-61.9	-42.3	174.2	-173.4	172.2	74.5	-112.6	11.5	112.7	Q38 R40 N46	Q38-R42 WeakPolarHBondContact O-CB 3.34Å; Q38-R42 PolarHBondContact O-N 3.3Å; R40-R42 PolarHBondContact O-N 3.45Å; R42-N46 WeakPolarHBondContact O-CB 3.35Å; R42-N46 PolarHBondContact O-N 3.05Å; R42-N46 PolarHBondContact O-ND2 2.97Å
43	R	91.8	Very high	90.7	Very high	93 Å²	93	92.5 Å²	92.5	35%	0.351	45%	0.449	S	S	.	.	H	α-helix	trans	-64.6	-45	176.8	-75	-169.2	-69.4	169	-7.1	111.9	D17 L39 R40 S41 N46 K47	D17-R43 IonicContact OD2-CZ 3.27Å; D17-R43 VanDerWaalsContact OD2-CZ 3.25Å; D17-R43 IonicContact OD2-NH1 3.24Å; D17-R43 PolarHBondContact OD2-NH1 3.24Å; D17-R43 IonicContact OD2-NH2 2.63Å; D17-R43 PolarHBondContact OD2-NH2 2.94Å; L39-R43 WeakPolarHBondContact O-CG 3.37Å; L39-R43 PolarHBondContact O-N 3.32Å; R40-R43 WeakPolarHBondContact O-CB 3.47Å; R40-R43 PolarHBondContact O-N 2.89Å; S41-R43 PolarHBondContact O-N 2.95Å; R43-N46 PolarHBondContact O-N 2.63Å; R43-K47 WeakPolarHBondContact O-CG 3.3Å; R43-K47 PolarHBondContact O-N 3.23Å; R43-K47 VanDerWaalsContact O-N 3.15Å
44	I	90.4	Very high	91.3	Very high	84 Å²	84	95.6 Å²	95.6	43%	0.431	45%	0.454	S	S	.	.	H	α-helix	trans	-61	-50.2	178.4	-66	168.6	0	0	0	109.7	R40 S41 N46 K47 L48	R40-I44 HydrophobicContact CG-CD1 3.93Å; R40-I44 HydrophobicContact CG-CG1 4.44Å; R40-I44 WeakPolarHBondContact O-CG1 3.47Å; R40-I44 PolarHBondContact O-N 3.27Å; S41-I44 PolarHBondContact O-N 2.98Å; I44-N46 VanDerWaalsContact C-N 3.32Å; I44-N46 PolarHBondContact O-N 3.46Å; I44-K47 PolarHBondContact O-N 3.38Å; I44-L48 PolarHBondContact O-N 3.17Å
45	Y	93.9	Very high	91.9	Very high	142 Å²	142	97.4 Å²	97.4	56%	0.557	45%	0.448	S	S	*	.	H	α-helix	trans	-54.1	-47.2	176.5	177.2	-98.6	0	0	0	112.3	S41 K47 L48 V51	S41-Y45 WeakPolarHBondContact O-CB 3.48Å; S41-Y45 PolarHBondContact O-N 3.45Å; Y45-K47 PolarHBondContact O-N 2.93Å; Y45-L48 HydrophobicContact CD2-CD1 4.14Å; Y45-L48 WeakPolarHBondContact O-CB 3.43Å; Y45-L48 WeakPolarHBondContact O-CG 3.44Å; Y45-L48 PolarHBondContact O-N 2.89Å; Y45-V51 HydrophobicContact CD1-CG2 4.41Å; Y45-V51 HydrophobicContact CD2-CG2 4.34Å; Y45-V51 HydrophobicContact CE1-CG1 4.16Å; Y45-V51 HydrophobicContact CE1-CG2 3.99Å; Y45-V51 HydrophobicContact CE2-CG2 3.91Å; Y45-V51 WeakPolarHBondContact O-CG2 3.16Å
46	N	93.6	Very high	92.4	Very high	58 Å²	58	92.4 Å²	92.4	31%	0.31	43%	0.434	S	S	.	.	H	α-helix	trans	-67.6	-20.1	-179.3	-78.5	-42.9	0	0	0	114.4	R42 R43 I44 T52 K55	R42-N46 WeakPolarHBondContact O-CB 3.35Å; R42-N46 PolarHBondContact O-N 3.05Å; R42-N46 PolarHBondContact O-ND2 2.97Å; R43-N46 PolarHBondContact O-N 2.63Å; I44-N46 VanDerWaalsContact C-N 3.32Å; I44-N46 PolarHBondContact O-N 3.46Å; N46-T52 WeakPolarHBondContact O-CG2 3.23Å; N46-K55 PolarHBondContact OD1-NZ 2.87Å
47	K	92	Very high	93	Very high	168 Å²	168	95 Å²	95	73%	0.73	45%	0.446	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.4	-3.1	177.7	-72.3	-176.7	177.3	-167.9	0	113.2	R43 I44 Y45	R43-K47 WeakPolarHBondContact O-CG 3.3Å; R43-K47 PolarHBondContact O-N 3.23Å; R43-K47 VanDerWaalsContact O-N 3.15Å; I44-K47 PolarHBondContact O-N 3.38Å; Y45-K47 PolarHBondContact O-N 2.93Å
48	L	95.8	Very high	93.6	Very high	68 Å²	68	94.5 Å²	94.5	36%	0.356	44%	0.442	S	S	.	.	S	Bend	trans	-63	139.2	177.2	-67	177.6	0	0	0	110.8	I44 Y45 E50 V51 T52	I44-L48 PolarHBondContact O-N 3.17Å; Y45-L48 HydrophobicContact CD2-CD1 4.14Å; Y45-L48 WeakPolarHBondContact O-CB 3.43Å; Y45-L48 WeakPolarHBondContact O-CG 3.44Å; Y45-L48 PolarHBondContact O-N 2.89Å; L48-E50 PolarHBondContact O-N 3.07Å; L48-V51 HydrophobicContact CB-CB 4.29Å; L48-V51 HydrophobicContact CB-CG2 4.05Å; L48-V51 HydrophobicContact CD1-CG2 4.45Å; L48-V51 PolarHBondContact O-N 2.87Å; L48-T52 WeakPolarHBondContact O-CG2 3.49Å; L48-T52 PolarHBondContact O-N 3.33Å; L48-T52 PolarHBondContact O-OG1 3.37Å
49	P	96.9	Very high	94.1	Very high	68 Å²	68	94.7 Å²	94.7	44%	0.442	44%	0.441	S	S	.	.	H	α-helix	trans	-60.2	-34	-178.8	22.3	-30.3	0	0	0	112.1	T52 K53	P49-T52 VanDerWaalsContact CA-OG1 3.28Å; P49-T52 WeakPolarHBondContact CA-OG1 3.29Å; P49-T52 PolarHBondContact O-OG1 3.39Å; P49-K53 VanDerWaalsContact O-CB 3.23Å; P49-K53 WeakPolarHBondContact O-CB 3.41Å; P49-K53 WeakPolarHBondContact O-CG 3.35Å; P49-K53 PolarHBondContact O-N 3.34Å
50	E	95.9	Very high	94.5	Very high	127 Å²	127	98.2 Å²	98.2	59%	0.593	45%	0.454	S	S	*	.	H	α-helix	trans	-66	-45.1	177.5	-56.8	74.8	-161.5	0	0	111.1	L48 K54	L48-E50 PolarHBondContact O-N 3.07Å; E50-K54 WeakPolarHBondContact O-CB 3.46Å; E50-K54 PolarHBondContact O-N 3Å; E50-K54 VanDerWaalsContact O-N 3.09Å
51	V	97.1	Very high	95.1	Very high	18 Å²	18	103.2 Å²	103.2	11%	0.109	47%	0.473	C	S	.	.	H	α-helix	trans	-69.2	-42.1	-179	176.6	0	0	0	0	111.1	Y45 L48 K55	Y45-V51 HydrophobicContact CD1-CG2 4.41Å; Y45-V51 HydrophobicContact CD2-CG2 4.34Å; Y45-V51 HydrophobicContact CE1-CG1 4.16Å; Y45-V51 HydrophobicContact CE1-CG2 3.99Å; Y45-V51 HydrophobicContact CE2-CG2 3.91Å; Y45-V51 WeakPolarHBondContact O-CG2 3.16Å; L48-V51 HydrophobicContact CB-CB 4.29Å; L48-V51 HydrophobicContact CB-CG2 4.05Å; L48-V51 HydrophobicContact CD1-CG2 4.45Å; L48-V51 PolarHBondContact O-N 2.87Å; V51-K55 HydrophobicContact CG1-CD 4.36Å; V51-K55 WeakPolarHBondContact O-CG 3.33Å; V51-K55 PolarHBondContact O-N 2.95Å; V51-K55 VanDerWaalsContact O-N 3.17Å
52	T	95.9	Very high	95.6	Very high	49 Å²	49	102.3 Å²	102.3	30%	0.301	47%	0.469	S	S	.	.	H	α-helix	trans	-66.5	-48.8	178.9	50	0	0	0	0	111.4	N46 L48 P49 K54 K55 E56	N46-T52 WeakPolarHBondContact O-CG2 3.23Å; L48-T52 WeakPolarHBondContact O-CG2 3.49Å; L48-T52 PolarHBondContact O-N 3.33Å; L48-T52 PolarHBondContact O-OG1 3.37Å; P49-T52 VanDerWaalsContact CA-OG1 3.28Å; P49-T52 WeakPolarHBondContact CA-OG1 3.29Å; P49-T52 PolarHBondContact O-OG1 3.39Å; T52-K54 VanDerWaalsContact C-N 3.35Å; T52-K54 PolarHBondContact O-N 2.99Å; T52-K55 PolarHBondContact O-N 3.29Å; T52-E56 WeakPolarHBondContact O-CG 3.31Å; T52-E56 PolarHBondContact O-N 3.03Å
53	K	97.2	Very high	95.9	Very high	144 Å²	144	101.4 Å²	101.4	63%	0.626	47%	0.473	S	S	*	.	H	α-helix	trans	-56.7	-45.9	176.1	-75.9	176.1	-179.8	-178.4	0	112.3	P49 K55 E56 E57	P49-K53 VanDerWaalsContact O-CB 3.23Å; P49-K53 WeakPolarHBondContact O-CB 3.41Å; P49-K53 WeakPolarHBondContact O-CG 3.35Å; P49-K53 PolarHBondContact O-N 3.34Å; K53-K55 PolarHBondContact O-N 3.46Å; K53-E56 PolarHBondContact O-N 3.11Å; K53-E57 WeakPolarHBondContact O-CB 3.26Å; K53-E57 PolarHBondContact O-N 3.48Å
54	K	97	Very high	96.1	Very high	130 Å²	130	100.7 Å²	100.7	57%	0.565	48%	0.482	S	S	*	.	H	α-helix	trans	-59.3	-46.6	178.3	-176	175.7	178.2	178.3	0	112.1	E50 T52 E56 E57 E58	E50-K54 WeakPolarHBondContact O-CB 3.46Å; E50-K54 PolarHBondContact O-N 3Å; E50-K54 VanDerWaalsContact O-N 3.09Å; T52-K54 VanDerWaalsContact C-N 3.35Å; T52-K54 PolarHBondContact O-N 2.99Å; K54-E56 VanDerWaalsContact C-N 3.35Å; K54-E56 PolarHBondContact O-N 3.27Å; K54-E57 PolarHBondContact O-N 3.02Å; K54-E58 WeakPolarHBondContact CE-OE1 3.38Å; K54-E58 WeakPolarHBondContact O-CG 3.28Å; K54-E58 PolarHBondContact O-N 3.19Å
55	K	96.5	Very high	96.5	Very high	88 Å²	88	102.4 Å²	102.4	38%	0.383	49%	0.488	S	S	.	.	H	α-helix	trans	-63.1	-39.8	177.9	-74.1	177.3	-178.5	175.4	0	112.4	N46 V51 T52 K53 K59	N46-K55 PolarHBondContact OD1-NZ 2.87Å; V51-K55 HydrophobicContact CG1-CD 4.36Å; V51-K55 WeakPolarHBondContact O-CG 3.33Å; V51-K55 PolarHBondContact O-N 2.95Å; V51-K55 VanDerWaalsContact O-N 3.17Å; T52-K55 PolarHBondContact O-N 3.29Å; K53-K55 PolarHBondContact O-N 3.46Å; K55-K59 VanDerWaalsContact O-CG 3.26Å; K55-K59 WeakPolarHBondContact O-CG 3.48Å; K55-K59 PolarHBondContact O-N 2.94Å
56	E	96.9	Very high	96.7	Very high	107 Å²	107	98.6 Å²	98.6	50%	0.5	48%	0.48	S	S	.	.	H	α-helix	trans	-66.5	-41	177	-74.2	-179.2	-174.5	0	0	112.2	T52 K53 K54 K59 K60	T52-E56 WeakPolarHBondContact O-CG 3.31Å; T52-E56 PolarHBondContact O-N 3.03Å; K53-E56 PolarHBondContact O-N 3.11Å; K54-E56 VanDerWaalsContact C-N 3.35Å; K54-E56 PolarHBondContact O-N 3.27Å; E56-K59 PolarHBondContact O-N 3.18Å; E56-K60 WeakPolarHBondContact O-CG 3.38Å; E56-K60 PolarHBondContact O-N 3.05Å
57	E	97.2	Very high	96.9	Very high	95 Å²	95	100.6 Å²	100.6	44%	0.444	49%	0.49	S	S	.	.	H	α-helix	trans	-63.5	-46.2	176.6	-170	-176.9	177.1	0	0	111.7	K53 K54 K59 K60 R61	K53-E57 WeakPolarHBondContact O-CB 3.26Å; K53-E57 PolarHBondContact O-N 3.48Å; K54-E57 PolarHBondContact O-N 3.02Å; E57-K59 VanDerWaalsContact C-N 3.31Å; E57-K59 PolarHBondContact O-N 3.17Å; E57-K60 PolarHBondContact O-N 3.15Å; E57-R61 VanDerWaalsContact O-CG 3.31Å; E57-R61 WeakPolarHBondContact O-CG 3.32Å; E57-R61 PolarHBondContact O-N 2.99Å; E57-R61 IonicContact OE1-CZ 2.66Å; E57-R61 VanDerWaalsContact OE1-CZ 3.27Å; E57-R61 IonicContact OE1-NE 3.52Å; E57-R61 PolarHBondContact OE1-NE 3.09Å; E57-R61 IonicContact OE1-NH2 3.31Å; E57-R61 PolarHBondContact OE1-NH2 3.36Å
58	E	97.1	Very high	97.1	Very high	99 Å²	99	100.4 Å²	100.4	46%	0.463	49%	0.485	S	S	.	.	H	α-helix	trans	-57.5	-43.7	174.7	-74	171.1	-178.3	0	0	111.6	K54 R61 A62	K54-E58 WeakPolarHBondContact CE-OE1 3.38Å; K54-E58 WeakPolarHBondContact O-CG 3.28Å; K54-E58 PolarHBondContact O-N 3.19Å; E58-R61 PolarHBondContact O-N 2.85Å; E58-A62 PolarHBondContact O-N 2.66Å
59	K	97.2	Very high	97.3	Very high	140 Å²	140	102.5 Å²	102.5	61%	0.609	50%	0.496	S	S	*	.	H	α-helix	trans	-61.2	-46.3	174.2	-74.4	173.7	-179.3	-176.5	0	112.2	K55 E56 E57 R61 A62 I63	K55-K59 VanDerWaalsContact O-CG 3.26Å; K55-K59 WeakPolarHBondContact O-CG 3.48Å; K55-K59 PolarHBondContact O-N 2.94Å; E56-K59 PolarHBondContact O-N 3.18Å; E57-K59 VanDerWaalsContact C-N 3.31Å; E57-K59 PolarHBondContact O-N 3.17Å; K59-R61 VanDerWaalsContact C-N 3.33Å; K59-R61 PolarHBondContact O-N 2.99Å; K59-A62 PolarHBondContact O-N 2.9Å; K59-I63 VanDerWaalsContact O-CG1 3.29Å; K59-I63 WeakPolarHBondContact O-CG1 3.17Å; K59-I63 PolarHBondContact O-N 3.33Å
60	K	97.7	Very high	97.3	Very high	145 Å²	145	107.6 Å²	107.6	63%	0.63	51%	0.507	S	S	*	.	H	α-helix	trans	-60.2	-43.3	177.8	-76.2	176	-179.9	176.4	0	111.3	E56 E57 I63 S64	E56-K60 WeakPolarHBondContact O-CG 3.38Å; E56-K60 PolarHBondContact O-N 3.05Å; E57-K60 PolarHBondContact O-N 3.15Å; K60-I63 PolarHBondContact O-N 3.33Å; K60-S64 VanDerWaalsContact O-CB 3.3Å; K60-S64 WeakPolarHBondContact O-CB 3.39Å; K60-S64 PolarHBondContact O-N 3.36Å
61	R	97.7	Very high	97.4	Very high	143 Å²	143	103.8 Å²	103.8	54%	0.54	50%	0.497	S	S	.	.	H	α-helix	trans	-60.1	-47.7	175.9	-70.8	173.2	-177.2	-167.3	0.7	111.3	E57 E58 K59 I63 S64 Q65	E57-R61 VanDerWaalsContact O-CG 3.31Å; E57-R61 WeakPolarHBondContact O-CG 3.32Å; E57-R61 PolarHBondContact O-N 2.99Å; E57-R61 IonicContact OE1-CZ 2.66Å; E57-R61 VanDerWaalsContact OE1-CZ 3.27Å; E57-R61 IonicContact OE1-NE 3.52Å; E57-R61 PolarHBondContact OE1-NE 3.09Å; E57-R61 IonicContact OE1-NH2 3.31Å; E57-R61 PolarHBondContact OE1-NH2 3.36Å; E58-R61 PolarHBondContact O-N 2.85Å; K59-R61 VanDerWaalsContact C-N 3.33Å; K59-R61 PolarHBondContact O-N 2.99Å; R61-I63 PolarHBondContact O-N 2.93Å; R61-S64 PolarHBondContact O-N 3.1Å; R61-Q65 WeakPolarHBondContact O-CG 3.39Å; R61-Q65 PolarHBondContact O-N 2.91Å
62	A	97.5	Very high	97.4	Very high	49 Å²	49	108.4 Å²	108.4	41%	0.405	52%	0.517	S	S	.	.	H	α-helix	trans	-62.6	-42.6	178.6	0	0	0	0	0	112.8	E58 K59 T66	E58-A62 PolarHBondContact O-N 2.66Å; K59-A62 PolarHBondContact O-N 2.9Å; A62-T66 WeakPolarHBondContact O-CB 3.45Å; A62-T66 PolarHBondContact O-N 3.35Å; A62-T66 PolarHBondContact O-OG1 3.07Å
63	I	97.8	Very high	97.5	Very high	115 Å²	115	109.9 Å²	109.9	59%	0.59	53%	0.526	S	S	*	.	H	α-helix	trans	-63.8	-46	176.2	-68.5	166.3	0	0	0	110.2	K59 K60 R61 Q65 T66 N67	K59-I63 VanDerWaalsContact O-CG1 3.29Å; K59-I63 WeakPolarHBondContact O-CG1 3.17Å; K59-I63 PolarHBondContact O-N 3.33Å; K60-I63 PolarHBondContact O-N 3.33Å; R61-I63 PolarHBondContact O-N 2.93Å; I63-Q65 PolarHBondContact O-N 3.46Å; I63-T66 PolarHBondContact O-N 2.62Å; I63-N67 VanDerWaalsContact O-CB 3.26Å; I63-N67 WeakPolarHBondContact O-CB 3.42Å; I63-N67 PolarHBondContact O-N 2.83Å
64	S	97.6	Very high	97.5	Very high	78 Å²	78	109.7 Å²	109.7	55%	0.545	53%	0.526	S	S	.	.	H	α-helix	trans	-60.4	-45.7	178.9	176.2	0	0	0	0	111.9	K60 R61 T66 N67 R68	K60-S64 VanDerWaalsContact O-CB 3.3Å; K60-S64 WeakPolarHBondContact O-CB 3.39Å; K60-S64 PolarHBondContact O-N 3.36Å; R61-S64 PolarHBondContact O-N 3.1Å; S64-T66 PolarHBondContact O-N 2.88Å; S64-N67 PolarHBondContact O-N 3.07Å; S64-R68 WeakPolarHBondContact O-CB 3.39Å; S64-R68 PolarHBondContact O-N 2.76Å
65	Q	97.6	Very high	97.5	Very high	120 Å²	120	110.3 Å²	110.3	56%	0.561	53%	0.528	S	S	*	.	H	α-helix	trans	-60.2	-45.4	176.5	-73.4	175.7	-4.9	0	0	111.9	R61 I63 R68 L69	R61-Q65 WeakPolarHBondContact O-CG 3.39Å; R61-Q65 PolarHBondContact O-N 2.91Å; I63-Q65 PolarHBondContact O-N 3.46Å; Q65-R68 PolarHBondContact O-N 2.91Å; Q65-L69 WeakPolarHBondContact O-CG 3.37Å; Q65-L69 PolarHBondContact O-N 3.25Å; Q65-L69 VanDerWaalsContact O-N 3.11Å
66	T	97.8	Very high	97.5	Very high	61 Å²	61	112.6 Å²	112.6	37%	0.374	54%	0.538	S	S	.	.	H	α-helix	trans	-65.6	-42.7	178.3	-59.1	0	0	0	0	111.4	A62 I63 S64 L69 R70	A62-T66 WeakPolarHBondContact O-CB 3.45Å; A62-T66 PolarHBondContact O-N 3.35Å; A62-T66 PolarHBondContact O-OG1 3.07Å; I63-T66 PolarHBondContact O-N 2.62Å; S64-T66 PolarHBondContact O-N 2.88Å; T66-L69 PolarHBondContact O-N 3.48Å; T66-R70 WeakPolarHBondContact O-CG 3.45Å; T66-R70 PolarHBondContact O-N 2.64Å
67	N	97.9	Very high	97.5	Very high	100 Å²	100	113.8 Å²	113.8	54%	0.535	54%	0.542	S	S	.	.	H	α-helix	trans	-62.6	-43.4	178.3	-171.4	-70.2	0	0	0	111	I63 S64 L69 R70 A71	I63-N67 VanDerWaalsContact O-CB 3.26Å; I63-N67 WeakPolarHBondContact O-CB 3.42Å; I63-N67 PolarHBondContact O-N 2.83Å; S64-N67 PolarHBondContact O-N 3.07Å; N67-L69 PolarHBondContact O-N 2.92Å; N67-R70 WeakPolarHBondContact O-CB 3.47Å; N67-R70 PolarHBondContact O-N 3.38Å; N67-A71 PolarHBondContact O-N 3.42Å
68	R	97.8	Very high	97.4	Very high	164 Å²	164	111.6 Å²	111.6	62%	0.619	54%	0.535	S	S	*	.	H	α-helix	trans	-56	-50	174	-173.5	178	71.5	176.5	4.3	111.7	S64 Q65 R70 A71 E72	S64-R68 WeakPolarHBondContact O-CB 3.39Å; S64-R68 PolarHBondContact O-N 2.76Å; Q65-R68 PolarHBondContact O-N 2.91Å; R68-R70 VanDerWaalsContact C-N 3.32Å; R68-R70 PolarHBondContact O-N 3.02Å; R68-A71 PolarHBondContact O-N 3.04Å; R68-E72 PolarHBondContact O-N 3.29Å
69	L	97.9	Very high	97.4	Very high	112 Å²	112	111.2 Å²	111.2	59%	0.586	54%	0.535	S	S	*	.	H	α-helix	trans	-61	-41	177.9	-68.8	174.2	0	0	0	112.1	Q65 T66 N67 A71 E72 V73	Q65-L69 WeakPolarHBondContact O-CG 3.37Å; Q65-L69 PolarHBondContact O-N 3.25Å; Q65-L69 VanDerWaalsContact O-N 3.11Å; T66-L69 PolarHBondContact O-N 3.48Å; N67-L69 PolarHBondContact O-N 2.92Å; L69-A71 VanDerWaalsContact C-N 3.33Å; L69-A71 PolarHBondContact O-N 3.01Å; L69-E72 PolarHBondContact O-N 3.25Å; L69-V73 WeakPolarHBondContact O-CG2 3.42Å; L69-V73 PolarHBondContact O-N 3.37Å
70	R	98.1	Very high	97.3	Very high	175 Å²	175	107.2 Å²	107.2	66%	0.66	52%	0.521	S	S	*	.	H	α-helix	trans	-61.6	-41.6	175.7	-72.4	175.1	-174.8	171.2	3.2	111.9	T66 N67 R68 F74	T66-R70 WeakPolarHBondContact O-CG 3.45Å; T66-R70 PolarHBondContact O-N 2.64Å; N67-R70 WeakPolarHBondContact O-CB 3.47Å; N67-R70 PolarHBondContact O-N 3.38Å; R68-R70 VanDerWaalsContact C-N 3.32Å; R68-R70 PolarHBondContact O-N 3.02Å; R70-F74 WeakPolarHBondContact O-CB 3.33Å; R70-F74 PolarHBondContact O-N 2.89Å
71	A	98.1	Very high	97.1	Very high	48 Å²	48	107.5 Å²	107.5	40%	0.397	52%	0.524	S	S	.	.	H	α-helix	trans	-64.2	-44.6	177.5	0	0	0	0	0	111.9	N67 R68 L69 F74 K75	N67-A71 PolarHBondContact O-N 3.42Å; R68-A71 PolarHBondContact O-N 3.04Å; L69-A71 VanDerWaalsContact C-N 3.33Å; L69-A71 PolarHBondContact O-N 3.01Å; A71-F74 PolarHBondContact O-N 3.12Å; A71-K75 WeakPolarHBondContact O-CB 3.38Å; A71-K75 PolarHBondContact O-N 2.61Å
72	E	97.4	Very high	96.9	Very high	114 Å²	114	106.5 Å²	106.5	53%	0.533	53%	0.528	S	S	.	.	H	α-helix	trans	-62.1	-45.2	176.9	-69.1	-54.3	140.9	0	0	112.1	R68 L69 F74 K75 K76	R68-E72 PolarHBondContact O-N 3.29Å; L69-E72 PolarHBondContact O-N 3.25Å; E72-F74 VanDerWaalsContact C-N 3.32Å; E72-F74 PolarHBondContact O-N 3.01Å; E72-K75 PolarHBondContact O-N 3.12Å; E72-K76 WeakPolarHBondContact O-CB 3.5Å; E72-K76 PolarHBondContact O-N 2.89Å
73	V	97.7	Very high	96.7	Very high	80 Å²	80	108.2 Å²	108.2	49%	0.485	53%	0.531	S	S	.	.	H	α-helix	trans	-61.8	-42.6	175.9	170.9	0	0	0	0	111.1	L69 K76 K77	L69-V73 WeakPolarHBondContact O-CG2 3.42Å; L69-V73 PolarHBondContact O-N 3.37Å; V73-K76 PolarHBondContact O-N 3.05Å; V73-K77 HydrophobicContact CG1-CD 4.28Å; V73-K77 WeakPolarHBondContact O-CG 3.41Å; V73-K77 PolarHBondContact O-N 3.04Å
74	F	97.4	Very high	95.8	Very high	141 Å²	141	111.3 Å²	111.3	62%	0.618	54%	0.542	S	S	*	.	H	α-helix	trans	-62.6	-48	177.5	178.3	-99.4	0	0	0	111.4	R70 A71 E72 K76 K77 V78	R70-F74 WeakPolarHBondContact O-CB 3.33Å; R70-F74 PolarHBondContact O-N 2.89Å; A71-F74 PolarHBondContact O-N 3.12Å; E72-F74 VanDerWaalsContact C-N 3.32Å; E72-F74 PolarHBondContact O-N 3.01Å; F74-K76 VanDerWaalsContact C-N 3.29Å; F74-K76 PolarHBondContact O-N 2.72Å; F74-K77 PolarHBondContact O-N 2.69Å; F74-V78 HydrophobicContact CD1-CG2 4.23Å; F74-V78 HydrophobicContact CD2-CG2 4.44Å; F74-V78 HydrophobicContact CE1-CG2 3.76Å; F74-V78 HydrophobicContact CE2-CG2 4Å; F74-V78 HydrophobicContact CZ-CG2 3.63Å; F74-V78 WeakPolarHBondContact O-CG2 3.44Å; F74-V78 PolarHBondContact O-N 3.46Å
75	K	96.8	Very high	94.1	Very high	143 Å²	143	119.7 Å²	119.7	62%	0.622	56%	0.562	S	S	*	*	H	α-helix	trans	-57.6	-43.5	178.1	-168	-179.3	-176	-178	0	111.4	A71 E72 L79	A71-K75 WeakPolarHBondContact O-CB 3.38Å; A71-K75 PolarHBondContact O-N 2.61Å; E72-K75 PolarHBondContact O-N 3.12Å; K75-L79 WeakPolarHBondContact O-CB 3.48Å; K75-L79 PolarHBondContact O-N 3.31Å
76	K	96.5	Very high	94	Very high	135 Å²	135	119.7 Å²	119.7	59%	0.587	56%	0.562	S	S	*	*	H	α-helix	trans	-59.9	-51.8	174.6	-177.8	179	176.5	-179.6	0	111.7	E72 V73 F74 V78 L79 D80	E72-K76 WeakPolarHBondContact O-CB 3.5Å; E72-K76 PolarHBondContact O-N 2.89Å; V73-K76 PolarHBondContact O-N 3.05Å; F74-K76 VanDerWaalsContact C-N 3.29Å; F74-K76 PolarHBondContact O-N 2.72Å; K76-V78 VanDerWaalsContact C-N 3.31Å; K76-V78 PolarHBondContact O-N 3.43Å; K76-L79 WeakPolarHBondContact O-CB 3.45Å; K76-L79 PolarHBondContact O-N 3.02Å; K76-L79 VanDerWaalsContact O-N 3.13Å; K76-D80 WeakPolarHBondContact CG-OD2 3.43Å; K76-D80 VanDerWaalsContact O-CG 3.23Å; K76-D80 PolarHBondContact O-N 3.42Å
77	K	95.9	Very high	93.8	Very high	132 Å²	132	122.7 Å²	122.7	57%	0.574	57%	0.572	S	S	*	*	H	α-helix	trans	-58	-42.1	-179.6	-74.4	-179.5	176.8	-170.7	0	112.9	V73 F74 D80 Q81	V73-K77 HydrophobicContact CG1-CD 4.28Å; V73-K77 WeakPolarHBondContact O-CG 3.41Å; V73-K77 PolarHBondContact O-N 3.04Å; F74-K77 PolarHBondContact O-N 2.69Å; K77-D80 PolarHBondContact O-N 3.49Å; K77-Q81 VanDerWaalsContact O-CG 3.31Å; K77-Q81 WeakPolarHBondContact O-CG 3.46Å; K77-Q81 PolarHBondContact O-N 2.91Å
78	V	96.1	Very high	93.5	Very high	49 Å²	49	124 Å²	124	30%	0.297	57%	0.574	S	S	.	*	H	α-helix	trans	-65.2	-43.6	177.2	171.9	0	0	0	0	110.8	F74 K76 Q81 I82	F74-V78 HydrophobicContact CD1-CG2 4.23Å; F74-V78 HydrophobicContact CD2-CG2 4.44Å; F74-V78 HydrophobicContact CE1-CG2 3.76Å; F74-V78 HydrophobicContact CE2-CG2 4Å; F74-V78 HydrophobicContact CZ-CG2 3.63Å; F74-V78 WeakPolarHBondContact O-CG2 3.44Å; F74-V78 PolarHBondContact O-N 3.46Å; K76-V78 VanDerWaalsContact C-N 3.31Å; K76-V78 PolarHBondContact O-N 3.43Å; V78-Q81 PolarHBondContact O-N 2.95Å; V78-I82 HydrophobicContact CG1-CD1 3.81Å; V78-I82 VanDerWaalsContact O-CG1 3.31Å; V78-I82 WeakPolarHBondContact O-CG1 3.49Å; V78-I82 PolarHBondContact O-N 3.25Å
79	L	95.9	Very high	93.3	Very high	91 Å²	91	121.6 Å²	121.6	48%	0.476	57%	0.571	S	S	.	*	H	α-helix	trans	-62.2	-45	177.4	-177.2	65	0	0	0	111.7	K75 K76 Q81 I82 L83	K75-L79 WeakPolarHBondContact O-CB 3.48Å; K75-L79 PolarHBondContact O-N 3.31Å; K76-L79 WeakPolarHBondContact O-CB 3.45Å; K76-L79 PolarHBondContact O-N 3.02Å; K76-L79 VanDerWaalsContact O-N 3.13Å; L79-Q81 VanDerWaalsContact C-N 3.3Å; L79-Q81 PolarHBondContact O-N 3.11Å; L79-I82 PolarHBondContact O-N 3.41Å; L79-L83 HydrophobicContact CD1-CD1 3.7Å; L79-L83 HydrophobicContact CD1-CG 3.93Å; L79-L83 HydrophobicContact CD2-CD1 4.35Å; L79-L83 HydrophobicContact CG-CD1 3.76Å; L79-L83 HydrophobicContact CG-CG 4.26Å; L79-L83 WeakPolarHBondContact O-CB 3.26Å; L79-L83 WeakPolarHBondContact O-CG 3.38Å; L79-L83 PolarHBondContact O-N 2.79Å
80	D	95.2	Very high	93	Very high	57 Å²	57	122.3 Å²	122.3	31%	0.305	57%	0.57	S	S	.	*	H	α-helix	trans	-59.8	-42.4	178.4	-66.1	-17.4	0	0	0	110.5	K76 K77 L83 Q84 R85	K76-D80 WeakPolarHBondContact CG-OD2 3.43Å; K76-D80 VanDerWaalsContact O-CG 3.23Å; K76-D80 PolarHBondContact O-N 3.42Å; K77-D80 PolarHBondContact O-N 3.49Å; D80-L83 PolarHBondContact O-N 2.65Å; D80-Q84 PolarHBondContact O-N 2.86Å; D80-R85 PolarHBondContact O-N 3.22Å
81	Q	93.5	Very high	92.7	Very high	150 Å²	150	118.7 Å²	118.7	70%	0.701	56%	0.564	S	S	*	*	H	α-helix	trans	-61.9	-43	174.3	-74.8	176.1	-10.8	0	0	113.3	K77 V78 L79 Q84	K77-Q81 VanDerWaalsContact O-CG 3.31Å; K77-Q81 WeakPolarHBondContact O-CG 3.46Å; K77-Q81 PolarHBondContact O-N 2.91Å; V78-Q81 PolarHBondContact O-N 2.95Å; L79-Q81 VanDerWaalsContact C-N 3.3Å; L79-Q81 PolarHBondContact O-N 3.11Å; Q81-Q84 PolarHBondContact O-N 2.76Å
82	I	93.9	Very high	92.3	Very high	122 Å²	122	123.8 Å²	123.8	63%	0.626	58%	0.576	S	S	*	*	H	α-helix	trans	-69	-42.1	-179.9	-68.7	167.6	0	0	0	110.9	V78 L79 Q84	V78-I82 HydrophobicContact CG1-CD1 3.81Å; V78-I82 VanDerWaalsContact O-CG1 3.31Å; V78-I82 WeakPolarHBondContact O-CG1 3.49Å; V78-I82 PolarHBondContact O-N 3.25Å; L79-I82 PolarHBondContact O-N 3.41Å; I82-Q84 PolarHBondContact O-N 2.72Å
83	L	93.2	Very high	91.9	Very high	86 Å²	86	124.5 Å²	124.5	45%	0.45	58%	0.58	S	S	.	*	H	α-helix	trans	-80	-2.6	-178.7	-64.3	-179.1	0	0	0	113.2	L79 D80 R85	L79-L83 HydrophobicContact CD1-CD1 3.7Å; L79-L83 HydrophobicContact CD1-CG 3.93Å; L79-L83 HydrophobicContact CD2-CD1 4.35Å; L79-L83 HydrophobicContact CG-CD1 3.76Å; L79-L83 HydrophobicContact CG-CG 4.26Å; L79-L83 WeakPolarHBondContact O-CB 3.26Å; L79-L83 WeakPolarHBondContact O-CG 3.38Å; L79-L83 PolarHBondContact O-N 2.79Å; D80-L83 PolarHBondContact O-N 2.65Å; L83-R85 HydrophobicContact CB-CG 4.11Å; L83-R85 PolarHBondContact O-N 2.98Å
84	Q	79.6	Confident	91.4	Very high	180 Å²	180	128.3 Å²	128.3	84%	0.841	59%	0.588	S	S	*	*	T	Hydrogen-bonded Turn	trans	50.5	35.9	-176.4	-57.2	-179.3	-0.2	0	0	112.7	D80 Q81 I82	D80-Q84 PolarHBondContact O-N 2.86Å; Q81-Q84 PolarHBondContact O-N 2.76Å; I82-Q84 PolarHBondContact O-N 2.72Å
85	R	62.4	Low	90.8	Very high	253 Å²	253	127.1 Å²	127.1	96%	0.955	59%	0.585	S	S	*	*			trans	-96.4	0	178.1	-72.7	-174.3	178.2	177.9	-0.7	111.6	D80 L83	D80-R85 PolarHBondContact O-N 3.22Å; L83-R85 HydrophobicContact CB-CG 4.11Å; L83-R85 PolarHBondContact O-N 2.98Å

Retrieved 85 of 85 residues in 60.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).