A0A087YIJ2_POEFO Loading...

Phosphatidylinositol N-acetylglucosaminyltransferase subunit P

Part of the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis.

AlphaFold DB , UniProt , Accession A0A087YIJ2, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 129 aa.

						>A0A087YIJ2_POEFO|A0A087YIJ2
MVENSPSPLPERAIYGFVLFLGSQFGFFLYCLWAYVPEEWLHSVGLTYWPQKYWALAMPIYLLVALMVSLVVLFGINMNNTAPLDSVDNITDVFAQGQRSDCYRKGGIPRLEDVSISEVNKMFYLSSET
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49	Very low	73.7	Confident	241 Å²	241	117.9 Å²	117.9	100%	1.187	66%	0.66	S	S	*	*				0	114.7	0	-144.4	167.2	-176.2	0	0	105.4	E3	M1-E3 PolarHBondContact O-N 3.33Å
2	V	58.6	Low	74.7	Confident	125 Å²	125	117 Å²	117	76%	0.758	64%	0.639	S	S	*	*			trans	-71.9	112.3	178.5	174	0	0	0	0	107	N4	V2-N4 PolarHBondContact O-N 2.82Å
3	E	67.9	Low	75.9	Confident	157 Å²	157	113.2 Å²	113.2	73%	0.734	63%	0.633	S	S	*	*			trans	-77.2	91.6	-179.2	-160.9	166.9	176.6	0	0	108.8	M1 S5	M1-E3 PolarHBondContact O-N 3.33Å; E3-S5 PolarHBondContact O-N 3.35Å
4	N	69.2	Low	77.1	Confident	141 Å²	141	112.6 Å²	112.6	75%	0.754	63%	0.626	S	S	*	*			trans	-80	60.8	173.3	-81	-57.6	0	0	0	110.1	V2	V2-N4 PolarHBondContact O-N 2.82Å
5	S	77.8	Confident	78.1	Confident	26 Å²	26	116.7 Å²	116.7	18%	0.182	63%	0.63	C	S	.	*			trans	-88	137.3	169.5	60	0	0	0	0	109.1	E3 S7 R12	E3-S5 PolarHBondContact O-N 3.35Å; S5-S7 PolarHBondContact O-N 3.1Å; S5-S7 VanDerWaalsContact O-N 3.16Å; S5-S7 PolarHBondContact OG-OG 3.21Å; S5-R12 PolarHBondContact O-NH1 3.24Å; S5-R12 PolarHBondContact O-NH2 2.91Å
6	P	76.2	Confident	79	Confident	128 Å²	128	111.9 Å²	111.9	83%	0.831	62%	0.616	S	S	*	*			trans	-72.9	3.5	173.3	30.6	-35	0	0	0	112.4
7	S	78.4	Confident	79.9	Confident	51 Å²	51	112.7 Å²	112.7	36%	0.357	61%	0.612	S	S	.	*	S	Bend	trans	-64.6	147.5	-176.8	57	0	0	0	0	111.4	S5 L9 R12	S5-S7 PolarHBondContact O-N 3.1Å; S5-S7 VanDerWaalsContact O-N 3.16Å; S5-S7 PolarHBondContact OG-OG 3.21Å; S7-L9 PolarHBondContact O-N 3.27Å; S7-R12 PolarHBondContact O-NH1 3.44Å
8	P	76.9	Confident	80.8	Confident	132 Å²	132	111.5 Å²	111.5	86%	0.857	61%	0.609	S	S	*	*			trans	-66.4	104.5	174.1	26.7	-32.4	0	0	0	108.8
9	L	84.5	Confident	81.6	Confident	59 Å²	59	112.4 Å²	112.4	31%	0.309	61%	0.612	S	S	.	*			trans	-96.1	138.8	175.6	-70.3	163.4	0	0	0	109.1	S7 E11 R12 A13	S7-L9 PolarHBondContact O-N 3.27Å; L9-E11 PolarHBondContact O-N 3.46Å; L9-E11 VanDerWaalsContact O-N 3.15Å; L9-R12 HydrophobicContact CB-CG 4.28Å; L9-R12 WeakPolarHBondContact O-CB 3.44Å; L9-R12 PolarHBondContact O-N 2.92Å; L9-A13 PolarHBondContact O-N 3.46Å
10	P	85.8	Confident	82.4	Confident	103 Å²	103	112.2 Å²	112.2	67%	0.669	61%	0.605	S	S	*	*	H	α-helix	trans	-52.5	-36.8	175.8	-27.5	34.7	0	0	0	113	R12 A13 I14	P10-R12 VanDerWaalsContact C-N 3.34Å; P10-R12 PolarHBondContact O-N 3.36Å; P10-A13 WeakPolarHBondContact O-CB 3.47Å; P10-A13 PolarHBondContact O-N 3Å; P10-I14 WeakPolarHBondContact O-CG1 3.35Å; P10-I14 PolarHBondContact O-N 3.36Å; P10-I14 VanDerWaalsContact O-N 3.12Å
11	E	86	Confident	83.1	Confident	134 Å²	134	111 Å²	111	63%	0.626	60%	0.599	S	S	*	*	H	α-helix	trans	-59.8	-40.6	176.9	-61.9	179.7	176.7	0	0	112.8	L9 A13 I14 Y15	L9-E11 PolarHBondContact O-N 3.46Å; L9-E11 VanDerWaalsContact O-N 3.15Å; E11-A13 VanDerWaalsContact C-N 3.33Å; E11-A13 PolarHBondContact O-N 3.01Å; E11-I14 PolarHBondContact O-N 3.31Å; E11-Y15 WeakPolarHBondContact O-CD2 3.44Å; E11-Y15 PolarHBondContact O-N 2.98Å
12	R	86.6	Confident	85.5	Confident	107 Å²	107	101.7 Å²	101.7	40%	0.404	56%	0.564	S	S	.	*	H	α-helix	trans	-66.9	-36	176.6	-68.2	-177.2	179	166.3	4.4	112.2	S5 S7 L9 P10 I14 Y15 G16	S5-R12 PolarHBondContact O-NH1 3.24Å; S5-R12 PolarHBondContact O-NH2 2.91Å; S7-R12 PolarHBondContact O-NH1 3.44Å; L9-R12 HydrophobicContact CB-CG 4.28Å; L9-R12 WeakPolarHBondContact O-CB 3.44Å; L9-R12 PolarHBondContact O-N 2.92Å; P10-R12 VanDerWaalsContact C-N 3.34Å; P10-R12 PolarHBondContact O-N 3.36Å; R12-I14 VanDerWaalsContact C-N 3.31Å; R12-I14 PolarHBondContact O-N 3.12Å; R12-Y15 PolarHBondContact O-N 3.21Å; R12-G16 PolarHBondContact O-N 3.03Å
13	A	89.2	Confident	87.3	Confident	68 Å²	68	98.6 Å²	98.6	56%	0.562	55%	0.548	S	S	*	.	H	α-helix	trans	-65	-36.5	175.8	0	0	0	0	0	111.7	L9 P10 E11 G16 F17	L9-A13 PolarHBondContact O-N 3.46Å; P10-A13 WeakPolarHBondContact O-CB 3.47Å; P10-A13 PolarHBondContact O-N 3Å; E11-A13 VanDerWaalsContact C-N 3.33Å; E11-A13 PolarHBondContact O-N 3.01Å; A13-G16 PolarHBondContact O-N 2.57Å; A13-F17 WeakPolarHBondContact O-CB 3.4Å; A13-F17 PolarHBondContact O-N 3.45Å
14	I	93.6	Very high	88.7	Confident	104 Å²	104	94.9 Å²	94.9	53%	0.533	53%	0.53	S	S	.	.	H	α-helix	trans	-62.7	-47	176.4	-64.4	166.6	0	0	0	110.6	P10 E11 R12 G16 F17 V18	P10-I14 WeakPolarHBondContact O-CG1 3.35Å; P10-I14 PolarHBondContact O-N 3.36Å; P10-I14 VanDerWaalsContact O-N 3.12Å; E11-I14 PolarHBondContact O-N 3.31Å; R12-I14 VanDerWaalsContact C-N 3.31Å; R12-I14 PolarHBondContact O-N 3.12Å; I14-G16 VanDerWaalsContact C-N 3.34Å; I14-G16 PolarHBondContact O-N 2.74Å; I14-F17 PolarHBondContact O-N 3.19Å; I14-V18 HydrophobicContact CG2-CG2 4.29Å; I14-V18 WeakPolarHBondContact O-CG2 3.36Å; I14-V18 PolarHBondContact O-N 2.98Å
15	Y	91	Very high	90.1	Very high	175 Å²	175	94.7 Å²	94.7	69%	0.686	52%	0.523	S	S	*	.	H	α-helix	trans	-59.9	-44	177.5	-66.4	-60.6	0	0	0	112.3	E11 R12 F17 V18 L19	E11-Y15 WeakPolarHBondContact O-CD2 3.44Å; E11-Y15 PolarHBondContact O-N 2.98Å; R12-Y15 PolarHBondContact O-N 3.21Å; Y15-F17 VanDerWaalsContact C-N 3.33Å; Y15-F17 PolarHBondContact O-N 3.39Å; Y15-V18 PolarHBondContact O-N 2.9Å; Y15-L19 VanDerWaalsContact O-CB 3.32Å; Y15-L19 WeakPolarHBondContact O-CB 3.39Å; Y15-L19 PolarHBondContact O-N 2.94Å
16	G	92.5	Very high	91	Very high	40 Å²	40	95.2 Å²	95.2	41%	0.412	53%	0.532	S	S	.	.	H	α-helix	trans	-61.2	-41.5	175.8	0	0	0	0	0	112.6	R12 A13 I14 L19 F20	R12-G16 PolarHBondContact O-N 3.03Å; A13-G16 PolarHBondContact O-N 2.57Å; I14-G16 VanDerWaalsContact C-N 3.34Å; I14-G16 PolarHBondContact O-N 2.74Å; G16-L19 PolarHBondContact O-N 3.33Å; G16-F20 WeakPolarHBondContact O-CB 3.18Å; G16-F20 PolarHBondContact O-N 3.37Å
17	F	94.8	Very high	91.9	Very high	125 Å²	125	94.7 Å²	94.7	55%	0.548	52%	0.517	S	S	.	.	H	α-helix	trans	-67.3	-43.7	178.2	-177.3	-111.2	0	0	0	112.7	A13 I14 Y15 L19 F20 L21	A13-F17 WeakPolarHBondContact O-CB 3.4Å; A13-F17 PolarHBondContact O-N 3.45Å; I14-F17 PolarHBondContact O-N 3.19Å; Y15-F17 VanDerWaalsContact C-N 3.33Å; Y15-F17 PolarHBondContact O-N 3.39Å; F17-L19 VanDerWaalsContact C-N 3.34Å; F17-F20 WeakPolarHBondContact O-CB 3.45Å; F17-F20 PolarHBondContact O-N 3.19Å; F17-L21 HydrophobicContact CD1-CD1 4.09Å; F17-L21 HydrophobicContact CE1-CD1 3.47Å; F17-L21 VanDerWaalsContact CE1-CD1 3.47Å; F17-L21 HydrophobicContact CE1-CG 4.21Å; F17-L21 HydrophobicContact CE2-CD1 4.34Å; F17-L21 HydrophobicContact CE2-CD2 4.44Å; F17-L21 HydrophobicContact CE2-CG 4.27Å; F17-L21 HydrophobicContact CZ-CD1 3.62Å; F17-L21 HydrophobicContact CZ-CD2 4.28Å; F17-L21 HydrophobicContact CZ-CG 4.03Å; F17-L21 PolarHBondContact O-N 3.29Å
18	V	96.8	Very high	92.9	Very high	91 Å²	91	98.6 Å²	98.6	55%	0.552	53%	0.528	S	S	*	.	H	α-helix	trans	-62.6	-43.6	175.3	173.1	0	0	0	0	110.6	I14 Y15 F20 L21 G22	I14-V18 HydrophobicContact CG2-CG2 4.29Å; I14-V18 WeakPolarHBondContact O-CG2 3.36Å; I14-V18 PolarHBondContact O-N 2.98Å; Y15-V18 PolarHBondContact O-N 2.9Å; V18-F20 VanDerWaalsContact C-N 3.34Å; V18-F20 PolarHBondContact O-N 3.42Å; V18-L21 PolarHBondContact O-N 2.98Å; V18-G22 PolarHBondContact O-N 3.36Å
19	L	96.3	Very high	93.7	Very high	128 Å²	128	96.5 Å²	96.5	67%	0.67	51%	0.509	S	S	*	.	H	α-helix	trans	-60.6	-43.8	175.8	-177.6	65.7	0	0	0	111.3	Y15 G16 F17 G22 S23	Y15-L19 VanDerWaalsContact O-CB 3.32Å; Y15-L19 WeakPolarHBondContact O-CB 3.39Å; Y15-L19 PolarHBondContact O-N 2.94Å; G16-L19 PolarHBondContact O-N 3.33Å; F17-L19 VanDerWaalsContact C-N 3.34Å; L19-G22 PolarHBondContact O-N 2.86Å; L19-S23 WeakPolarHBondContact O-CB 3.39Å; L19-S23 PolarHBondContact O-N 3.46Å; L19-S23 PolarHBondContact O-OG 2.95Å; L19-S23 VanDerWaalsContact O-OG 3.13Å
20	F	96.6	Very high	94.2	Very high	109 Å²	109	96.8 Å²	96.8	48%	0.478	51%	0.507	S	S	.	.	H	α-helix	trans	-60.6	-48.8	177.1	171.2	-102.8	0	0	0	112.3	G16 F17 V18 G22 S23 Q24	G16-F20 WeakPolarHBondContact O-CB 3.18Å; G16-F20 PolarHBondContact O-N 3.37Å; F17-F20 WeakPolarHBondContact O-CB 3.45Å; F17-F20 PolarHBondContact O-N 3.19Å; V18-F20 VanDerWaalsContact C-N 3.34Å; V18-F20 PolarHBondContact O-N 3.42Å; F20-G22 PolarHBondContact O-N 2.95Å; F20-S23 WeakPolarHBondContact CA-OG 3.35Å; F20-S23 PolarHBondContact O-N 2.62Å; F20-S23 PolarHBondContact O-OG 3.13Å; F20-Q24 HydrophobicContact CD2-CG 4.2Å; F20-Q24 HydrophobicContact CE1-CG 4.27Å; F20-Q24 HydrophobicContact CE2-CG 3.83Å; F20-Q24 HydrophobicContact CZ-CG 3.87Å; F20-Q24 WeakPolarHBondContact O-CB 3.36Å; F20-Q24 WeakPolarHBondContact O-CG 3.45Å; F20-Q24 PolarHBondContact O-N 2.8Å
21	L	98.1	Very high	94.6	Very high	88 Å²	88	93.3 Å²	93.3	46%	0.461	48%	0.484	S	S	.	.	H	α-helix	trans	-62.9	-44.1	177.6	-70.1	-179.6	0	0	0	111.6	F17 V18 Q24 F25	F17-L21 HydrophobicContact CD1-CD1 4.09Å; F17-L21 HydrophobicContact CE1-CD1 3.47Å; F17-L21 VanDerWaalsContact CE1-CD1 3.47Å; F17-L21 HydrophobicContact CE1-CG 4.21Å; F17-L21 HydrophobicContact CE2-CD1 4.34Å; F17-L21 HydrophobicContact CE2-CD2 4.44Å; F17-L21 HydrophobicContact CE2-CG 4.27Å; F17-L21 HydrophobicContact CZ-CD1 3.62Å; F17-L21 HydrophobicContact CZ-CD2 4.28Å; F17-L21 HydrophobicContact CZ-CG 4.03Å; F17-L21 PolarHBondContact O-N 3.29Å; V18-L21 PolarHBondContact O-N 2.98Å; L21-Q24 PolarHBondContact O-N 3.48Å; L21-F25 WeakPolarHBondContact O-CB 3.12Å; L21-F25 PolarHBondContact O-N 3.42Å
22	G	98.1	Very high	95.1	Very high	44 Å²	44	92.4 Å²	92.4	45%	0.454	48%	0.483	S	S	.	.	H	α-helix	trans	-62.2	-42.8	177.4	0	0	0	0	0	112.6	V18 L19 F20 F25 G26	V18-G22 PolarHBondContact O-N 3.36Å; L19-G22 PolarHBondContact O-N 2.86Å; F20-G22 PolarHBondContact O-N 2.95Å; G22-F25 PolarHBondContact O-N 2.98Å; G22-G26 PolarHBondContact O-N 3.4Å
23	S	97	Very high	95.3	Very high	60 Å²	60	88.6 Å²	88.6	42%	0.42	47%	0.469	S	S	.	.	H	α-helix	trans	-67	-41.4	178.1	64.5	0	0	0	0	111.9	L19 F20 G26 F27	L19-S23 WeakPolarHBondContact O-CB 3.39Å; L19-S23 PolarHBondContact O-N 3.46Å; L19-S23 PolarHBondContact O-OG 2.95Å; L19-S23 VanDerWaalsContact O-OG 3.13Å; F20-S23 WeakPolarHBondContact CA-OG 3.35Å; F20-S23 PolarHBondContact O-N 2.62Å; F20-S23 PolarHBondContact O-OG 3.13Å; S23-G26 PolarHBondContact O-N 3.35Å; S23-F27 VanDerWaalsContact O-CB 3.24Å; S23-F27 WeakPolarHBondContact O-CB 3.48Å; S23-F27 PolarHBondContact O-N 2.91Å
24	Q	97.9	Very high	95.6	Very high	80 Å²	80	86.7 Å²	86.7	37%	0.374	45%	0.453	S	S	.	.	H	α-helix	trans	-62	-49	176.3	-71.1	-65.3	97.6	0	0	110.7	F20 L21 F27 F28	F20-Q24 HydrophobicContact CD2-CG 4.2Å; F20-Q24 HydrophobicContact CE1-CG 4.27Å; F20-Q24 HydrophobicContact CE2-CG 3.83Å; F20-Q24 HydrophobicContact CZ-CG 3.87Å; F20-Q24 WeakPolarHBondContact O-CB 3.36Å; F20-Q24 WeakPolarHBondContact O-CG 3.45Å; F20-Q24 PolarHBondContact O-N 2.8Å; L21-Q24 PolarHBondContact O-N 3.48Å; Q24-F27 PolarHBondContact O-N 3.26Å; Q24-F28 WeakPolarHBondContact O-CD2 3.29Å; Q24-F28 PolarHBondContact O-N 2.87Å
25	F	98.1	Very high	95.6	Very high	137 Å²	137	91 Å²	91	60%	0.601	46%	0.464	S	S	*	.	H	α-helix	trans	-60.7	-47.5	178.4	179.7	-107.8	0	0	0	112.2	L21 G22 F27 F28 L29	L21-F25 WeakPolarHBondContact O-CB 3.12Å; L21-F25 PolarHBondContact O-N 3.42Å; G22-F25 PolarHBondContact O-N 2.98Å; F25-F27 VanDerWaalsContact C-N 3.32Å; F25-F27 PolarHBondContact O-N 3.42Å; F25-F28 PolarHBondContact O-N 3.41Å; F25-L29 HydrophobicContact CD1-CD1 4.03Å; F25-L29 HydrophobicContact CE1-CD1 3.44Å; F25-L29 VanDerWaalsContact CE1-CD1 3.44Å; F25-L29 HydrophobicContact CE1-CG 4.19Å; F25-L29 HydrophobicContact CE2-CD1 4.46Å; F25-L29 HydrophobicContact CE2-CG 4.42Å; F25-L29 HydrophobicContact CZ-CD1 3.69Å; F25-L29 HydrophobicContact CZ-CD2 4.33Å; F25-L29 HydrophobicContact CZ-CG 4.11Å; F25-L29 PolarHBondContact O-N 3.49Å
26	G	96.6	Very high	95.7	Very high	36 Å²	36	84.5 Å²	84.5	37%	0.371	44%	0.442	S	S	.	.	H	α-helix	trans	-60.2	-40.1	175.9	0	0	0	0	0	112.8	G22 S23 L29 Y30	G22-G26 PolarHBondContact O-N 3.4Å; S23-G26 PolarHBondContact O-N 3.35Å; G26-L29 PolarHBondContact O-N 3.02Å; G26-Y30 WeakPolarHBondContact O-CB 3.37Å; G26-Y30 PolarHBondContact O-N 2.87Å
27	F	95.8	Very high	95.7	Very high	117 Å²	117	85.5 Å²	85.5	51%	0.513	44%	0.442	S	S	.	.	H	α-helix	trans	-64.6	-41.3	176	-178.4	-106.5	0	0	0	112.4	S23 Q24 F25 Y30 C31	S23-F27 VanDerWaalsContact O-CB 3.24Å; S23-F27 WeakPolarHBondContact O-CB 3.48Å; S23-F27 PolarHBondContact O-N 2.91Å; Q24-F27 PolarHBondContact O-N 3.26Å; F25-F27 VanDerWaalsContact C-N 3.32Å; F25-F27 PolarHBondContact O-N 3.42Å; F27-Y30 WeakPolarHBondContact O-CB 3.21Å; F27-Y30 PolarHBondContact O-N 2.88Å; F27-C31 VanDerWaalsContact CZ-SG 3.58Å; F27-C31 PolarHBondContact O-N 3.44Å; F27-C31 PolarHBondContact O-SG 3.49Å
28	F	97.8	Very high	95.6	Very high	133 Å²	133	84 Å²	84	58%	0.583	44%	0.436	S	S	*	.	H	α-helix	trans	-62	-45.1	174.1	-78.4	-65.4	0	0	0	112	Q24 F25 Y30 C31 L32	Q24-F28 WeakPolarHBondContact O-CD2 3.29Å; Q24-F28 PolarHBondContact O-N 2.87Å; F25-F28 PolarHBondContact O-N 3.41Å; F28-Y30 VanDerWaalsContact C-N 3.31Å; F28-Y30 PolarHBondContact O-N 3.4Å; F28-C31 PolarHBondContact O-N 3.33Å; F28-L32 VanDerWaalsContact O-CB 3.31Å; F28-L32 WeakPolarHBondContact O-CB 3.41Å; F28-L32 PolarHBondContact O-N 3.3Å
29	L	95.2	Very high	95.3	Very high	88 Å²	88	87.2 Å²	87.2	46%	0.461	45%	0.445	S	S	.	.	H	α-helix	trans	-61.9	-40.2	175.7	-69.9	-178.6	0	0	0	112	F25 G26 L32 W33	F25-L29 HydrophobicContact CD1-CD1 4.03Å; F25-L29 HydrophobicContact CE1-CD1 3.44Å; F25-L29 VanDerWaalsContact CE1-CD1 3.44Å; F25-L29 HydrophobicContact CE1-CG 4.19Å; F25-L29 HydrophobicContact CE2-CD1 4.46Å; F25-L29 HydrophobicContact CE2-CG 4.42Å; F25-L29 HydrophobicContact CZ-CD1 3.69Å; F25-L29 HydrophobicContact CZ-CD2 4.33Å; F25-L29 HydrophobicContact CZ-CG 4.11Å; F25-L29 PolarHBondContact O-N 3.49Å; G26-L29 PolarHBondContact O-N 3.02Å; L29-L32 PolarHBondContact O-N 2.84Å; L29-W33 WeakPolarHBondContact O-CB 3.3Å; L29-W33 PolarHBondContact O-N 3.49Å
30	Y	94.6	Very high	95.2	Very high	66 Å²	66	89.2 Å²	89.2	26%	0.259	44%	0.444	S	S	.	.	H	α-helix	trans	-61.2	-48.6	175.9	175.2	-97.8	0	0	0	111.9	G26 F27 F28 W33 A34 A55 P59	G26-Y30 WeakPolarHBondContact O-CB 3.37Å; G26-Y30 PolarHBondContact O-N 2.87Å; F27-Y30 WeakPolarHBondContact O-CB 3.21Å; F27-Y30 PolarHBondContact O-N 2.88Å; F28-Y30 VanDerWaalsContact C-N 3.31Å; F28-Y30 PolarHBondContact O-N 3.4Å; Y30-W33 HydrophobicContact CD2-CE3 4.21Å; Y30-W33 HydrophobicContact CD2-CZ3 4.3Å; Y30-W33 HydrophobicContact CE2-CE3 4.33Å; Y30-W33 AromaticContact CE2-CZ3 3.98Å; Y30-W33 HydrophobicContact CE2-CZ3 3.98Å; Y30-W33 PolarHBondContact O-N 3.24Å; Y30-A34 VanDerWaalsContact O-CB 3.3Å; Y30-A34 WeakPolarHBondContact O-CB 3.07Å; Y30-A34 PolarHBondContact O-N 3.38Å; Y30-A55 WeakPolarHBondContact OH-CA 3.31Å; Y30-A55 PolarHBondContact OH-O 3.41Å; Y30-P59 WeakPolarHBondContact OH-CD 3.47Å; Y30-P59 WeakPolarHBondContact OH-CG 3.46Å
31	C	95.1	Very high	94.9	Very high	29 Å²	29	85.1 Å²	85.1	20%	0.196	43%	0.427	C	S	.	.	H	α-helix	trans	-63.3	-45.6	176.7	-73.3	0	0	0	0	111.5	F27 F28 W33 A34 Y35	F27-C31 VanDerWaalsContact CZ-SG 3.58Å; F27-C31 PolarHBondContact O-N 3.44Å; F27-C31 PolarHBondContact O-SG 3.49Å; F28-C31 PolarHBondContact O-N 3.33Å; C31-W33 VanDerWaalsContact C-N 3.32Å; C31-W33 PolarHBondContact O-N 2.92Å; C31-A34 PolarHBondContact O-N 2.94Å; C31-A34 VanDerWaalsContact O-N 3.13Å; C31-Y35 HydrophobicContact CB-CD2 4.31Å; C31-Y35 HydrophobicContact CB-CE2 4.36Å; C31-Y35 WeakPolarHBondContact O-CD2 3.39Å; C31-Y35 PolarHBondContact O-N 3.39Å
32	L	94.6	Very high	94.6	Very high	116 Å²	116	85.5 Å²	85.5	61%	0.607	43%	0.426	S	S	*	.	H	α-helix	trans	-55.6	-50.9	176.4	-172.4	105.5	0	0	0	110.1	F28 L29 A34 V36	F28-L32 VanDerWaalsContact O-CB 3.31Å; F28-L32 WeakPolarHBondContact O-CB 3.41Å; F28-L32 PolarHBondContact O-N 3.3Å; L29-L32 PolarHBondContact O-N 2.84Å; L32-A34 PolarHBondContact O-N 3.04Å; L32-V36 HydrophobicContact CG-CG2 4.22Å; L32-V36 VanDerWaalsContact O-CB 3.29Å; L32-V36 WeakPolarHBondContact O-CB 3.34Å; L32-V36 WeakPolarHBondContact O-CG2 3.42Å; L32-V36 PolarHBondContact O-N 3.46Å
33	W	92.4	Very high	94.4	Very high	26 Å²	26	88 Å²	88	10%	0.098	44%	0.437	C	S	.	.	H	α-helix	trans	-59.9	-46.8	174.6	167.5	72.4	0	0	0	111.7	L29 Y30 C31 Y35 W49 P50 K52 W54 A55	L29-W33 WeakPolarHBondContact O-CB 3.3Å; L29-W33 PolarHBondContact O-N 3.49Å; Y30-W33 HydrophobicContact CD2-CE3 4.21Å; Y30-W33 HydrophobicContact CD2-CZ3 4.3Å; Y30-W33 HydrophobicContact CE2-CE3 4.33Å; Y30-W33 AromaticContact CE2-CZ3 3.98Å; Y30-W33 HydrophobicContact CE2-CZ3 3.98Å; Y30-W33 PolarHBondContact O-N 3.24Å; C31-W33 VanDerWaalsContact C-N 3.32Å; C31-W33 PolarHBondContact O-N 2.92Å; W33-Y35 VanDerWaalsContact C-N 3.34Å; W33-Y35 PolarHBondContact O-N 2.86Å; W33-W49 HydrophobicContact CB-CZ3 4.1Å; W33-W49 AromaticContact CD1-CE3 3.08Å; W33-W49 AromaticContact CD1-CZ3 3.24Å; W33-W49 AromaticContact CG-CE3 3.96Å; W33-W49 HydrophobicContact CG-CE3 3.96Å; W33-W49 AromaticContact CG-CZ3 3.74Å; W33-W49 HydrophobicContact CG-CZ3 3.74Å; W33-W49 AromaticContact NE1-CE3 3.31Å; W33-W49 VanDerWaalsContact NE1-CE3 3.31Å; W33-W49 AromaticContact NE1-CZ3 3.92Å; W33-P50 HydrophobicContact CZ2-CB 4.35Å; W33-P50 HydrophobicContact CZ2-CG 3.92Å; W33-P50 WeakPolarHBondContact CZ2-O 3.36Å; W33-K52 HydrophobicContact CZ2-CD 4.29Å; W33-K52 PolarHBondContact O-NZ 3.21Å; W33-W54 HydrophobicContact CH2-CB 4.16Å; W33-A55 HydrophobicContact CH2-CB 4.06Å; W33-A55 HydrophobicContact CZ3-CB 3.67Å
34	A	94.1	Very high	94.2	Very high	28 Å²	28	90.6 Å²	90.6	23%	0.231	45%	0.45	C	S	.	.	H	α-helix	trans	-61.4	-39.7	-175.7	0	0	0	0	0	113	Y30 C31 L32 A55	Y30-A34 VanDerWaalsContact O-CB 3.3Å; Y30-A34 WeakPolarHBondContact O-CB 3.07Å; Y30-A34 PolarHBondContact O-N 3.38Å; C31-A34 PolarHBondContact O-N 2.94Å; C31-A34 VanDerWaalsContact O-N 3.13Å; L32-A34 PolarHBondContact O-N 3.04Å; A34-A55 HydrophobicContact CB-CB 3.9Å
35	Y	93.9	Very high	93.9	Very high	195 Å²	195	89.3 Å²	89.3	77%	0.765	46%	0.458	S	S	*	.	H	α-helix	trans	-92.7	-20.7	-175.1	-67.8	-68.7	0	0	0	114.7	C31 W33 P37	C31-Y35 HydrophobicContact CB-CD2 4.31Å; C31-Y35 HydrophobicContact CB-CE2 4.36Å; C31-Y35 WeakPolarHBondContact O-CD2 3.39Å; C31-Y35 PolarHBondContact O-N 3.39Å; W33-Y35 VanDerWaalsContact C-N 3.34Å; W33-Y35 PolarHBondContact O-N 2.86Å; Y35-P37 WeakPolarHBondContact O-CD 3.29Å
36	V	93.8	Very high	93.5	Very high	38 Å²	38	86.1 Å²	86.1	23%	0.23	45%	0.447	C	S	.	.	S	Bend	trans	-70.5	126	177.4	169.2	0	0	0	0	110.2	L32 W40 L41 K52	L32-V36 HydrophobicContact CG-CG2 4.22Å; L32-V36 VanDerWaalsContact O-CB 3.29Å; L32-V36 WeakPolarHBondContact O-CB 3.34Å; L32-V36 WeakPolarHBondContact O-CG2 3.42Å; L32-V36 PolarHBondContact O-N 3.46Å; V36-W40 HydrophobicContact CG1-CB 4.14Å; V36-L41 HydrophobicContact CG1-CD1 4.09Å; V36-L41 HydrophobicContact CG1-CG 3.97Å; V36-K52 WeakPolarHBondContact O-CE 3.28Å; V36-K52 PolarHBondContact O-NZ 2.85Å
37	P	92.7	Very high	93.2	Very high	62 Å²	62	88 Å²	88	40%	0.403	45%	0.451	S	S	.	.			trans	-59.8	146.9	177.5	-23.4	33.5	0	0	0	112.9	Y35 E39 W40 L41	Y35-P37 WeakPolarHBondContact O-CD 3.29Å; P37-E39 VanDerWaalsContact C-N 3.27Å; P37-E39 PolarHBondContact O-N 3.45Å; P37-W40 PolarHBondContact O-N 3.3Å; P37-L41 PolarHBondContact O-N 3.44Å
38	E	91.2	Very high	92.7	Very high	94 Å²	94	93.1 Å²	93.1	44%	0.439	47%	0.469	S	S	.	.	H	α-helix	trans	-62	-34.2	178.5	-69.1	-178.3	178.9	0	0	112.5	W40 L41 H42 K52	E38-W40 VanDerWaalsContact C-N 3.25Å; E38-W40 PolarHBondContact O-N 3.36Å; E38-L41 WeakPolarHBondContact O-CB 3.14Å; E38-L41 PolarHBondContact O-N 2.92Å; E38-L41 VanDerWaalsContact O-N 3.1Å; E38-H42 WeakPolarHBondContact O-CB 3.31Å; E38-H42 PolarHBondContact O-CD2 3.36Å; E38-H42 VanDerWaalsContact O-CG 3.26Å; E38-H42 PolarHBondContact O-N 2.88Å; E38-K52 HydrophobicContact CG-CG 4.26Å; E38-K52 WeakPolarHBondContact OE1-CG 3.48Å
39	E	91.9	Very high	92.1	Very high	157 Å²	157	92.9 Å²	92.9	73%	0.734	46%	0.464	S	S	*	.	H	α-helix	trans	-58.3	-38.1	177.3	-61.4	-176.6	-175.8	0	0	112.6	P37 H42 S43	P37-E39 VanDerWaalsContact C-N 3.27Å; P37-E39 PolarHBondContact O-N 3.45Å; E39-H42 PolarHBondContact O-N 2.97Å; E39-S43 PolarHBondContact O-N 3.47Å
40	W	93.4	Very high	91.8	Very high	171 Å²	171	92.2 Å²	92.2	65%	0.648	47%	0.465	S	S	*	.	H	α-helix	trans	-73.3	-35.6	178	-68.7	17.7	0	0	0	111.4	V36 P37 E38 S43 V44	V36-W40 HydrophobicContact CG1-CB 4.14Å; P37-W40 PolarHBondContact O-N 3.3Å; E38-W40 VanDerWaalsContact C-N 3.25Å; E38-W40 PolarHBondContact O-N 3.36Å; W40-S43 PolarHBondContact O-OG 3.42Å; W40-V44 WeakPolarHBondContact O-CG2 3.29Å; W40-V44 PolarHBondContact O-N 3.03Å
41	L	91.3	Very high	91.7	Very high	22 Å²	22	95.6 Å²	95.6	12%	0.115	48%	0.483	C	S	.	.	H	α-helix	trans	-64.9	-43.7	172.8	-75.6	150.4	0	0	0	110.4	V36 P37 E38 S43 V44 G45 L46	V36-L41 HydrophobicContact CG1-CD1 4.09Å; V36-L41 HydrophobicContact CG1-CG 3.97Å; P37-L41 PolarHBondContact O-N 3.44Å; E38-L41 WeakPolarHBondContact O-CB 3.14Å; E38-L41 PolarHBondContact O-N 2.92Å; E38-L41 VanDerWaalsContact O-N 3.1Å; L41-S43 VanDerWaalsContact C-N 3.35Å; L41-S43 PolarHBondContact O-N 3.42Å; L41-V44 PolarHBondContact O-N 2.99Å; L41-G45 PolarHBondContact O-N 3.49Å; L41-L46 HydrophobicContact CB-CB 4.28Å; L41-L46 HydrophobicContact CD2-CB 4.22Å; L41-L46 HydrophobicContact CD2-CD1 3.79Å; L41-L46 WeakPolarHBondContact O-CB 3.48Å; L41-L46 PolarHBondContact O-N 3.19Å
42	H	91.6	Very high	91.6	Very high	96 Å²	96	96.5 Å²	96.5	44%	0.444	48%	0.484	S	S	.	.	H	α-helix	trans	-64	-37.1	178.6	-69.6	-178	0	0	0	112.5	E38 E39 V44 G45 L46	E38-H42 WeakPolarHBondContact O-CB 3.31Å; E38-H42 PolarHBondContact O-CD2 3.36Å; E38-H42 VanDerWaalsContact O-CG 3.26Å; E38-H42 PolarHBondContact O-N 2.88Å; E39-H42 PolarHBondContact O-N 2.97Å; H42-V44 VanDerWaalsContact C-N 3.25Å; H42-V44 PolarHBondContact O-N 3.36Å; H42-G45 PolarHBondContact O-N 2.89Å; H42-L46 PolarHBondContact CD2-O 3.48Å
43	S	93.6	Very high	91.6	Very high	97 Å²	97	97.8 Å²	97.8	68%	0.678	48%	0.482	S	S	*	.	H	α-helix	trans	-66	-28	177.9	73.5	0	0	0	0	113.3	E39 W40 L41 G45	E39-S43 PolarHBondContact O-N 3.47Å; W40-S43 PolarHBondContact O-OG 3.42Å; L41-S43 VanDerWaalsContact C-N 3.35Å; L41-S43 PolarHBondContact O-N 3.42Å; S43-G45 VanDerWaalsContact C-N 3.27Å
44	V	92.9	Very high	91.7	Very high	114 Å²	114	101.7 Å²	101.7	69%	0.691	50%	0.496	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87	2.5	174.6	-174.2	0	0	0	0	111.7	W40 L41 H42	W40-V44 WeakPolarHBondContact O-CG2 3.29Å; W40-V44 PolarHBondContact O-N 3.03Å; L41-V44 PolarHBondContact O-N 2.99Å; H42-V44 VanDerWaalsContact C-N 3.25Å; H42-V44 PolarHBondContact O-N 3.36Å
45	G	92.2	Very high	91.7	Very high	53 Å²	53	101.6 Å²	101.6	55%	0.546	50%	0.495	S	S	.	.	T	Hydrogen-bonded Turn	trans	85.5	11.6	178.5	0	0	0	0	0	114.6	L41 H42 S43 T47	L41-G45 PolarHBondContact O-N 3.49Å; H42-G45 PolarHBondContact O-N 2.89Å; S43-G45 VanDerWaalsContact C-N 3.27Å; G45-T47 PolarHBondContact O-N 3.06Å
46	L	89.6	Confident	91.8	Very high	71 Å²	71	97.5 Å²	97.5	37%	0.372	49%	0.486	S	S	.	.			trans	-92.1	80.4	179.5	-65.3	177.1	0	0	0	110.9	L41 H42 W49	L41-L46 HydrophobicContact CB-CB 4.28Å; L41-L46 HydrophobicContact CD2-CB 4.22Å; L41-L46 HydrophobicContact CD2-CD1 3.79Å; L41-L46 WeakPolarHBondContact O-CB 3.48Å; L41-L46 PolarHBondContact O-N 3.19Å; H42-L46 PolarHBondContact CD2-O 3.48Å; L46-W49 HydrophobicContact CD1-CZ2 4.08Å
47	T	88.8	Confident	91.9	Very high	76 Å²	76	95.8 Å²	95.8	47%	0.466	48%	0.476	S	S	.	.			trans	-97.9	-15.3	-173.7	52.2	0	0	0	0	115.3	G45	G45-T47 PolarHBondContact O-N 3.06Å
48	Y	85.4	Confident	92	Very high	224 Å²	224	98.3 Å²	98.3	88%	0.878	48%	0.484	S	S	*	.			trans	-112.5	50.2	-175.5	-62.7	-79.2	0	0	0	112.9
49	W	86.1	Confident	92.2	Very high	127 Å²	127	96.4 Å²	96.4	48%	0.481	48%	0.48	S	S	.	.	P	Polyproline II helix	trans	-93.3	155.7	175.8	-83.5	62.6	0	0	0	111.8	W33 L46	W33-W49 HydrophobicContact CB-CZ3 4.1Å; W33-W49 AromaticContact CD1-CE3 3.08Å; W33-W49 AromaticContact CD1-CZ3 3.24Å; W33-W49 AromaticContact CG-CE3 3.96Å; W33-W49 HydrophobicContact CG-CE3 3.96Å; W33-W49 AromaticContact CG-CZ3 3.74Å; W33-W49 HydrophobicContact CG-CZ3 3.74Å; W33-W49 AromaticContact NE1-CE3 3.31Å; W33-W49 VanDerWaalsContact NE1-CE3 3.31Å; W33-W49 AromaticContact NE1-CZ3 3.92Å; L46-W49 HydrophobicContact CD1-CZ2 4.08Å
50	P	89.3	Confident	92.5	Very high	74 Å²	74	93.1 Å²	93.1	48%	0.481	47%	0.466	S	S	.	.	P	Polyproline II helix	trans	-56.7	146.3	171.8	22.4	-31.6	0	0	0	110.6	W33	W33-P50 HydrophobicContact CZ2-CB 4.35Å; W33-P50 HydrophobicContact CZ2-CG 3.92Å; W33-P50 WeakPolarHBondContact CZ2-O 3.36Å
51	Q	91.5	Very high	92.6	Very high	138 Å²	138	91.4 Å²	91.4	65%	0.645	46%	0.461	S	S	*	.	P	Polyproline II helix	trans	-59.8	141.5	177.8	-66.6	177.2	-29.6	0	0	111	Y53 W54	Q51-Y53 PolarHBondContact O-N 3.36Å; Q51-W54 WeakPolarHBondContact O-CB 3.35Å; Q51-W54 PolarHBondContact O-N 2.87Å
52	K	92.7	Very high	92.9	Very high	48 Å²	48	95.6 Å²	95.6	21%	0.209	48%	0.482	C	S	.	.	T	Hydrogen-bonded Turn	trans	-57.8	-22	178.9	-61.9	-66.1	-172.3	-178.3	0	114.2	W33 V36 E38 W54 A55	W33-K52 HydrophobicContact CZ2-CD 4.29Å; W33-K52 PolarHBondContact O-NZ 3.21Å; V36-K52 WeakPolarHBondContact O-CE 3.28Å; V36-K52 PolarHBondContact O-NZ 2.85Å; E38-K52 HydrophobicContact CG-CG 4.26Å; E38-K52 WeakPolarHBondContact OE1-CG 3.48Å; K52-W54 PolarHBondContact O-N 3.37Å; K52-W54 VanDerWaalsContact O-N 3.12Å; K52-A55 WeakPolarHBondContact O-CB 3.3Å; K52-A55 PolarHBondContact O-N 2.87Å
53	Y	94.1	Very high	93.2	Very high	142 Å²	142	96.4 Å²	96.4	56%	0.557	49%	0.489	S	S	*	.	T	Hydrogen-bonded Turn	trans	-49.8	-35.5	170.9	169.9	-101.7	0	0	0	112.7	Q51 A55 L56 A57	Q51-Y53 PolarHBondContact O-N 3.36Å; Y53-A55 PolarHBondContact O-N 3.07Å; Y53-L56 PolarHBondContact O-N 3.27Å; Y53-A57 HydrophobicContact CD1-CB 4.02Å; Y53-A57 HydrophobicContact CE1-CB 3.49Å; Y53-A57 VanDerWaalsContact CE1-CB 3.49Å; Y53-A57 PolarHBondContact O-N 2.88Å
54	W	94.5	Very high	93.4	Very high	109 Å²	109	95.6 Å²	95.6	41%	0.413	48%	0.48	S	S	.	.	H	α-helix	trans	-64.3	-21.7	178.2	-73.2	101.9	0	0	0	113.7	W33 Q51 K52 L56 A57 M58 Y61	W33-W54 HydrophobicContact CH2-CB 4.16Å; Q51-W54 WeakPolarHBondContact O-CB 3.35Å; Q51-W54 PolarHBondContact O-N 2.87Å; K52-W54 PolarHBondContact O-N 3.37Å; K52-W54 VanDerWaalsContact O-N 3.12Å; W54-L56 PolarHBondContact O-N 3.49Å; W54-A57 HydrophobicContact CE3-CB 4.07Å; W54-A57 PolarHBondContact O-N 2.96Å; W54-M58 HydrophobicContact CE3-CG 4.08Å; W54-M58 HydrophobicContact CE3-SD 4.47Å; W54-M58 VanDerWaalsContact O-CB 3.29Å; W54-M58 WeakPolarHBondContact O-CB 3.42Å; W54-M58 WeakPolarHBondContact O-CG 3.45Å; W54-M58 PolarHBondContact O-N 3.24Å; W54-Y61 HydrophobicContact CZ3-CD2 4.46Å; W54-Y61 HydrophobicContact CZ3-CE2 4.32Å
55	A	94.9	Very high	93.7	Very high	25 Å²	25	92.9 Å²	92.9	21%	0.207	47%	0.47	C	S	.	.	H	α-helix	trans	-66.1	-20.3	172.6	0	0	0	0	0	113	Y30 W33 A34 K52 Y53	Y30-A55 WeakPolarHBondContact OH-CA 3.31Å; Y30-A55 PolarHBondContact OH-O 3.41Å; W33-A55 HydrophobicContact CH2-CB 4.06Å; W33-A55 HydrophobicContact CZ3-CB 3.67Å; A34-A55 HydrophobicContact CB-CB 3.9Å; K52-A55 WeakPolarHBondContact O-CB 3.3Å; K52-A55 PolarHBondContact O-N 2.87Å; Y53-A55 PolarHBondContact O-N 3.07Å
56	L	95.6	Very high	94	Very high	110 Å²	110	94.7 Å²	94.7	58%	0.576	47%	0.467	S	S	*	.	H	α-helix	trans	-100	-41.9	172.5	-177.8	64.4	0	0	0	111.1	Y53 W54 P59 I60	Y53-L56 PolarHBondContact O-N 3.27Å; W54-L56 PolarHBondContact O-N 3.49Å; L56-P59 WeakPolarHBondContact O-CD 3.4Å; L56-I60 HydrophobicContact CD1-CD1 4.03Å; L56-I60 HydrophobicContact CG-CD1 3.82Å; L56-I60 WeakPolarHBondContact O-CG1 3.24Å; L56-I60 PolarHBondContact O-N 3.39Å
57	A	96.5	Very high	94.4	Very high	2 Å²	2	97.1 Å²	97.1	2%	0.017	48%	0.477	C	S	.	.	H	α-helix	trans	-65.3	-42.8	-175.4	0	0	0	0	0	112.6	Y53 W54 I60 Y61	Y53-A57 HydrophobicContact CD1-CB 4.02Å; Y53-A57 HydrophobicContact CE1-CB 3.49Å; Y53-A57 VanDerWaalsContact CE1-CB 3.49Å; Y53-A57 PolarHBondContact O-N 2.88Å; W54-A57 HydrophobicContact CE3-CB 4.07Å; W54-A57 PolarHBondContact O-N 2.96Å; A57-I60 PolarHBondContact O-N 2.8Å; A57-Y61 HydrophobicContact CB-CD2 4.09Å; A57-Y61 HydrophobicContact CB-CE2 3.98Å; A57-Y61 WeakPolarHBondContact O-CD2 3.46Å; A57-Y61 PolarHBondContact O-N 3.36Å
58	M	94.7	Very high	94.8	Very high	115 Å²	115	97.5 Å²	97.5	57%	0.567	48%	0.479	S	S	*	.	H	α-helix	trans	-57.1	-52.1	-178.7	-78.2	-77.8	-83.9	0	0	112.6	W54 I60 Y61 L62	W54-M58 HydrophobicContact CE3-CG 4.08Å; W54-M58 HydrophobicContact CE3-SD 4.47Å; W54-M58 VanDerWaalsContact O-CB 3.29Å; W54-M58 WeakPolarHBondContact O-CB 3.42Å; W54-M58 WeakPolarHBondContact O-CG 3.45Å; W54-M58 PolarHBondContact O-N 3.24Å; M58-I60 VanDerWaalsContact C-N 3.32Å; M58-I60 PolarHBondContact O-N 3.48Å; M58-Y61 PolarHBondContact O-N 2.99Å; M58-L62 WeakPolarHBondContact O-CB 3.08Å; M58-L62 PolarHBondContact O-N 2.9Å
59	P	95.4	Very high	95.4	Very high	54 Å²	54	89.8 Å²	89.8	35%	0.351	46%	0.458	S	S	.	.	H	α-helix	trans	-57.2	-40.9	174.7	-26.2	32	0	0	0	113.9	Y30 L56 L62 L63	Y30-P59 WeakPolarHBondContact OH-CD 3.47Å; Y30-P59 WeakPolarHBondContact OH-CG 3.46Å; L56-P59 WeakPolarHBondContact O-CD 3.4Å; P59-L62 PolarHBondContact O-N 3.19Å; P59-L63 WeakPolarHBondContact O-CG 3.24Å; P59-L63 PolarHBondContact O-N 2.99Å
60	I	97.6	Very high	96	Very high	87 Å²	87	87.8 Å²	87.8	45%	0.446	46%	0.456	S	S	.	.	H	α-helix	trans	-66.4	-47.1	-180	-65.2	171.2	0	0	0	110.5	L56 A57 M58 L62 L63 V64	L56-I60 HydrophobicContact CD1-CD1 4.03Å; L56-I60 HydrophobicContact CG-CD1 3.82Å; L56-I60 WeakPolarHBondContact O-CG1 3.24Å; L56-I60 PolarHBondContact O-N 3.39Å; A57-I60 PolarHBondContact O-N 2.8Å; M58-I60 VanDerWaalsContact C-N 3.32Å; M58-I60 PolarHBondContact O-N 3.48Å; I60-L62 VanDerWaalsContact C-N 3.29Å; I60-L62 PolarHBondContact O-N 2.98Å; I60-L63 PolarHBondContact O-N 2.89Å; I60-V64 HydrophobicContact CG2-CG2 4.49Å; I60-V64 WeakPolarHBondContact O-CG2 3.04Å; I60-V64 PolarHBondContact O-N 3.44Å
61	Y	97.3	Very high	96.4	Very high	136 Å²	136	89 Å²	89	53%	0.533	46%	0.463	S	S	.	.	H	α-helix	trans	-61.9	-37.1	176.6	-78.1	-61.1	0	0	0	112.2	W54 A57 M58 V64 A65	W54-Y61 HydrophobicContact CZ3-CD2 4.46Å; W54-Y61 HydrophobicContact CZ3-CE2 4.32Å; A57-Y61 HydrophobicContact CB-CD2 4.09Å; A57-Y61 HydrophobicContact CB-CE2 3.98Å; A57-Y61 WeakPolarHBondContact O-CD2 3.46Å; A57-Y61 PolarHBondContact O-N 3.36Å; M58-Y61 PolarHBondContact O-N 2.99Å; Y61-V64 PolarHBondContact O-N 3.24Å; Y61-A65 VanDerWaalsContact O-CB 3.28Å; Y61-A65 WeakPolarHBondContact O-CB 3.35Å; Y61-A65 PolarHBondContact O-N 3.28Å
62	L	96.5	Very high	96.7	Very high	109 Å²	109	86.2 Å²	86.2	57%	0.571	45%	0.454	S	S	*	.	H	α-helix	trans	-60.8	-47.1	173.9	-179	66	0	0	0	111.2	M58 P59 I60 V64 A65 L66	M58-L62 WeakPolarHBondContact O-CB 3.08Å; M58-L62 PolarHBondContact O-N 2.9Å; P59-L62 PolarHBondContact O-N 3.19Å; I60-L62 VanDerWaalsContact C-N 3.29Å; I60-L62 PolarHBondContact O-N 2.98Å; L62-V64 PolarHBondContact O-N 2.65Å; L62-A65 PolarHBondContact O-N 2.97Å; L62-L66 HydrophobicContact CG-CD1 4.32Å; L62-L66 VanDerWaalsContact O-CG 3.3Å; L62-L66 WeakPolarHBondContact O-CG 3.33Å; L62-L66 PolarHBondContact O-N 3.13Å
63	L	98.1	Very high	97	Very high	113 Å²	113	88.1 Å²	88.1	59%	0.592	47%	0.466	S	S	*	.	H	α-helix	trans	-61.6	-44.1	176.9	-70.6	174.4	0	0	0	111.8	P59 I60 A65 L66 M67	P59-L63 WeakPolarHBondContact O-CG 3.24Å; P59-L63 PolarHBondContact O-N 2.99Å; I60-L63 PolarHBondContact O-N 2.89Å; L63-A65 PolarHBondContact O-N 3.42Å; L63-L66 PolarHBondContact O-N 3.48Å; L63-M67 WeakPolarHBondContact O-CG 3.4Å; L63-M67 PolarHBondContact O-N 3.45Å
64	V	98.3	Very high	97.1	Very high	80 Å²	80	88.2 Å²	88.2	49%	0.485	47%	0.47	S	S	.	.	H	α-helix	trans	-61.7	-44.8	176.3	173.3	0	0	0	0	110.8	I60 Y61 L62 L66 M67 V68	I60-V64 HydrophobicContact CG2-CG2 4.49Å; I60-V64 WeakPolarHBondContact O-CG2 3.04Å; I60-V64 PolarHBondContact O-N 3.44Å; Y61-V64 PolarHBondContact O-N 3.24Å; L62-V64 PolarHBondContact O-N 2.65Å; V64-L66 VanDerWaalsContact C-N 3.34Å; V64-L66 PolarHBondContact O-N 2.86Å; V64-M67 PolarHBondContact O-N 3.39Å; V64-V68 HydrophobicContact CG1-CG2 4.3Å; V64-V68 WeakPolarHBondContact O-CB 3.44Å; V64-V68 VanDerWaalsContact O-CG2 3.29Å; V64-V68 WeakPolarHBondContact O-CG2 3.49Å; V64-V68 PolarHBondContact O-N 2.92Å
65	A	98.2	Very high	97.1	Very high	57 Å²	57	85 Å²	85	47%	0.471	47%	0.47	S	S	.	.	H	α-helix	trans	-62.4	-39.9	178.1	0	0	0	0	0	112.2	Y61 L62 L63 V68 S69	Y61-A65 VanDerWaalsContact O-CB 3.28Å; Y61-A65 WeakPolarHBondContact O-CB 3.35Å; Y61-A65 PolarHBondContact O-N 3.28Å; L62-A65 PolarHBondContact O-N 2.97Å; L63-A65 PolarHBondContact O-N 3.42Å; A65-V68 PolarHBondContact O-N 2.97Å; A65-S69 WeakPolarHBondContact O-CB 3.4Å; A65-S69 PolarHBondContact O-N 2.9Å; A65-S69 PolarHBondContact O-OG 2.91Å
66	L	98.1	Very high	97.2	Very high	92 Å²	92	87.8 Å²	87.8	48%	0.482	48%	0.481	S	S	.	.	H	α-helix	trans	-64.8	-42.2	174.1	-71	173.7	0	0	0	112	L62 L63 V64 S69 L70	L62-L66 HydrophobicContact CG-CD1 4.32Å; L62-L66 VanDerWaalsContact O-CG 3.3Å; L62-L66 WeakPolarHBondContact O-CG 3.33Å; L62-L66 PolarHBondContact O-N 3.13Å; L63-L66 PolarHBondContact O-N 3.48Å; V64-L66 VanDerWaalsContact C-N 3.34Å; V64-L66 PolarHBondContact O-N 2.86Å; L66-S69 PolarHBondContact O-N 2.92Å; L66-S69 PolarHBondContact O-OG 3.4Å; L66-L70 WeakPolarHBondContact O-CG 3.16Å; L66-L70 PolarHBondContact O-N 3.04Å
67	M	98.3	Very high	97.2	Very high	122 Å²	122	86.2 Å²	86.2	60%	0.601	47%	0.473	S	S	*	.	H	α-helix	trans	-64.6	-44.4	176.5	-70.6	-58.7	-63.2	0	0	111.6	L63 V64 S69 L70 V71	L63-M67 WeakPolarHBondContact O-CG 3.4Å; L63-M67 PolarHBondContact O-N 3.45Å; V64-M67 PolarHBondContact O-N 3.39Å; M67-S69 VanDerWaalsContact C-N 3.35Å; M67-L70 PolarHBondContact O-N 2.75Å; M67-V71 WeakPolarHBondContact O-CG2 3.34Å; M67-V71 PolarHBondContact O-N 2.92Å
68	V	98.4	Very high	97	Very high	84 Å²	84	92.4 Å²	92.4	51%	0.509	50%	0.503	S	S	.	.	H	α-helix	trans	-62.6	-42.8	176.7	171.2	0	0	0	0	110.8	V64 A65 L70 V71 V72	V64-V68 HydrophobicContact CG1-CG2 4.3Å; V64-V68 WeakPolarHBondContact O-CB 3.44Å; V64-V68 VanDerWaalsContact O-CG2 3.29Å; V64-V68 WeakPolarHBondContact O-CG2 3.49Å; V64-V68 PolarHBondContact O-N 2.92Å; A65-V68 PolarHBondContact O-N 2.97Å; V68-L70 VanDerWaalsContact C-N 3.33Å; V68-L70 PolarHBondContact O-N 3.4Å; V68-V71 PolarHBondContact O-N 3.29Å; V68-V72 HydrophobicContact CG1-CG2 4.26Å; V68-V72 WeakPolarHBondContact O-CB 3.35Å; V68-V72 VanDerWaalsContact O-CG2 3.31Å; V68-V72 WeakPolarHBondContact O-CG2 3.21Å; V68-V72 PolarHBondContact O-N 3.47Å
69	S	98.2	Very high	97	Very high	62 Å²	62	93.3 Å²	93.3	43%	0.434	51%	0.51	S	S	.	.	H	α-helix	trans	-63.5	-38.5	179.2	72.5	0	0	0	0	112.2	A65 L66 M67 V72 L73	A65-S69 WeakPolarHBondContact O-CB 3.4Å; A65-S69 PolarHBondContact O-N 2.9Å; A65-S69 PolarHBondContact O-OG 2.91Å; L66-S69 PolarHBondContact O-N 2.92Å; L66-S69 PolarHBondContact O-OG 3.4Å; M67-S69 VanDerWaalsContact C-N 3.35Å; S69-V72 PolarHBondContact O-N 3.47Å; S69-L73 VanDerWaalsContact O-CB 3.24Å; S69-L73 WeakPolarHBondContact O-CB 3.33Å; S69-L73 PolarHBondContact O-N 2.87Å
70	L	97.9	Very high	97	Very high	84 Å²	84	96.5 Å²	96.5	44%	0.44	52%	0.524	S	S	.	.	H	α-helix	trans	-63.1	-47.7	173.3	-70.7	176.3	0	0	0	111.7	L66 M67 V68 V72 L73 F74	L66-L70 WeakPolarHBondContact O-CG 3.16Å; L66-L70 PolarHBondContact O-N 3.04Å; M67-L70 PolarHBondContact O-N 2.75Å; V68-L70 VanDerWaalsContact C-N 3.33Å; V68-L70 PolarHBondContact O-N 3.4Å; L70-V72 VanDerWaalsContact C-N 3.32Å; L70-V72 PolarHBondContact O-N 3.2Å; L70-L73 WeakPolarHBondContact O-CB 3.45Å; L70-L73 PolarHBondContact O-N 2.91Å; L70-F74 WeakPolarHBondContact O-CD2 3.32Å; L70-F74 PolarHBondContact O-N 3.42Å
71	V	98.3	Very high	96.7	Very high	101 Å²	101	96 Å²	96	61%	0.612	53%	0.526	S	S	*	.	H	α-helix	trans	-59.4	-44.9	178	171.6	0	0	0	0	111.1	M67 V68 F74 G75	M67-V71 WeakPolarHBondContact O-CG2 3.34Å; M67-V71 PolarHBondContact O-N 2.92Å; V68-V71 PolarHBondContact O-N 3.29Å; V71-F74 PolarHBondContact O-N 3.39Å; V71-G75 PolarHBondContact O-N 3.41Å
72	V	98.3	Very high	96.5	Very high	78 Å²	78	91 Å²	91	47%	0.473	51%	0.513	S	S	.	.	H	α-helix	trans	-63.5	-43.3	176.9	170.6	0	0	0	0	110.9	V68 S69 L70 F74 G75 I76	V68-V72 HydrophobicContact CG1-CG2 4.26Å; V68-V72 WeakPolarHBondContact O-CB 3.35Å; V68-V72 VanDerWaalsContact O-CG2 3.31Å; V68-V72 WeakPolarHBondContact O-CG2 3.21Å; V68-V72 PolarHBondContact O-N 3.47Å; S69-V72 PolarHBondContact O-N 3.47Å; L70-V72 VanDerWaalsContact C-N 3.32Å; L70-V72 PolarHBondContact O-N 3.2Å; V72-F74 PolarHBondContact O-N 3.17Å; V72-G75 PolarHBondContact O-N 3.3Å; V72-I76 HydrophobicContact CG1-CD1 3.72Å; V72-I76 HydrophobicContact CG1-CG1 4.32Å; V72-I76 WeakPolarHBondContact O-CG1 3.29Å; V72-I76 PolarHBondContact O-N 3.28Å
73	L	97.6	Very high	96.3	Very high	88 Å²	88	90 Å²	90	46%	0.461	51%	0.513	S	S	.	.	H	α-helix	trans	-59.8	-45.1	176.6	179.8	64.9	0	0	0	111.4	S69 L70 G75 I76 N77	S69-L73 VanDerWaalsContact O-CB 3.24Å; S69-L73 WeakPolarHBondContact O-CB 3.33Å; S69-L73 PolarHBondContact O-N 2.87Å; L70-L73 WeakPolarHBondContact O-CB 3.45Å; L70-L73 PolarHBondContact O-N 2.91Å; L73-G75 VanDerWaalsContact C-N 3.35Å; L73-G75 PolarHBondContact O-N 2.89Å; L73-I76 PolarHBondContact O-N 3.05Å; L73-N77 WeakPolarHBondContact O-CB 3.5Å; L73-N77 VanDerWaalsContact O-CG 3.24Å; L73-N77 PolarHBondContact O-N 2.9Å; L73-N77 PolarHBondContact O-ND2 3.45Å
74	F	96.1	Very high	95.9	Very high	145 Å²	145	92.2 Å²	92.2	64%	0.636	52%	0.524	S	S	*	.	H	α-helix	trans	-60.4	-43.9	174.2	-79.7	-66.1	0	0	0	111.9	L70 V71 V72 N77 M78	L70-F74 WeakPolarHBondContact O-CD2 3.32Å; L70-F74 PolarHBondContact O-N 3.42Å; V71-F74 PolarHBondContact O-N 3.39Å; V72-F74 PolarHBondContact O-N 3.17Å; F74-N77 PolarHBondContact O-N 3.44Å; F74-M78 WeakPolarHBondContact O-CB 3.34Å; F74-M78 PolarHBondContact O-N 2.75Å
75	G	95.9	Very high	95.5	Very high	40 Å²	40	95.5 Å²	95.5	41%	0.412	54%	0.539	S	S	.	.	H	α-helix	trans	-60.7	-45.2	176.8	0	0	0	0	0	112.7	V71 V72 L73 M78 N79	V71-G75 PolarHBondContact O-N 3.41Å; V72-G75 PolarHBondContact O-N 3.3Å; L73-G75 VanDerWaalsContact C-N 3.35Å; L73-G75 PolarHBondContact O-N 2.89Å; G75-M78 PolarHBondContact O-N 2.85Å; G75-N79 WeakPolarHBondContact O-CB 3.12Å; G75-N79 PolarHBondContact O-N 3.14Å
76	I	96.9	Very high	95.1	Very high	85 Å²	85	94.1 Å²	94.1	44%	0.436	53%	0.526	S	S	.	.	H	α-helix	trans	-64.4	-45.7	176.8	-68	169.2	0	0	0	110.8	V72 L73 M78 N79 N80	V72-I76 HydrophobicContact CG1-CD1 3.72Å; V72-I76 HydrophobicContact CG1-CG1 4.32Å; V72-I76 WeakPolarHBondContact O-CG1 3.29Å; V72-I76 PolarHBondContact O-N 3.28Å; L73-I76 PolarHBondContact O-N 3.05Å; I76-M78 VanDerWaalsContact C-N 3.32Å; I76-M78 PolarHBondContact O-N 3.32Å; I76-N79 PolarHBondContact O-N 2.76Å; I76-N80 WeakPolarHBondContact CG2-ND2 3.37Å; I76-N80 WeakPolarHBondContact O-CB 3.39Å; I76-N80 VanDerWaalsContact O-CG 3.3Å; I76-N80 PolarHBondContact O-N 3.4Å; I76-N80 PolarHBondContact O-ND2 3.25Å
77	N	95	Very high	94.6	Very high	77 Å²	77	94.2 Å²	94.2	41%	0.412	53%	0.53	S	S	.	.	H	α-helix	trans	-59.8	-44.5	177.9	-75.6	-24.8	0	0	0	111.1	L73 F74 N79 N80 T81	L73-N77 WeakPolarHBondContact O-CB 3.5Å; L73-N77 VanDerWaalsContact O-CG 3.24Å; L73-N77 PolarHBondContact O-N 2.9Å; L73-N77 PolarHBondContact O-ND2 3.45Å; F74-N77 PolarHBondContact O-N 3.44Å; N77-N79 VanDerWaalsContact C-N 3.32Å; N77-N79 PolarHBondContact O-N 2.99Å; N77-N80 PolarHBondContact O-N 3.15Å; N77-T81 VanDerWaalsContact O-CB 3.29Å; N77-T81 WeakPolarHBondContact O-CB 3.13Å; N77-T81 PolarHBondContact O-N 3.3Å; N77-T81 PolarHBondContact O-OG1 3.4Å
78	M	92.4	Very high	94.3	Very high	131 Å²	131	93.4 Å²	93.4	65%	0.645	53%	0.528	S	S	*	.	H	α-helix	trans	-67.4	-33.9	179.2	-164.7	153.2	69.8	0	0	112.2	F74 G75 I76 N80	F74-M78 WeakPolarHBondContact O-CB 3.34Å; F74-M78 PolarHBondContact O-N 2.75Å; G75-M78 PolarHBondContact O-N 2.85Å; I76-M78 VanDerWaalsContact C-N 3.32Å; I76-M78 PolarHBondContact O-N 3.32Å; M78-N80 VanDerWaalsContact C-N 3.32Å
79	N	95.1	Very high	93.9	Very high	134 Å²	134	92.6 Å²	92.6	72%	0.717	52%	0.521	S	S	*	.	H	α-helix	trans	-69.8	-28.4	174.1	-174.3	67.9	0	0	0	113.2	G75 I76 N77	G75-N79 WeakPolarHBondContact O-CB 3.12Å; G75-N79 PolarHBondContact O-N 3.14Å; I76-N79 PolarHBondContact O-N 2.76Å; N77-N79 VanDerWaalsContact C-N 3.32Å; N77-N79 PolarHBondContact O-N 2.99Å
80	N	94.7	Very high	93.4	Very high	121 Å²	121	96.8 Å²	96.8	65%	0.647	54%	0.537	S	S	*	.	H	α-helix	trans	-95.2	-5.5	-179.1	-67.4	-19	0	0	0	113.6	I76 N77 M78	I76-N80 WeakPolarHBondContact CG2-ND2 3.37Å; I76-N80 WeakPolarHBondContact O-CB 3.39Å; I76-N80 VanDerWaalsContact O-CG 3.3Å; I76-N80 PolarHBondContact O-N 3.4Å; I76-N80 PolarHBondContact O-ND2 3.25Å; N77-N80 PolarHBondContact O-N 3.15Å; M78-N80 VanDerWaalsContact C-N 3.32Å
81	T	92.4	Very high	93	Very high	78 Å²	78	95.6 Å²	95.6	48%	0.479	53%	0.533	S	S	.	.	S	Bend	trans	-102	156.2	-179.4	-55.8	0	0	0	0	109.5	N77 N89	N77-T81 VanDerWaalsContact O-CB 3.29Å; N77-T81 WeakPolarHBondContact O-CB 3.13Å; N77-T81 PolarHBondContact O-N 3.3Å; N77-T81 PolarHBondContact O-OG1 3.4Å; T81-N89 WeakPolarHBondContact CG2-OD1 3.43Å
82	A	92.5	Very high	92.7	Very high	31 Å²	31	95.6 Å²	95.6	26%	0.256	53%	0.53	S	S	.	.	P	Polyproline II helix	trans	-59.9	156.6	174.3	0	0	0	0	0	111.1	D88	A82-D88 HydrophobicContact CB-CB 4.01Å
83	P	92.3	Very high	92.2	Very high	88 Å²	88	98.7 Å²	98.7	57%	0.571	55%	0.549	S	S	*	.	P	Polyproline II helix	trans	-48.6	145.8	171.9	-28.3	36.6	0	0	0	111.7	D85 S86 N89	P83-D85 WeakPolarHBondContact CB-OD1 3.37Å; P83-D85 PolarHBondContact O-N 3.49Å; P83-S86 WeakPolarHBondContact O-CB 3.49Å; P83-S86 PolarHBondContact O-N 3.12Å; P83-N89 PolarHBondContact O-ND2 3.22Å
84	L	88.9	Confident	91.7	Very high	159 Å²	159	103 Å²	103	83%	0.832	56%	0.564	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.3	-23	-172.4	-66.7	173.8	0	0	0	114.1
85	D	90.4	Very high	91.3	Very high	148 Å²	148	98.2 Å²	98.2	79%	0.791	55%	0.552	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91	-4.5	177.7	60.3	-27.5	0	0	0	113.7	P83	P83-D85 WeakPolarHBondContact CB-OD1 3.37Å; P83-D85 PolarHBondContact O-N 3.49Å
86	S	90.5	Very high	90.4	Very high	29 Å²	29	105.4 Å²	105.4	20%	0.203	58%	0.575	C	S	.	*			trans	-76	134.6	177.9	-172.3	0	0	0	0	111.8	P83 D88 N89	P83-S86 WeakPolarHBondContact O-CB 3.49Å; P83-S86 PolarHBondContact O-N 3.12Å; S86-D88 PolarHBondContact O-N 3.48Å; S86-D88 WeakPolarHBondContact OG-CB 3.42Å; S86-D88 PolarHBondContact OG-N 3.27Å; S86-D88 VanDerWaalsContact OG-N 3.14Å; S86-D88 PolarHBondContact OG-OD2 3.17Å; S86-N89 PolarHBondContact O-N 3.05Å; S86-N89 PolarHBondContact O-ND2 3.02Å
87	V	87.6	Confident	89.3	Confident	93 Å²	93	104.3 Å²	104.3	56%	0.564	58%	0.584	S	S	*	*	G	3₁₀ helix	trans	-61.7	-21.4	169	-64.2	0	0	0	0	112.3	N89 I90 T91	V87-N89 PolarHBondContact O-N 3Å; V87-I90 WeakPolarHBondContact O-CG1 3.18Å; V87-I90 PolarHBondContact O-N 2.98Å; V87-T91 HydrophobicContact CB-CG2 4.47Å; V87-T91 PolarHBondContact O-N 3.23Å; V87-T91 PolarHBondContact O-OG1 2.95Å
88	D	90.2	Very high	88	Confident	106 Å²	106	105.4 Å²	105.4	57%	0.567	59%	0.586	S	S	*	*	G	3₁₀ helix	trans	-60.6	-19	177.7	-57.5	-37.3	0	0	0	112.8	A82 S86 I90	A82-D88 HydrophobicContact CB-CB 4.01Å; S86-D88 PolarHBondContact O-N 3.48Å; S86-D88 WeakPolarHBondContact OG-CB 3.42Å; S86-D88 PolarHBondContact OG-N 3.27Å; S86-D88 VanDerWaalsContact OG-N 3.14Å; S86-D88 PolarHBondContact OG-OD2 3.17Å; D88-I90 PolarHBondContact O-N 3.15Å
89	N	90.6	Very high	86.7	Confident	66 Å²	66	109 Å²	109	35%	0.353	59%	0.593	S	S	.	*	G	3₁₀ helix	trans	-70.4	-18.3	173.5	-67.1	-66.1	0	0	0	113.6	T81 P83 S86 V87	T81-N89 WeakPolarHBondContact CG2-OD1 3.43Å; P83-N89 PolarHBondContact O-ND2 3.22Å; S86-N89 PolarHBondContact O-N 3.05Å; S86-N89 PolarHBondContact O-ND2 3.02Å; V87-N89 PolarHBondContact O-N 3Å
90	I	89	Confident	85.1	Confident	150 Å²	150	108.1 Å²	108.1	77%	0.769	60%	0.598	S	S	*	*	T	Hydrogen-bonded Turn	trans	-126	-7.6	-177.3	61.8	168.1	0	0	0	113.3	V87 D88	V87-I90 WeakPolarHBondContact O-CG1 3.18Å; V87-I90 PolarHBondContact O-N 2.98Å; D88-I90 PolarHBondContact O-N 3.15Å
91	T	88.9	Confident	83.5	Confident	59 Å²	59	107.5 Å²	107.5	36%	0.362	59%	0.594	S	S	.	*			trans	-113.8	145.5	178.2	60.4	0	0	0	0	111.6	V87 A95	V87-T91 HydrophobicContact CB-CG2 4.47Å; V87-T91 PolarHBondContact O-N 3.23Å; V87-T91 PolarHBondContact O-OG1 2.95Å; T91-A95 HydrophobicContact CG2-CB 4.12Å
92	D	90.8	Very high	81.8	Confident	101 Å²	101	109.9 Å²	109.9	54%	0.54	61%	0.613	S	S	.	*			trans	-120.1	-171.6	173.6	75.7	-8	0	0	0	111.7	F94 A95	D92-F94 PolarHBondContact O-N 2.98Å; D92-F94 WeakPolarHBondContact OD1-CA 3.45Å; D92-F94 WeakPolarHBondContact OD1-CB 3.48Å; D92-F94 PolarHBondContact OD1-N 2.98Å; D92-F94 WeakPolarHBondContact OD2-CD2 3.32Å; D92-A95 VanDerWaalsContact O-CB 3.29Å; D92-A95 WeakPolarHBondContact O-CB 3.29Å; D92-A95 PolarHBondContact O-N 3.16Å; D92-A95 VanDerWaalsContact O-N 3.15Å; D92-A95 PolarHBondContact OD1-N 3.01Å
93	V	89	Confident	80.4	Confident	144 Å²	144	116.3 Å²	116.3	87%	0.873	63%	0.631	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66	-20	179.5	-174.3	0	0	0	0	112.5
94	F	87.1	Confident	79.1	Confident	177 Å²	177	122.6 Å²	122.6	78%	0.776	64%	0.644	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.5	-13.3	178	-57.8	-73	0	0	0	112.5	D92 Q96	D92-F94 PolarHBondContact O-N 2.98Å; D92-F94 WeakPolarHBondContact OD1-CA 3.45Å; D92-F94 WeakPolarHBondContact OD1-CB 3.48Å; D92-F94 PolarHBondContact OD1-N 2.98Å; D92-F94 WeakPolarHBondContact OD2-CD2 3.32Å; F94-Q96 PolarHBondContact O-N 2.91Å; F94-Q96 VanDerWaalsContact O-N 3.16Å
95	A	86.2	Confident	78.1	Confident	46 Å²	46	124.5 Å²	124.5	38%	0.38	65%	0.645	S	S	.	*			trans	-61.2	117.1	176.5	0	0	0	0	0	109.8	T91 D92 G97	T91-A95 HydrophobicContact CG2-CB 4.12Å; D92-A95 VanDerWaalsContact O-CB 3.29Å; D92-A95 WeakPolarHBondContact O-CB 3.29Å; D92-A95 PolarHBondContact O-N 3.16Å; D92-A95 VanDerWaalsContact O-N 3.15Å; D92-A95 PolarHBondContact OD1-N 3.01Å; A95-G97 PolarHBondContact O-N 3.03Å
96	Q	78.6	Confident	77.3	Confident	191 Å²	191	121.3 Å²	121.3	89%	0.893	65%	0.647	S	S	*	*			trans	-91.1	99.9	172.6	-63.5	-173.2	13.1	0	0	107.8	F94	F94-Q96 PolarHBondContact O-N 2.91Å; F94-Q96 VanDerWaalsContact O-N 3.16Å
97	G	72.9	Confident	76.6	Confident	61 Å²	61	121.6 Å²	121.6	63%	0.629	66%	0.655	S	S	*	*			trans	-58.9	151.4	170	0	0	0	0	0	110.8	A95 R99	A95-G97 PolarHBondContact O-N 3.03Å; G97-R99 VanDerWaalsContact C-N 3.31Å; G97-R99 PolarHBondContact O-N 3.47Å
98	Q	68	Low	76.1	Confident	100 Å²	100	125.1 Å²	125.1	47%	0.467	67%	0.669	S	S	.	*			trans	-63.1	96.6	167.1	-68.7	173.5	-92.5	0	0	108.2	S100 D113	Q98-S100 PolarHBondContact O-N 2.86Å; Q98-D113 PolarHBondContact NE2-O 3.49Å; Q98-D113 PolarHBondContact OE1-O 3.04Å
99	R	65.8	Low	75.3	Confident	206 Å²	206	124.2 Å²	124.2	78%	0.777	67%	0.668	S	S	*	*			trans	-66.2	119.3	171.6	-72.9	-174.7	174.4	-177.1	-0.8	107.3	G97 D101	G97-R99 VanDerWaalsContact C-N 3.31Å; G97-R99 PolarHBondContact O-N 3.47Å; R99-D101 PolarHBondContact O-N 3.22Å
100	S	61	Low	74.4	Confident	117 Å²	117	131 Å²	131	82%	0.818	69%	0.689	S	S	*	*			trans	-67.5	66.3	165.2	-45.4	0	0	0	0	109.1	Q98	Q98-S100 PolarHBondContact O-N 2.86Å
101	D	60.1	Low	73.9	Confident	108 Å²	108	132.4 Å²	132.4	58%	0.578	70%	0.697	S	S	*	*			trans	-63.1	139	170.6	-78.9	-29	0	0	0	108.3	R99 Y103	R99-D101 PolarHBondContact O-N 3.22Å; D101-Y103 PolarHBondContact O-N 3.22Å; D101-Y103 VanDerWaalsContact O-N 3.09Å
102	C	57.4	Low	73.4	Confident	128 Å²	128	134.5 Å²	134.5	87%	0.865	70%	0.703	S	S	*	*			trans	-45.5	119.8	177.8	-93.5	0	0	0	0	110.9	R104	C102-R104 PolarHBondContact O-N 2.9Å
103	Y	63.6	Low	73	Confident	166 Å²	166	136 Å²	136	65%	0.651	71%	0.711	S	S	*	*			trans	-46.9	108.2	171.2	-179.6	-96.1	0	0	0	109.5	D101 K105	D101-Y103 PolarHBondContact O-N 3.22Å; D101-Y103 VanDerWaalsContact O-N 3.09Å; Y103-K105 PolarHBondContact O-N 3.41Å
104	R	63.9	Low	72.6	Confident	219 Å²	219	133 Å²	133	83%	0.826	69%	0.693	S	S	*	*			trans	-75	98.7	178.4	-160.5	167.3	-170	156.3	1.3	106.9	C102 G106 G107	C102-R104 PolarHBondContact O-N 2.9Å; R104-G106 PolarHBondContact O-N 3.45Å; R104-G107 PolarHBondContact O-N 2.83Å
105	K	67.8	Low	72.4	Confident	200 Å²	200	127.2 Å²	127.2	87%	0.87	68%	0.675	S	S	*	*	T	Hydrogen-bonded Turn	trans	-51.2	112.1	-177	-167	174.7	-176	178	0	110.1	Y103	Y103-K105 PolarHBondContact O-N 3.41Å
106	G	73.6	Confident	72.5	Confident	81 Å²	81	130.6 Å²	130.6	84%	0.835	69%	0.685	S	S	*	*	T	Hydrogen-bonded Turn	trans	100	-0.8	-178.8	0	0	0	0	0	116.2	R104	R104-G106 PolarHBondContact O-N 3.45Å
107	G	77.6	Confident	72.9	Confident	35 Å²	35	125.6 Å²	125.6	36%	0.361	67%	0.671	S	S	.	*	S	Bend	trans	-93.5	158.9	170.8	0	0	0	0	0	112.9	R104	R104-G107 PolarHBondContact O-N 2.83Å
108	I	76.2	Confident	73.6	Confident	167 Å²	167	128.1 Å²	128.1	86%	0.856	67%	0.666	S	S	*	*	P	Polyproline II helix	trans	-68.6	127.2	168.8	-59.7	169.7	0	0	0	107.5
109	P	72.8	Confident	74.6	Confident	86 Å²	86	125.5 Å²	125.5	56%	0.558	66%	0.657	S	S	*	*	P	Polyproline II helix	trans	-62.4	148.3	178.4	26.3	-33.2	0	0	0	110.5
110	R	72.8	Confident	75.9	Confident	208 Å²	208	118.9 Å²	118.9	79%	0.785	64%	0.637	S	S	*	*	P	Polyproline II helix	trans	-65.9	150.9	173	-77	-175.1	160.4	-154.5	-5.2	109.6	E112	R110-E112 PolarHBondContact O-N 3.48Å
111	L	77.5	Confident	77.2	Confident	180 Å²	180	120.4 Å²	120.4	94%	0.942	63%	0.629	S	S	*	*	P	Polyproline II helix	trans	-67.3	120.9	169.5	-175.5	66.2	0	0	0	107.9
112	E	79.7	Confident	78.5	Confident	103 Å²	103	121.8 Å²	121.8	48%	0.481	63%	0.634	S	S	.	*			trans	-144.7	145.1	-175.6	86.2	-179.4	145.3	0	0	108.4	R110 V114	R110-E112 PolarHBondContact O-N 3.48Å; E112-V114 PolarHBondContact O-N 3.28Å
113	D	80.7	Confident	80	Confident	134 Å²	134	122.6 Å²	122.6	72%	0.717	62%	0.623	S	S	*	*	P	Polyproline II helix	trans	-70.2	120.9	173.3	-64.9	-28.4	0	0	0	109.6	Q98	Q98-D113 PolarHBondContact NE2-O 3.49Å; Q98-D113 PolarHBondContact OE1-O 3.04Å
114	V	81.3	Confident	81	Confident	80 Å²	80	123.1 Å²	123.1	49%	0.485	63%	0.625	S	S	.	*	P	Polyproline II helix	trans	-89.7	136.7	176.1	-179	0	0	0	0	108.3	E112 I116 E118 V119	E112-V114 PolarHBondContact O-N 3.28Å; V114-I116 PolarHBondContact O-N 2.89Å; V114-E118 HydrophobicContact CG1-CB 3.64Å; V114-V119 HydrophobicContact CB-CG2 3.98Å; V114-V119 HydrophobicContact CG1-CG2 3.77Å
115	S	84.1	Confident	82.1	Confident	56 Å²	56	118.8 Å²	118.8	39%	0.392	62%	0.618	S	S	.	*	P	Polyproline II helix	trans	-58.2	138.2	178	69.8	0	0	0	0	110.4	S117 E118 V119	S115-S117 PolarHBondContact O-N 3.06Å; S115-E118 WeakPolarHBondContact O-CB 3.31Å; S115-E118 PolarHBondContact O-N 3.4Å; S115-E118 WeakPolarHBondContact OG-CB 3.23Å; S115-E118 VanDerWaalsContact OG-CG 3.28Å; S115-E118 WeakPolarHBondContact OG-CG 3.42Å; S115-E118 PolarHBondContact OG-N 3.19Å; S115-E118 PolarHBondContact OG-OE2 2.92Å; S115-V119 PolarHBondContact O-N 2.84Å
116	I	86.4	Confident	82.3	Confident	117 Å²	117	112.2 Å²	112.2	60%	0.6	60%	0.597	S	S	*	*	H	α-helix	trans	-57.6	-28.9	180	-168.6	61.2	0	0	0	111.9	V114 V119 N120	V114-I116 PolarHBondContact O-N 2.89Å; I116-V119 HydrophobicContact CD1-CB 4.48Å; I116-V119 PolarHBondContact O-N 3.43Å; I116-N120 VanDerWaalsContact O-CB 3.23Å; I116-N120 WeakPolarHBondContact O-CB 3.5Å; I116-N120 PolarHBondContact O-N 3.16Å; I116-N120 PolarHBondContact O-ND2 2.9Å
117	S	88.9	Confident	81.9	Confident	85 Å²	85	113.1 Å²	113.1	59%	0.594	59%	0.59	S	S	*	*	H	α-helix	trans	-63.6	-42.9	173.6	-59.3	0	0	0	0	112.5	S115 K121	S115-S117 PolarHBondContact O-N 3.06Å; S117-K121 VanDerWaalsContact O-CB 3.32Å; S117-K121 WeakPolarHBondContact O-CB 3.49Å; S117-K121 PolarHBondContact O-N 3.04Å
118	E	86.7	Confident	81.1	Confident	115 Å²	115	120.8 Å²	120.8	54%	0.537	62%	0.617	S	S	.	*	H	α-helix	trans	-68.6	-42.9	175.2	-79.1	169.5	143.2	0	0	111.9	V114 S115 N120 K121 M122	V114-E118 HydrophobicContact CG1-CB 3.64Å; S115-E118 WeakPolarHBondContact O-CB 3.31Å; S115-E118 PolarHBondContact O-N 3.4Å; S115-E118 WeakPolarHBondContact OG-CB 3.23Å; S115-E118 VanDerWaalsContact OG-CG 3.28Å; S115-E118 WeakPolarHBondContact OG-CG 3.42Å; S115-E118 PolarHBondContact OG-N 3.19Å; S115-E118 PolarHBondContact OG-OE2 2.92Å; E118-N120 VanDerWaalsContact C-N 3.32Å; E118-N120 PolarHBondContact O-N 2.77Å; E118-K121 PolarHBondContact O-N 3.28Å; E118-M122 VanDerWaalsContact O-CB 3.31Å; E118-M122 WeakPolarHBondContact O-CB 3.28Å; E118-M122 PolarHBondContact O-N 2.99Å
119	V	89.1	Confident	79.6	Confident	45 Å²	45	122.4 Å²	122.4	27%	0.273	63%	0.634	S	S	.	*	H	α-helix	trans	-57.9	-48	173.8	178.4	0	0	0	0	109.8	V114 S115 I116 K121 M122 F123	V114-V119 HydrophobicContact CB-CG2 3.98Å; V114-V119 HydrophobicContact CG1-CG2 3.77Å; S115-V119 PolarHBondContact O-N 2.84Å; I116-V119 HydrophobicContact CD1-CB 4.48Å; I116-V119 PolarHBondContact O-N 3.43Å; V119-K121 VanDerWaalsContact C-N 3.33Å; V119-K121 PolarHBondContact O-N 2.67Å; V119-M122 PolarHBondContact O-N 2.99Å; V119-F123 HydrophobicContact CG1-CD2 3.74Å; V119-F123 HydrophobicContact CG1-CE2 4.16Å; V119-F123 WeakPolarHBondContact O-CD2 3.49Å; V119-F123 PolarHBondContact O-N 2.78Å
120	N	91.9	Very high	79.9	Confident	66 Å²	66	124.2 Å²	124.2	35%	0.353	64%	0.638	S	S	.	*	H	α-helix	trans	-61.4	-42.3	177.9	-76.8	-11.6	0	0	0	112.1	I116 E118 M122 Y124 L125	I116-N120 VanDerWaalsContact O-CB 3.23Å; I116-N120 WeakPolarHBondContact O-CB 3.5Å; I116-N120 PolarHBondContact O-N 3.16Å; I116-N120 PolarHBondContact O-ND2 2.9Å; E118-N120 VanDerWaalsContact C-N 3.32Å; E118-N120 PolarHBondContact O-N 2.77Å; N120-M122 VanDerWaalsContact C-N 3.33Å; N120-M122 PolarHBondContact O-N 3.4Å; N120-Y124 WeakPolarHBondContact O-CA 3.37Å; N120-Y124 WeakPolarHBondContact O-CB 3.32Å; N120-Y124 PolarHBondContact O-N 3.31Å; N120-L125 PolarHBondContact O-N 3.09Å
121	K	90.3	Very high	80.3	Confident	149 Å²	149	119.8 Å²	119.8	65%	0.648	63%	0.63	S	S	*	*	I	π-helix	trans	-63.3	-39.7	176.6	-172	179.3	177.5	-176.3	0	112.4	S117 E118 V119 S126	S117-K121 VanDerWaalsContact O-CB 3.32Å; S117-K121 WeakPolarHBondContact O-CB 3.49Å; S117-K121 PolarHBondContact O-N 3.04Å; E118-K121 PolarHBondContact O-N 3.28Å; V119-K121 VanDerWaalsContact C-N 3.33Å; V119-K121 PolarHBondContact O-N 2.67Å; K121-S126 WeakPolarHBondContact O-CB 3.32Å; K121-S126 PolarHBondContact O-N 2.76Å; K121-S126 PolarHBondContact O-OG 2.97Å
122	M	87.2	Confident	80.4	Confident	138 Å²	138	116.4 Å²	116.4	68%	0.68	61%	0.613	S	S	*	*	I	π-helix	trans	-80.7	-32.3	-173.3	-166.4	172.5	-155.6	0	0	113.8	E118 V119 N120 S126	E118-M122 VanDerWaalsContact O-CB 3.31Å; E118-M122 WeakPolarHBondContact O-CB 3.28Å; E118-M122 PolarHBondContact O-N 2.99Å; V119-M122 PolarHBondContact O-N 2.99Å; N120-M122 VanDerWaalsContact C-N 3.33Å; N120-M122 PolarHBondContact O-N 3.4Å; M122-S126 PolarHBondContact O-OG 2.9Å
123	F	87.1	Confident	80.5	Confident	144 Å²	144	117.2 Å²	117.2	63%	0.632	62%	0.621	S	S	*	*	I	π-helix	trans	-106.5	-24.8	-174.9	-69.2	-72.8	0	0	0	114.4	V119	V119-F123 HydrophobicContact CG1-CD2 3.74Å; V119-F123 HydrophobicContact CG1-CE2 4.16Å; V119-F123 WeakPolarHBondContact O-CD2 3.49Å; V119-F123 PolarHBondContact O-N 2.78Å
124	Y	86.5	Confident	80.5	Confident	177 Å²	177	116.2 Å²	116.2	69%	0.694	62%	0.615	S	S	*	*	I	π-helix	trans	-124.6	-27.3	-170.1	-57.2	-86.8	0	0	0	114.2	N120	N120-Y124 WeakPolarHBondContact O-CA 3.37Å; N120-Y124 WeakPolarHBondContact O-CB 3.32Å; N120-Y124 PolarHBondContact O-N 3.31Å
125	L	85.8	Confident	80.4	Confident	129 Å²	129	118.6 Å²	118.6	68%	0.675	62%	0.624	S	S	*	*	I	π-helix	trans	-108.6	-12.8	-178.7	-54.6	170.5	0	0	0	113.8	N120 S127	N120-L125 PolarHBondContact O-N 3.09Å; L125-S127 VanDerWaalsContact C-N 3.34Å; L125-S127 PolarHBondContact O-N 3.28Å
126	S	71.9	Confident	80.1	Confident	62 Å²	62	123.1 Å²	123.1	43%	0.434	64%	0.64	S	S	.	*			trans	-70.8	93.4	168.6	46.6	0	0	0	0	107.9	K121 M122 E128	K121-S126 WeakPolarHBondContact O-CB 3.32Å; K121-S126 PolarHBondContact O-N 2.76Å; K121-S126 PolarHBondContact O-OG 2.97Å; M122-S126 PolarHBondContact O-OG 2.9Å; S126-E128 PolarHBondContact O-N 3.01Å
127	S	64.8	Low	79.7	Confident	100 Å²	100	123.5 Å²	123.5	70%	0.699	64%	0.643	S	S	*	*			trans	-67.9	100.8	163.8	44.1	0	0	0	0	107.8	L125 T129	L125-S127 VanDerWaalsContact C-N 3.34Å; L125-S127 PolarHBondContact O-N 3.28Å; S127-T129 VanDerWaalsContact C-N 3.31Å; S127-T129 PolarHBondContact O-N 2.88Å
128	E	61.7	Low	78.9	Confident	196 Å²	196	126.8 Å²	126.8	92%	0.916	65%	0.647	S	S	*	*			trans	-62.4	98.1	159.6	-76.5	-161.9	153.1	0	0	108.4	S126	S126-E128 PolarHBondContact O-N 3.01Å
129	T	43.8	Very low	78.2	Confident	200 Å²	200	127.8 Å²	127.8	100%	1.227	66%	0.657	S	S	*	*			trans	-129.4	0	146.8	51.4	0	0	0	0	107.9	S127	S127-T129 VanDerWaalsContact C-N 3.31Å; S127-T129 PolarHBondContact O-N 2.88Å

Retrieved 129 of 129 residues in 175.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).