A0A087YL29_POEFO Loading...

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

AlphaFold DB , UniProt , Accession A0A087YL29, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 57 aa.

						>A0A087YL29_POEFO|A0A087YL29
MVKFALSSVNWAHILVPMGFVIGWYLDKQQDQKLTAFRNKSALYKRELKPGEEVTWK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	37.6	Very low	56.4	Low	239 Å²	239	131.1 Å²	131.1	100%	1.177	70%	0.697	S	S	*	*				0	96	0	-166.4	-179.2	-123.6	0	0	107.6	K3	M1-K3 PolarHBondContact O-N 3.4Å
2	V	50	Low	58.4	Low	118 Å²	118	124 Å²	124	72%	0.715	67%	0.671	S	S	*	*			trans	-65.3	121.1	-177.6	178.4	0	0	0	0	107.8	F4	V2-F4 HydrophobicContact CB-CE2 4.22Å; V2-F4 HydrophobicContact CG1-CE2 4.39Å; V2-F4 VanDerWaalsContact O-CD2 3.28Å; V2-F4 WeakPolarHBondContact O-CD2 3.45Å; V2-F4 PolarHBondContact O-N 2.93Å
3	K	50.6	Low	60.3	Low	194 Å²	194	124.6 Å²	124.6	84%	0.843	67%	0.666	S	S	*	*			trans	-70.4	90.5	-178.9	-71.6	-178.2	172.6	-178	0	109.3	M1 A5	M1-K3 PolarHBondContact O-N 3.4Å; K3-A5 PolarHBondContact O-N 2.69Å
4	F	56.3	Low	61.9	Low	168 Å²	168	122.4 Å²	122.4	74%	0.737	65%	0.653	S	S	*	*	G	3₁₀ helix	trans	-69.1	26.4	166.7	-74.8	-84.3	0	0	0	113.1	V2 S7	V2-F4 HydrophobicContact CB-CE2 4.22Å; V2-F4 HydrophobicContact CG1-CE2 4.39Å; V2-F4 VanDerWaalsContact O-CD2 3.28Å; V2-F4 WeakPolarHBondContact O-CD2 3.45Å; V2-F4 PolarHBondContact O-N 2.93Å; F4-S7 PolarHBondContact O-OG 3.3Å
5	A	52.3	Low	63.5	Low	79 Å²	79	119.9 Å²	119.9	65%	0.653	64%	0.639	S	S	*	*	G	3₁₀ helix	trans	-88.9	-4.9	-175.1	0	0	0	0	0	113.5	K3	K3-A5 PolarHBondContact O-N 2.69Å
6	L	53.6	Low	65.1	Low	135 Å²	135	119.7 Å²	119.7	71%	0.707	64%	0.643	S	S	*	*	G	3₁₀ helix	trans	-88.4	0	177	-145.6	83.7	0	0	0	113.3	N10	L6-N10 HydrophobicContact CG-CB 4.45Å; L6-N10 WeakPolarHBondContact O-CB 3.19Å
7	S	58.2	Low	66.7	Low	81 Å²	81	117 Å²	117	57%	0.566	63%	0.634	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.7	-29.8	-170.5	62.4	0	0	0	0	114.2	F4	F4-S7 PolarHBondContact O-OG 3.3Å
8	S	59.5	Low	68.1	Low	87 Å²	87	116.1 Å²	116.1	61%	0.608	63%	0.626	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.6	-28.5	-171.8	59.2	0	0	0	0	114.8	W11	S8-W11 VanDerWaalsContact O-CD1 3.25Å
9	V	59.3	Low	69.5	Low	114 Å²	114	112.2 Å²	112.2	69%	0.691	62%	0.616	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.9	-29.5	-177.4	-177.3	0	0	0	0	112
10	N	69.1	Low	70.8	Confident	73 Å²	73	114 Å²	114	39%	0.39	62%	0.618	S	S	.	*	S	Bend	trans	-96.8	-6.2	-170.7	-137.9	36.2	0	0	0	114.6	L6 A12 H13	L6-N10 HydrophobicContact CG-CB 4.45Å; L6-N10 WeakPolarHBondContact O-CB 3.19Å; N10-A12 PolarHBondContact O-N 3.33Å; N10-H13 PolarHBondContact O-N 2.97Å
11	W	73.6	Confident	72	Confident	154 Å²	154	112.8 Å²	112.8	58%	0.583	61%	0.614	S	S	*	*	H	α-helix	trans	-66.1	-38.4	-178	82.8	-73.9	0	0	0	112.5	S8 H13 I14 L15	S8-W11 VanDerWaalsContact O-CD1 3.25Å; W11-H13 VanDerWaalsContact C-N 3.28Å; W11-H13 PolarHBondContact O-N 2.96Å; W11-I14 WeakPolarHBondContact O-CB 3.31Å; W11-I14 PolarHBondContact O-N 3.47Å; W11-L15 HydrophobicContact CE3-CD1 3.9Å; W11-L15 HydrophobicContact CE3-CD2 4.08Å; W11-L15 HydrophobicContact CE3-CG 4.06Å; W11-L15 HydrophobicContact CH2-CD1 3.87Å; W11-L15 HydrophobicContact CZ3-CD1 3.52Å; W11-L15 HydrophobicContact CZ3-CD2 3.95Å; W11-L15 HydrophobicContact CZ3-CG 4.06Å; W11-L15 PolarHBondContact O-N 3.41Å
12	A	81.1	Confident	74.7	Confident	46 Å²	46	105.6 Å²	105.6	38%	0.38	58%	0.579	S	S	.	*	H	α-helix	trans	-64	-34	-178.2	0	0	0	0	0	112	N10 I14 L15	N10-A12 PolarHBondContact O-N 3.33Å; A12-I14 PolarHBondContact O-N 3.09Å; A12-L15 PolarHBondContact O-N 3.29Å
13	H	82.9	Confident	76.9	Confident	132 Å²	132	101.3 Å²	101.3	61%	0.611	56%	0.56	S	S	*	*	H	α-helix	trans	-70.1	-19.2	176.4	-66.7	-60.4	0	0	0	113.4	N10 W11 P17	N10-H13 PolarHBondContact O-N 2.97Å; W11-H13 VanDerWaalsContact C-N 3.28Å; W11-H13 PolarHBondContact O-N 2.96Å; H13-P17 WeakPolarHBondContact O-CD 3.49Å; H13-P17 WeakPolarHBondContact O-CG 3.25Å
14	I	81.9	Confident	79.1	Confident	93 Å²	93	99.2 Å²	99.2	48%	0.477	55%	0.546	S	S	.	.	H	α-helix	trans	-87.2	-26.7	178.4	-61.4	167.3	0	0	0	111.2	W11 A12 V16 P17 M18	W11-I14 WeakPolarHBondContact O-CB 3.31Å; W11-I14 PolarHBondContact O-N 3.47Å; A12-I14 PolarHBondContact O-N 3.09Å; I14-V16 PolarHBondContact O-N 3.12Å; I14-P17 WeakPolarHBondContact O-CD 3.47Å; I14-M18 HydrophobicContact CG2-CE 4.03Å; I14-M18 VanDerWaalsContact O-CB 3.23Å; I14-M18 WeakPolarHBondContact O-CB 3.38Å; I14-M18 PolarHBondContact O-N 2.78Å
15	L	87.1	Confident	80.9	Confident	85 Å²	85	97.6 Å²	97.6	45%	0.445	54%	0.536	S	S	.	.	H	α-helix	trans	-60.6	-45.3	-177.1	-67.8	177	0	0	0	113.1	W11 A12 M18 G19	W11-L15 HydrophobicContact CE3-CD1 3.9Å; W11-L15 HydrophobicContact CE3-CD2 4.08Å; W11-L15 HydrophobicContact CE3-CG 4.06Å; W11-L15 HydrophobicContact CH2-CD1 3.87Å; W11-L15 HydrophobicContact CZ3-CD1 3.52Å; W11-L15 HydrophobicContact CZ3-CD2 3.95Å; W11-L15 HydrophobicContact CZ3-CG 4.06Å; W11-L15 PolarHBondContact O-N 3.41Å; A12-L15 PolarHBondContact O-N 3.29Å; L15-M18 PolarHBondContact O-N 3.31Å; L15-G19 PolarHBondContact O-N 3.34Å
16	V	89	Confident	83	Confident	117 Å²	117	98.4 Å²	98.4	71%	0.709	53%	0.529	S	S	*	.	H	α-helix	trans	-67.9	-49.9	-176.4	178	0	0	0	0	111.4	I14 M18 G19 F20	I14-V16 PolarHBondContact O-N 3.12Å; V16-M18 VanDerWaalsContact C-N 3.3Å; V16-M18 PolarHBondContact O-N 2.83Å; V16-G19 PolarHBondContact O-N 2.89Å; V16-F20 PolarHBondContact O-N 2.99Å
17	P	92.3	Very high	85	Confident	74 Å²	74	96.6 Å²	96.6	48%	0.481	52%	0.52	S	S	.	.	H	α-helix	trans	-59	-39.5	173.1	-24.9	34.3	0	0	0	113.2	H13 I14 F20 V21	H13-P17 WeakPolarHBondContact O-CD 3.49Å; H13-P17 WeakPolarHBondContact O-CG 3.25Å; I14-P17 WeakPolarHBondContact O-CD 3.47Å; P17-F20 PolarHBondContact O-N 3.23Å; P17-V21 WeakPolarHBondContact O-CG2 3.19Å; P17-V21 PolarHBondContact O-N 3.19Å
18	M	91.9	Very high	86.6	Confident	100 Å²	100	96 Å²	96	49%	0.493	51%	0.507	S	S	.	.	H	α-helix	trans	-65.4	-44.4	178.1	-167.2	-161.9	-59.2	0	0	111.4	I14 L15 V16 F20 V21 I22	I14-M18 HydrophobicContact CG2-CE 4.03Å; I14-M18 VanDerWaalsContact O-CB 3.23Å; I14-M18 WeakPolarHBondContact O-CB 3.38Å; I14-M18 PolarHBondContact O-N 2.78Å; L15-M18 PolarHBondContact O-N 3.31Å; V16-M18 VanDerWaalsContact C-N 3.3Å; V16-M18 PolarHBondContact O-N 2.83Å; M18-F20 VanDerWaalsContact C-N 3.28Å; M18-F20 PolarHBondContact O-N 2.99Å; M18-V21 PolarHBondContact O-N 3.34Å; M18-I22 HydrophobicContact CG-CD1 4Å; M18-I22 VanDerWaalsContact O-CG1 3.3Å; M18-I22 WeakPolarHBondContact O-CG1 3.5Å; M18-I22 PolarHBondContact O-N 3.39Å; M18-I22 HydrophobicContact SD-CD1 4.26Å
19	G	93.6	Very high	88.2	Confident	43 Å²	43	95 Å²	95	44%	0.443	49%	0.493	S	S	.	.	H	α-helix	trans	-60	-39	176	0	0	0	0	0	112.4	L15 V16 I22 G23	L15-G19 PolarHBondContact O-N 3.34Å; V16-G19 PolarHBondContact O-N 2.89Å; G19-I22 PolarHBondContact O-N 3.38Å; G19-G23 PolarHBondContact O-N 3.08Å
20	F	95.4	Very high	89.9	Confident	148 Å²	148	95.1 Å²	95.1	65%	0.649	49%	0.486	S	S	*	.	H	α-helix	trans	-62.2	-47.2	173.8	176.8	-99.3	0	0	0	112.3	V16 P17 M18 I22 G23 W24	V16-F20 PolarHBondContact O-N 2.99Å; P17-F20 PolarHBondContact O-N 3.23Å; M18-F20 VanDerWaalsContact C-N 3.28Å; M18-F20 PolarHBondContact O-N 2.99Å; F20-I22 VanDerWaalsContact C-N 3.3Å; F20-I22 PolarHBondContact O-N 2.89Å; F20-G23 PolarHBondContact O-N 3.36Å; F20-W24 WeakPolarHBondContact O-CB 3.44Å; F20-W24 PolarHBondContact O-N 3.17Å
21	V	95.9	Very high	90.9	Very high	88 Å²	88	94.7 Å²	94.7	53%	0.533	48%	0.484	S	S	.	.	H	α-helix	trans	-61.2	-41.4	178.2	173.1	0	0	0	0	111.1	P17 M18 Y25	P17-V21 WeakPolarHBondContact O-CG2 3.19Å; P17-V21 PolarHBondContact O-N 3.19Å; M18-V21 PolarHBondContact O-N 3.34Å; V21-Y25 WeakPolarHBondContact O-CB 3.48Å; V21-Y25 PolarHBondContact O-N 3.18Å
22	I	95.7	Very high	91.6	Very high	88 Å²	88	93.2 Å²	93.2	45%	0.451	48%	0.483	S	S	.	.	H	α-helix	trans	-64.8	-46.2	176.8	-66.8	166.7	0	0	0	110.7	M18 G19 F20 Y25 L26	M18-I22 HydrophobicContact CG-CD1 4Å; M18-I22 VanDerWaalsContact O-CG1 3.3Å; M18-I22 WeakPolarHBondContact O-CG1 3.5Å; M18-I22 PolarHBondContact O-N 3.39Å; M18-I22 HydrophobicContact SD-CD1 4.26Å; G19-I22 PolarHBondContact O-N 3.38Å; F20-I22 VanDerWaalsContact C-N 3.3Å; F20-I22 PolarHBondContact O-N 2.89Å; I22-Y25 WeakPolarHBondContact O-CB 3.42Å; I22-Y25 PolarHBondContact O-N 3.16Å; I22-L26 HydrophobicContact CG2-CD1 4.18Å; I22-L26 WeakPolarHBondContact O-CG 3.42Å; I22-L26 PolarHBondContact O-N 3.06Å
23	G	95.8	Very high	92.1	Very high	29 Å²	29	98.7 Å²	98.7	30%	0.299	50%	0.499	S	S	.	.	H	α-helix	trans	-58.6	-49.5	177	0	0	0	0	0	112	G19 F20 Y25 L26 D27	G19-G23 PolarHBondContact O-N 3.08Å; F20-G23 PolarHBondContact O-N 3.36Å; G23-Y25 VanDerWaalsContact C-N 3.26Å; G23-Y25 PolarHBondContact O-N 3.31Å; G23-L26 PolarHBondContact O-N 3.36Å; G23-L26 VanDerWaalsContact O-N 3.11Å; G23-D27 PolarHBondContact O-N 3Å
24	W	96.2	Very high	92.3	Very high	149 Å²	149	97.9 Å²	97.9	56%	0.564	50%	0.498	S	S	*	.	H	α-helix	trans	-58.6	-38.6	176.8	178.7	78.4	0	0	0	112.7	F20 D27 K28	F20-W24 WeakPolarHBondContact O-CB 3.44Å; F20-W24 PolarHBondContact O-N 3.17Å; W24-D27 PolarHBondContact O-N 3.2Å; W24-K28 HydrophobicContact CD2-CG 4.41Å; W24-K28 HydrophobicContact CH2-CG 4.4Å; W24-K28 HydrophobicContact CZ2-CG 4.02Å; W24-K28 PolarHBondContact O-N 3.01Å
25	Y	95.5	Very high	92.6	Very high	135 Å²	135	95.6 Å²	95.6	53%	0.529	49%	0.488	S	S	.	.	H	α-helix	trans	-65.7	-42	176.4	179.4	-106.3	0	0	0	112.3	V21 I22 G23 K28 Q29	V21-Y25 WeakPolarHBondContact O-CB 3.48Å; V21-Y25 PolarHBondContact O-N 3.18Å; I22-Y25 WeakPolarHBondContact O-CB 3.42Å; I22-Y25 PolarHBondContact O-N 3.16Å; G23-Y25 VanDerWaalsContact C-N 3.26Å; G23-Y25 PolarHBondContact O-N 3.31Å; Y25-K28 PolarHBondContact O-N 3.39Å; Y25-Q29 HydrophobicContact CE1-CG 4.33Å; Y25-Q29 PolarHBondContact O-N 3.09Å; Y25-Q29 PolarHBondContact OH-NE2 3.37Å
26	L	96.1	Very high	92.5	Very high	96 Å²	96	94.6 Å²	94.6	50%	0.503	49%	0.493	S	S	.	.	H	α-helix	trans	-65.7	-41.5	176.7	-68.2	173.5	0	0	0	111.8	I22 G23 K28 Q29 Q30	I22-L26 HydrophobicContact CG2-CD1 4.18Å; I22-L26 WeakPolarHBondContact O-CG 3.42Å; I22-L26 PolarHBondContact O-N 3.06Å; G23-L26 PolarHBondContact O-N 3.36Å; G23-L26 VanDerWaalsContact O-N 3.11Å; L26-K28 VanDerWaalsContact C-N 3.33Å; L26-K28 PolarHBondContact O-N 3.3Å; L26-Q29 WeakPolarHBondContact O-CB 3.38Å; L26-Q29 PolarHBondContact O-N 2.89Å; L26-Q30 PolarHBondContact O-N 3Å
27	D	94.3	Very high	92.3	Very high	96 Å²	96	97 Å²	97	51%	0.513	49%	0.494	S	S	.	.	H	α-helix	trans	-60.3	-44.5	174.8	-74.8	-21.7	0	0	0	110.8	G23 W24 Q29 Q30 D31	G23-D27 PolarHBondContact O-N 3Å; W24-D27 PolarHBondContact O-N 3.2Å; D27-Q29 VanDerWaalsContact C-N 3.32Å; D27-Q29 PolarHBondContact O-N 3.26Å; D27-Q30 WeakPolarHBondContact O-CB 3.4Å; D27-Q30 PolarHBondContact O-N 3.47Å; D27-D31 PolarHBondContact O-N 3.5Å
28	K	93.2	Very high	92	Very high	69 Å²	69	96.8 Å²	96.8	30%	0.3	48%	0.484	S	S	.	.	H	α-helix	trans	-59.8	-39	174.8	-84.4	-60	-167	-171.2	0	113.4	W24 Y25 L26 Q30 Q32 K57	W24-K28 HydrophobicContact CD2-CG 4.41Å; W24-K28 HydrophobicContact CH2-CG 4.4Å; W24-K28 HydrophobicContact CZ2-CG 4.02Å; W24-K28 PolarHBondContact O-N 3.01Å; Y25-K28 PolarHBondContact O-N 3.39Å; L26-K28 VanDerWaalsContact C-N 3.33Å; L26-K28 PolarHBondContact O-N 3.3Å; K28-Q30 VanDerWaalsContact C-N 3.31Å; K28-Q32 WeakPolarHBondContact O-CG 3.48Å; K28-Q32 PolarHBondContact O-N 3Å; K28-K57 PolarHBondContact NZ-O 3.18Å
29	Q	93.4	Very high	91.6	Very high	66 Å²	66	93.7 Å²	93.7	31%	0.308	47%	0.469	S	S	.	.	H	α-helix	trans	-66.3	-35.2	174.1	-72.2	-167	-2.4	0	0	112.4	Y25 L26 D27 K33	Y25-Q29 HydrophobicContact CE1-CG 4.33Å; Y25-Q29 PolarHBondContact O-N 3.09Å; Y25-Q29 PolarHBondContact OH-NE2 3.37Å; L26-Q29 WeakPolarHBondContact O-CB 3.38Å; L26-Q29 PolarHBondContact O-N 2.89Å; D27-Q29 VanDerWaalsContact C-N 3.32Å; D27-Q29 PolarHBondContact O-N 3.26Å; Q29-K33 WeakPolarHBondContact O-CG 3.38Å; Q29-K33 PolarHBondContact O-N 3.41Å
30	Q	93.3	Very high	91.2	Very high	116 Å²	116	98.5 Å²	98.5	54%	0.542	48%	0.478	S	S	.	.	H	α-helix	trans	-69.7	-42.7	178.2	-166.2	169.9	-91.4	0	0	111.3	L26 D27 K28 Q32 K33 L34	L26-Q30 PolarHBondContact O-N 3Å; D27-Q30 WeakPolarHBondContact O-CB 3.4Å; D27-Q30 PolarHBondContact O-N 3.47Å; K28-Q30 VanDerWaalsContact C-N 3.31Å; Q30-Q32 VanDerWaalsContact C-N 3.27Å; Q30-Q32 PolarHBondContact O-N 3.04Å; Q30-K33 WeakPolarHBondContact O-CB 3.38Å; Q30-K33 PolarHBondContact O-N 3.29Å; Q30-L34 HydrophobicContact CG-CD1 4.25Å; Q30-L34 WeakPolarHBondContact O-CG 3.42Å; Q30-L34 PolarHBondContact O-N 3.23Å; Q30-L34 VanDerWaalsContact O-N 3.09Å
31	D	91.1	Very high	90.9	Very high	64 Å²	64	93.6 Å²	93.6	34%	0.342	46%	0.462	S	S	.	.	H	α-helix	trans	-57.6	-41	174.6	-72.9	-20.4	0	0	0	111.9	D27 K33 L34 T35	D27-D31 PolarHBondContact O-N 3.5Å; D31-K33 VanDerWaalsContact C-N 3.29Å; D31-K33 PolarHBondContact O-N 2.93Å; D31-L34 CarbonylContact O-C 3.58Å; D31-L34 PolarHBondContact O-N 3.11Å; D31-L34 VanDerWaalsContact O-N 3.08Å; D31-T35 WeakPolarHBondContact O-CG2 3.46Å
32	Q	88.7	Confident	90.6	Very high	124 Å²	124	94.8 Å²	94.8	58%	0.579	48%	0.481	S	S	*	.	H	α-helix	trans	-63.4	-31.6	175.5	-73.9	-177.7	-8.7	0	0	113.3	K28 Q30 L34 T35	K28-Q32 WeakPolarHBondContact O-CG 3.48Å; K28-Q32 PolarHBondContact O-N 3Å; Q30-Q32 VanDerWaalsContact C-N 3.27Å; Q30-Q32 PolarHBondContact O-N 3.04Å; Q32-L34 VanDerWaalsContact C-N 3.34Å; Q32-T35 WeakPolarHBondContact O-CG2 3.49Å; Q32-T35 PolarHBondContact O-OG1 3.35Å
33	K	90.1	Very high	90.4	Very high	161 Å²	161	97.1 Å²	97.1	70%	0.7	49%	0.494	S	S	*	.	H	α-helix	trans	-73.7	-29.5	173.7	-66.9	171.4	-174.3	173.1	0	111.6	Q29 Q30 D31 T35	Q29-K33 WeakPolarHBondContact O-CG 3.38Å; Q29-K33 PolarHBondContact O-N 3.41Å; Q30-K33 WeakPolarHBondContact O-CB 3.38Å; Q30-K33 PolarHBondContact O-N 3.29Å; D31-K33 VanDerWaalsContact C-N 3.29Å; D31-K33 PolarHBondContact O-N 2.93Å; K33-T35 VanDerWaalsContact C-N 3.28Å; K33-T35 PolarHBondContact O-N 2.98Å
34	L	88.4	Confident	90	Very high	114 Å²	114	103.9 Å²	103.9	60%	0.597	51%	0.511	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.6	18.7	-177.4	-64	174.2	0	0	0	113.8	Q30 D31 Q32 A36	Q30-L34 HydrophobicContact CG-CD1 4.25Å; Q30-L34 WeakPolarHBondContact O-CG 3.42Å; Q30-L34 PolarHBondContact O-N 3.23Å; Q30-L34 VanDerWaalsContact O-N 3.09Å; D31-L34 CarbonylContact O-C 3.58Å; D31-L34 PolarHBondContact O-N 3.11Å; D31-L34 VanDerWaalsContact O-N 3.08Å; Q32-L34 VanDerWaalsContact C-N 3.34Å; L34-A36 VanDerWaalsContact C-N 3.27Å; L34-A36 PolarHBondContact O-N 3.03Å
35	T	87.8	Confident	89.7	Confident	45 Å²	45	104.1 Å²	104.1	28%	0.276	52%	0.516	S	S	.	.	G	3₁₀ helix	trans	-81.3	3.2	-179	60.3	0	0	0	0	114.8	D31 Q32 K33 F37 R38 W56	D31-T35 WeakPolarHBondContact O-CG2 3.46Å; Q32-T35 WeakPolarHBondContact O-CG2 3.49Å; Q32-T35 PolarHBondContact O-OG1 3.35Å; K33-T35 VanDerWaalsContact C-N 3.28Å; K33-T35 PolarHBondContact O-N 2.98Å; T35-F37 PolarHBondContact O-N 3.29Å; T35-F37 VanDerWaalsContact O-N 3.16Å; T35-R38 WeakPolarHBondContact O-CB 3.45Å; T35-R38 PolarHBondContact O-N 3.19Å; T35-W56 HydrophobicContact CG2-CH2 4.36Å; T35-W56 HydrophobicContact CG2-CZ3 4.39Å
36	A	85.3	Confident	89.4	Confident	65 Å²	65	102.7 Å²	102.7	54%	0.537	51%	0.51	S	S	.	.	G	3₁₀ helix	trans	-56.9	-35.2	-173.3	0	0	0	0	0	113.9	L34 K40	L34-A36 VanDerWaalsContact C-N 3.27Å; L34-A36 PolarHBondContact O-N 3.03Å; A36-K40 PolarHBondContact O-NZ 3.43Å
37	F	84.9	Confident	89	Confident	167 Å²	167	106.7 Å²	106.7	73%	0.732	53%	0.526	S	S	*	.	G	3₁₀ helix	trans	-98.2	10.2	178.8	-80.4	-84	0	0	0	114.1	T35 N39 K40	T35-F37 PolarHBondContact O-N 3.29Å; T35-F37 VanDerWaalsContact O-N 3.16Å; F37-N39 PolarHBondContact O-N 3.02Å; F37-K40 PolarHBondContact O-N 3.06Å
38	R	84.8	Confident	88.7	Confident	70 Å²	70	105.9 Å²	105.9	26%	0.264	52%	0.521	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.2	128.8	178.9	-169.5	179.4	71.4	-159	-6.2	110.7	T35 K40 V54 T55 W56	T35-R38 WeakPolarHBondContact O-CB 3.45Å; T35-R38 PolarHBondContact O-N 3.19Å; R38-K40 PolarHBondContact O-N 3.35Å; R38-V54 VanDerWaalsContact NH1-CB 3.32Å; R38-V54 VanDerWaalsContact NH1-CG1 3.28Å; R38-T55 VanDerWaalsContact CG-OG1 3.25Å; R38-T55 WeakPolarHBondContact CG-OG1 3.39Å; R38-W56 WeakPolarHBondContact CD-O 3.43Å; R38-W56 HydrophobicContact CG-CD2 4.49Å; R38-W56 HydrophobicContact CG-CZ2 4.41Å; R38-W56 PolarHBondContact NH1-O 2.95Å
39	N	84.6	Confident	88.5	Confident	35 Å²	35	109.6 Å²	109.6	19%	0.187	54%	0.538	C	S	.	.	T	Hydrogen-bonded Turn	trans	58.6	22.2	-177.8	-158.5	29.3	0	0	0	115.2	F37 Y44 K45 R46 T55	F37-N39 PolarHBondContact O-N 3.02Å; N39-Y44 PolarHBondContact OD1-O 2.99Å; N39-K45 WeakPolarHBondContact OD1-CA 3.05Å; N39-R46 PolarHBondContact ND2-O 2.87Å; N39-R46 PolarHBondContact OD1-N 2.84Å; N39-R46 PolarHBondContact OD1-O 3.41Å; N39-T55 HydrophobicContact CB-CG2 3.72Å
40	K	85.6	Confident	88.2	Confident	143 Å²	143	113.1 Å²	113.1	62%	0.622	57%	0.566	S	S	*	*	T	Hydrogen-bonded Turn	trans	-117.3	-8.9	179.1	-64.9	176.7	-171.7	167.2	0	113.8	A36 F37 R38	A36-K40 PolarHBondContact O-NZ 3.43Å; F37-K40 PolarHBondContact O-N 3.06Å; R38-K40 PolarHBondContact O-N 3.35Å
41	S	89.3	Confident	87.9	Confident	46 Å²	46	111.7 Å²	111.7	32%	0.322	58%	0.583	S	S	.	*	S	Bend	trans	-69.4	142.4	178	58.4	0	0	0	0	110.9	L43 Y44 K45	S41-L43 PolarHBondContact O-N 2.98Å; S41-L43 VanDerWaalsContact O-N 3.09Å; S41-Y44 PolarHBondContact O-N 3.38Å; S41-Y44 WeakPolarHBondContact OG-CB 3.43Å; S41-Y44 PolarHBondContact OG-N 3.42Å; S41-K45 WeakPolarHBondContact O-CB 3.41Å; S41-K45 PolarHBondContact O-N 3.38Å
42	A	87.9	Confident	87.7	Confident	113 Å²	113	111.1 Å²	111.1	93%	0.934	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.1	-28.4	-178.4	0	0	0	0	0	113.3
43	L	91.4	Very high	87.4	Confident	136 Å²	136	113.3 Å²	113.3	71%	0.712	59%	0.588	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.6	-32.2	-176.3	-161.3	144.5	0	0	0	113.8	S41	S41-L43 PolarHBondContact O-N 2.98Å; S41-L43 VanDerWaalsContact O-N 3.09Å
44	Y	88.7	Confident	87.2	Confident	171 Å²	171	107.1 Å²	107.1	67%	0.671	56%	0.564	S	S	*	*	T	Hydrogen-bonded Turn	trans	-116.8	3.7	-173.2	-61	-73.5	0	0	0	114.3	N39 S41 R46	N39-Y44 PolarHBondContact OD1-O 2.99Å; S41-Y44 PolarHBondContact O-N 3.38Å; S41-Y44 WeakPolarHBondContact OG-CB 3.43Å; S41-Y44 PolarHBondContact OG-N 3.42Å; Y44-R46 PolarHBondContact O-N 2.95Å
45	K	88.6	Confident	87.1	Confident	154 Å²	154	103.3 Å²	103.3	67%	0.67	55%	0.545	S	S	*	.			trans	-65.3	123.5	175.4	179.5	177.1	179.6	-172.5	0	109.9	N39 S41	N39-K45 WeakPolarHBondContact OD1-CA 3.05Å; S41-K45 WeakPolarHBondContact O-CB 3.41Å; S41-K45 PolarHBondContact O-N 3.38Å
46	R	89.8	Confident	86.9	Confident	105 Å²	105	106.8 Å²	106.8	40%	0.396	55%	0.554	S	S	.	*			trans	-144.7	161.6	175.6	61.6	175.2	177.1	87.2	-4	111.5	N39 Y44 E52	N39-R46 PolarHBondContact ND2-O 2.87Å; N39-R46 PolarHBondContact OD1-N 2.84Å; N39-R46 PolarHBondContact OD1-O 3.41Å; Y44-R46 PolarHBondContact O-N 2.95Å; R46-E52 IonicContact CZ-OE1 3.61Å; R46-E52 IonicContact CZ-OE2 3.53Å; R46-E52 IonicContact NH1-OE1 3.63Å; R46-E52 IonicContact NH1-OE2 2.78Å; R46-E52 PolarHBondContact NH1-OE2 3.28Å; R46-E52 IonicContact NH2-OE1 2.69Å; R46-E52 PolarHBondContact NH2-OE1 3.34Å; R46-E52 IonicContact NH2-OE2 3.34Å; R46-E52 PolarHBondContact NH2-OE2 2.91Å
47	E	88.2	Confident	86.7	Confident	181 Å²	181	112.1 Å²	112.1	85%	0.846	57%	0.565	S	S	*	*	P	Polyproline II helix	trans	-66.4	140.2	166.3	-62.5	-167.4	167.9	0	0	109.9
48	L	88.2	Confident	86.8	Confident	78 Å²	78	109.4 Å²	109.4	41%	0.408	56%	0.556	S	S	.	*	P	Polyproline II helix	trans	-78.3	139	179.5	-69.8	167	0	0	0	109.1	E52 T55	L48-E52 WeakPolarHBondContact CB-O 3.5Å; L48-E52 HydrophobicContact CD2-CG 4.18Å; L48-T55 HydrophobicContact CD2-CG2 4.01Å
49	K	88.8	Confident	86.9	Confident	148 Å²	148	111.5 Å²	111.5	64%	0.643	57%	0.572	S	S	*	*	P	Polyproline II helix	trans	-66.8	151.2	174.2	-68.6	179.7	-178.9	179.1	0	109.5	G51 E52	K49-G51 PolarHBondContact O-N 3.49Å; K49-G51 VanDerWaalsContact O-N 3.12Å; K49-E52 HydrophobicContact CB-CB 4.2Å; K49-E52 PolarHBondContact N-OE2 3.37Å; K49-E52 WeakPolarHBondContact O-CB 3.23Å; K49-E52 PolarHBondContact O-N 3.46Å
50	P	87.1	Confident	87.1	Confident	139 Å²	139	115.7 Å²	115.7	90%	0.903	59%	0.593	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.6	121.9	174.3	21.3	-30.9	0	0	0	110
51	G	86.3	Confident	87.2	Confident	87 Å²	87	114.1 Å²	114.1	90%	0.897	59%	0.591	S	S	*	*	T	Hydrogen-bonded Turn	trans	91.2	-3.8	-175.3	0	0	0	0	0	115.8	K49	K49-G51 PolarHBondContact O-N 3.49Å; K49-G51 VanDerWaalsContact O-N 3.12Å
52	E	86.8	Confident	87	Confident	51 Å²	51	118.4 Å²	118.4	24%	0.238	61%	0.608	C	S	.	*			trans	-95.5	107.8	175.1	-171.4	-178.6	-168	0	0	110.2	R46 L48 K49 V54	R46-E52 IonicContact CZ-OE1 3.61Å; R46-E52 IonicContact CZ-OE2 3.53Å; R46-E52 IonicContact NH1-OE1 3.63Å; R46-E52 IonicContact NH1-OE2 2.78Å; R46-E52 PolarHBondContact NH1-OE2 3.28Å; R46-E52 IonicContact NH2-OE1 2.69Å; R46-E52 PolarHBondContact NH2-OE1 3.34Å; R46-E52 IonicContact NH2-OE2 3.34Å; R46-E52 PolarHBondContact NH2-OE2 2.91Å; L48-E52 WeakPolarHBondContact CB-O 3.5Å; L48-E52 HydrophobicContact CD2-CG 4.18Å; K49-E52 HydrophobicContact CB-CB 4.2Å; K49-E52 PolarHBondContact N-OE2 3.37Å; K49-E52 WeakPolarHBondContact O-CB 3.23Å; K49-E52 PolarHBondContact O-N 3.46Å; E52-V54 VanDerWaalsContact CG-O 3.31Å; E52-V54 WeakPolarHBondContact CG-O 3.3Å
53	E	83.4	Confident	87	Confident	171 Å²	171	118.7 Å²	118.7	80%	0.799	59%	0.586	S	S	*	*			trans	-75.4	-29.9	177	-64.6	178.3	-179.3	0	0	112.3
54	V	85.1	Confident	86.6	Confident	30 Å²	30	117.5 Å²	117.5	18%	0.182	58%	0.577	C	S	.	*			trans	-147.2	143.8	-163.4	-48.9	0	0	0	0	111.4	R38 E52 W56 K57	R38-V54 VanDerWaalsContact NH1-CB 3.32Å; R38-V54 VanDerWaalsContact NH1-CG1 3.28Å; E52-V54 VanDerWaalsContact CG-O 3.31Å; E52-V54 WeakPolarHBondContact CG-O 3.3Å; V54-W56 WeakPolarHBondContact CG2-O 3.28Å; V54-K57 HydrophobicContact CG2-CG 3.91Å
55	T	86.2	Confident	86.5	Confident	35 Å²	35	113.4 Å²	113.4	22%	0.215	57%	0.57	C	S	.	*	S	Bend	trans	-76.2	-24.9	177.9	53.6	0	0	0	0	113.8	R38 N39 L48	R38-T55 VanDerWaalsContact CG-OG1 3.25Å; R38-T55 WeakPolarHBondContact CG-OG1 3.39Å; N39-T55 HydrophobicContact CB-CG2 3.72Å; L48-T55 HydrophobicContact CD2-CG2 4.01Å
56	W	84.4	Confident	86.3	Confident	118 Å²	118	110 Å²	110	45%	0.447	56%	0.562	S	S	.	*			trans	-160.2	162.5	175	54.8	-95.6	0	0	0	111.6	T35 R38 V54	T35-W56 HydrophobicContact CG2-CH2 4.36Å; T35-W56 HydrophobicContact CG2-CZ3 4.39Å; R38-W56 WeakPolarHBondContact CD-O 3.43Å; R38-W56 HydrophobicContact CG-CD2 4.49Å; R38-W56 HydrophobicContact CG-CZ2 4.41Å; R38-W56 PolarHBondContact NH1-O 2.95Å; V54-W56 WeakPolarHBondContact CG2-O 3.28Å
57	K	81.4	Confident	86	Confident	177 Å²	177	110.5 Å²	110.5	77%	0.77	58%	0.577	S	S	*	*			trans	-122.8	0	-172.1	-71.7	-172	179.5	-176.5	0	114.1	K28 V54	K28-K57 PolarHBondContact NZ-O 3.18Å; V54-K57 HydrophobicContact CG2-CG 3.91Å

Retrieved 57 of 57 residues in 66 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).