A0A087YM65_POEFO Loading...

Guanine nucleotide-binding protein subunit gamma

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

AlphaFold DB , UniProt , Accession A0A087YM65, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 81 aa.

						>A0A087YM65_POEFO|A0A087YM65
AVSVARMKGDTPVNSTMSVGQARKLVEQLKIEASFCRIKVSKAAADLMAYCDAHACDDPLITPVPTSENPFREKKFFCALL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	A	37.8	Very low	48.8	Very low	146 Å²	146	139.7 Å²	139.7	100%	1.207	82%	0.821	S	S	*	*				0	107.3	0	0	0	0	0	0	107.6	S3	A1-S3 PolarHBondContact O-N 3.32Å
2	V	41.5	Very low	49.1	Very low	141 Å²	141	138 Å²	138	86%	0.855	82%	0.817	S	S	*	*			trans	-87.1	105.1	175.9	179.7	0	0	0	0	106.4	V4	V2-V4 PolarHBondContact O-N 3.14Å; V2-V4 VanDerWaalsContact O-N 3.13Å
3	S	48.3	Very low	49.8	Very low	115 Å²	115	136.5 Å²	136.5	80%	0.804	81%	0.809	S	S	*	*			trans	-64.1	108.9	176.5	-58.4	0	0	0	0	109.1	A1 A5	A1-S3 PolarHBondContact O-N 3.32Å; S3-A5 PolarHBondContact O-N 2.88Å; S3-A5 VanDerWaalsContact O-N 3.12Å
4	V	51.9	Low	50.6	Low	139 Å²	139	135.1 Å²	135.1	84%	0.842	80%	0.797	S	S	*	*			trans	-75.7	100.2	169.6	-179.7	0	0	0	0	107	V2 R6	V2-V4 PolarHBondContact O-N 3.14Å; V2-V4 VanDerWaalsContact O-N 3.13Å; V4-R6 PolarHBondContact O-N 2.89Å
5	A	50.1	Low	51.5	Low	81 Å²	81	133.3 Å²	133.3	67%	0.669	79%	0.793	S	S	*	*			trans	-63.3	122.9	169.3	0	0	0	0	0	108.8	S3 M7	S3-A5 PolarHBondContact O-N 2.88Å; S3-A5 VanDerWaalsContact O-N 3.12Å; A5-M7 PolarHBondContact O-N 3.04Å
6	R	49.4	Very low	52.6	Low	236 Å²	236	132.5 Å²	132.5	89%	0.891	79%	0.79	S	S	*	*			trans	-65.6	104.9	172.4	178.6	165.9	162.4	152.5	-7.1	108.1	V4 K8	V4-R6 PolarHBondContact O-N 2.89Å; R6-K8 PolarHBondContact O-N 3.22Å
7	M	52.9	Low	53.8	Low	185 Å²	185	130.1 Å²	130.1	91%	0.911	77%	0.77	S	S	*	*			trans	-62.5	108.1	172.8	-65.2	-172	-173.5	0	0	108.6	A5 G9	A5-M7 PolarHBondContact O-N 3.04Å; M7-G9 PolarHBondContact O-N 3.1Å; M7-G9 VanDerWaalsContact O-N 3.15Å
8	K	51.6	Low	55.6	Low	178 Å²	178	126.2 Å²	126.2	77%	0.774	75%	0.751	S	S	*	*			trans	-75.6	93.2	166	-173.6	94.6	170.1	-168.6	0	106	R6 D10	R6-K8 PolarHBondContact O-N 3.22Å; K8-D10 PolarHBondContact O-N 3.25Å
9	G	44.6	Very low	57.3	Low	61 Å²	61	124.9 Å²	124.9	63%	0.629	74%	0.744	S	S	*	*			trans	-75.7	100.7	174.4	0	0	0	0	0	109.6	M7 T11	M7-G9 PolarHBondContact O-N 3.1Å; M7-G9 VanDerWaalsContact O-N 3.15Å; G9-T11 PolarHBondContact O-N 3.1Å; G9-T11 VanDerWaalsContact O-N 3.11Å
10	D	48.6	Very low	59	Low	142 Å²	142	120.9 Å²	120.9	76%	0.759	73%	0.729	S	S	*	*			trans	-78.8	80	159.8	-70.3	-33.5	0	0	0	107.4	K8	K8-D10 PolarHBondContact O-N 3.25Å
11	T	60.3	Low	60.6	Low	113 Å²	113	120.2 Å²	120.2	69%	0.693	72%	0.718	S	S	*	*			trans	-73.2	125.3	169.5	-34.2	0	0	0	0	107.5	G9 V13	G9-T11 PolarHBondContact O-N 3.1Å; G9-T11 VanDerWaalsContact O-N 3.11Å; T11-V13 PolarHBondContact O-N 3.36Å
12	P	52.6	Low	63.2	Low	119 Å²	119	115 Å²	115	77%	0.773	68%	0.676	S	S	*	*			trans	-62.4	108.5	169.8	24.6	-29.9	0	0	0	107.6	N14	P12-N14 PolarHBondContact O-N 3.06Å
13	V	57.9	Low	65.8	Low	118 Å²	118	116.6 Å²	116.6	72%	0.715	67%	0.666	S	S	*	*			trans	-64.2	100.4	172.8	165.9	0	0	0	0	106.8	T11 S15	T11-V13 PolarHBondContact O-N 3.36Å; V13-S15 PolarHBondContact O-N 3.22Å; V13-S15 PolarHBondContact O-OG 2.97Å
14	N	61.3	Low	68	Low	118 Å²	118	119 Å²	119	63%	0.631	66%	0.662	S	S	*	*			trans	-56.9	104.4	165.4	-177.2	17.5	0	0	0	107.3	P12 T16	P12-N14 PolarHBondContact O-N 3.06Å; N14-T16 PolarHBondContact O-N 3.2Å
15	S	63.8	Low	70.1	Confident	107 Å²	107	116.5 Å²	116.5	75%	0.748	64%	0.644	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.6	22.4	-161.1	-64.2	0	0	0	0	114.4	V13	V13-S15 PolarHBondContact O-N 3.22Å; V13-S15 PolarHBondContact O-OG 2.97Å
16	T	69.6	Low	72.3	Confident	121 Å²	121	116.1 Å²	116.1	74%	0.742	63%	0.632	S	S	*	*	T	Hydrogen-bonded Turn	trans	-142.8	37.1	174	62.8	0	0	0	0	113.5	N14	N14-T16 PolarHBondContact O-N 3.2Å
17	M	71.6	Confident	74.6	Confident	91 Å²	91	109.6 Å²	109.6	45%	0.448	61%	0.612	S	S	.	*			trans	-84	119.2	171.1	-138.5	157.6	84.8	0	0	110.2	Q21 A22 L25	M17-Q21 HydrophobicContact CG-CB 3.92Å; M17-A22 HydrophobicContact CE-CB 4.32Å; M17-L25 HydrophobicContact CE-CD2 3.77Å
18	S	86.8	Confident	76.7	Confident	61 Å²	61	105.2 Å²	105.2	43%	0.427	59%	0.589	S	S	.	*			trans	-61.1	149	179.1	68.1	0	0	0	0	110.6	G20 Q21 A22	S18-G20 PolarHBondContact O-N 3.07Å; S18-G20 VanDerWaalsContact O-N 3.09Å; S18-Q21 PolarHBondContact O-N 3.5Å; S18-Q21 VanDerWaalsContact OG-CG 3.31Å; S18-Q21 WeakPolarHBondContact OG-CG 3.48Å; S18-Q21 PolarHBondContact OG-N 3.49Å; S18-Q21 PolarHBondContact OG-OE1 3.25Å; S18-A22 PolarHBondContact O-N 2.81Å
19	V	88.9	Confident	78.9	Confident	102 Å²	102	100.8 Å²	100.8	62%	0.618	57%	0.574	S	S	*	*	H	α-helix	trans	-54	-34.3	177.2	177.7	0	0	0	0	111.2	R23	V19-R23 WeakPolarHBondContact O-CG 3.09Å; V19-R23 PolarHBondContact O-N 3.13Å; V19-R23 VanDerWaalsContact O-N 3.07Å
20	G	91.4	Very high	81.4	Confident	43 Å²	43	103.5 Å²	103.5	44%	0.443	57%	0.568	S	S	.	*	H	α-helix	trans	-65	-42	175.2	0	0	0	0	0	113.6	S18 K24	S18-G20 PolarHBondContact O-N 3.07Å; S18-G20 VanDerWaalsContact O-N 3.09Å; G20-K24 WeakPolarHBondContact O-CG 3.38Å; G20-K24 PolarHBondContact O-N 2.83Å
21	Q	92.3	Very high	83.7	Confident	107 Å²	107	101.1 Å²	101.1	50%	0.5	56%	0.555	S	S	.	*	H	α-helix	trans	-68.2	-41.3	175.6	-73.6	164.9	-55	0	0	111.8	M17 S18 R23 K24 L25	M17-Q21 HydrophobicContact CG-CB 3.92Å; S18-Q21 PolarHBondContact O-N 3.5Å; S18-Q21 VanDerWaalsContact OG-CG 3.31Å; S18-Q21 WeakPolarHBondContact OG-CG 3.48Å; S18-Q21 PolarHBondContact OG-N 3.49Å; S18-Q21 PolarHBondContact OG-OE1 3.25Å; Q21-R23 VanDerWaalsContact C-N 3.32Å; Q21-R23 PolarHBondContact O-N 2.87Å; Q21-K24 PolarHBondContact O-N 3.11Å; Q21-L25 PolarHBondContact O-N 2.88Å
22	A	92.7	Very high	85.4	Confident	38 Å²	38	100 Å²	100	31%	0.314	54%	0.542	S	S	.	.	H	α-helix	trans	-60	-42.3	176.8	0	0	0	0	0	111.8	M17 S18 L25 V26	M17-A22 HydrophobicContact CE-CB 4.32Å; S18-A22 PolarHBondContact O-N 2.81Å; A22-L25 PolarHBondContact O-N 3.15Å; A22-V26 WeakPolarHBondContact O-CG2 3.3Å; A22-V26 PolarHBondContact O-N 3.12Å
23	R	94.7	Very high	87.5	Confident	174 Å²	174	97.7 Å²	97.7	66%	0.657	53%	0.532	S	S	*	.	H	α-helix	trans	-62.1	-45.8	175.6	-72.9	175.8	-171.9	-80	-0	112.3	V19 Q21 L25 V26 E27	V19-R23 WeakPolarHBondContact O-CG 3.09Å; V19-R23 PolarHBondContact O-N 3.13Å; V19-R23 VanDerWaalsContact O-N 3.07Å; Q21-R23 VanDerWaalsContact C-N 3.32Å; Q21-R23 PolarHBondContact O-N 2.87Å; R23-L25 VanDerWaalsContact C-N 3.3Å; R23-L25 PolarHBondContact O-N 3.42Å; R23-V26 PolarHBondContact O-N 3.12Å; R23-E27 WeakPolarHBondContact O-CG 3.45Å; R23-E27 PolarHBondContact O-N 3.44Å
24	K	95.5	Very high	89.3	Confident	166 Å²	166	96.4 Å²	96.4	72%	0.722	53%	0.528	S	S	*	.	H	α-helix	trans	-58.5	-42.9	176.6	-72.6	-178.6	179.2	-174.9	0	111.9	G20 Q21 E27 Q28	G20-K24 WeakPolarHBondContact O-CG 3.38Å; G20-K24 PolarHBondContact O-N 2.83Å; Q21-K24 PolarHBondContact O-N 3.11Å; K24-E27 PolarHBondContact O-N 2.99Å; K24-Q28 PolarHBondContact O-N 2.92Å
25	L	95.7	Very high	90.9	Very high	86 Å²	86	97.3 Å²	97.3	45%	0.45	53%	0.527	S	S	.	.	H	α-helix	trans	-63.5	-42.7	176.7	-179.2	62.3	0	0	0	111.8	M17 Q21 A22 R23 E27 Q28 L29	M17-L25 HydrophobicContact CE-CD2 3.77Å; Q21-L25 PolarHBondContact O-N 2.88Å; A22-L25 PolarHBondContact O-N 3.15Å; R23-L25 VanDerWaalsContact C-N 3.3Å; R23-L25 PolarHBondContact O-N 3.42Å; L25-E27 VanDerWaalsContact C-N 3.35Å; L25-E27 PolarHBondContact O-N 3.48Å; L25-Q28 PolarHBondContact O-N 3.13Å; L25-L29 HydrophobicContact CD1-CD1 4.32Å; L25-L29 HydrophobicContact CD1-CG 4.25Å; L25-L29 HydrophobicContact CG-CD1 4.01Å; L25-L29 HydrophobicContact CG-CG 4.38Å; L25-L29 VanDerWaalsContact O-CG 3.31Å; L25-L29 WeakPolarHBondContact O-CG 3.38Å; L25-L29 PolarHBondContact O-N 3.5Å
26	V	96.3	Very high	92.4	Very high	72 Å²	72	98.5 Å²	98.5	44%	0.436	53%	0.534	S	S	.	.	H	α-helix	trans	-61.6	-43.1	177.3	168	0	0	0	0	111.5	A22 R23 Q28 L29 K30	A22-V26 WeakPolarHBondContact O-CG2 3.3Å; A22-V26 PolarHBondContact O-N 3.12Å; R23-V26 PolarHBondContact O-N 3.12Å; V26-Q28 VanDerWaalsContact C-N 3.34Å; V26-Q28 PolarHBondContact O-N 3.36Å; V26-L29 PolarHBondContact O-N 2.91Å; V26-K30 HydrophobicContact CG1-CD 4.39Å; V26-K30 WeakPolarHBondContact O-CG 3.15Å; V26-K30 PolarHBondContact O-N 3.26Å
27	E	97.3	Very high	93.7	Very high	100 Å²	100	102.1 Å²	102.1	47%	0.467	53%	0.534	S	S	.	.	H	α-helix	trans	-63.3	-40.8	176.7	-64.6	-47.3	125.4	0	0	111.9	R23 K24 L25 K30 I31	R23-E27 WeakPolarHBondContact O-CG 3.45Å; R23-E27 PolarHBondContact O-N 3.44Å; K24-E27 PolarHBondContact O-N 2.99Å; L25-E27 VanDerWaalsContact C-N 3.35Å; L25-E27 PolarHBondContact O-N 3.48Å; E27-K30 PolarHBondContact O-N 3.3Å; E27-K30 IonicContact OE1-NZ 3.47Å; E27-K30 PolarHBondContact OE1-NZ 3.35Å; E27-K30 IonicContact OE2-NZ 2.88Å; E27-K30 PolarHBondContact OE2-NZ 3.42Å; E27-I31 WeakPolarHBondContact O-CG1 3.32Å; E27-I31 PolarHBondContact O-N 3.42Å
28	Q	97.4	Very high	94.9	Very high	92 Å²	92	102.9 Å²	102.9	43%	0.43	54%	0.539	S	S	.	.	H	α-helix	trans	-61.4	-47.1	174	-179.3	60	26.1	0	0	112.1	K24 L25 V26 K30 I31 E32	K24-Q28 PolarHBondContact O-N 2.92Å; L25-Q28 PolarHBondContact O-N 3.13Å; V26-Q28 VanDerWaalsContact C-N 3.34Å; V26-Q28 PolarHBondContact O-N 3.36Å; Q28-K30 VanDerWaalsContact C-N 3.28Å; Q28-K30 PolarHBondContact O-N 3.15Å; Q28-I31 WeakPolarHBondContact O-CB 3.3Å; Q28-I31 PolarHBondContact O-N 2.8Å; Q28-I31 VanDerWaalsContact O-N 3.08Å; Q28-E32 WeakPolarHBondContact CG-OE1 3.39Å; Q28-E32 PolarHBondContact NE2-OE1 3.31Å; Q28-E32 PolarHBondContact O-N 3.31Å
29	L	97.2	Very high	95.4	Very high	86 Å²	86	107.9 Å²	107.9	45%	0.45	55%	0.553	S	S	.	*	H	α-helix	trans	-63.7	-33.4	-180	-71.1	172.6	0	0	0	112.5	L25 V26 I31 E32 A33	L25-L29 HydrophobicContact CD1-CD1 4.32Å; L25-L29 HydrophobicContact CD1-CG 4.25Å; L25-L29 HydrophobicContact CG-CD1 4.01Å; L25-L29 HydrophobicContact CG-CG 4.38Å; L25-L29 VanDerWaalsContact O-CG 3.31Å; L25-L29 WeakPolarHBondContact O-CG 3.38Å; L25-L29 PolarHBondContact O-N 3.5Å; V26-L29 PolarHBondContact O-N 2.91Å; L29-I31 VanDerWaalsContact C-N 3.31Å; L29-I31 PolarHBondContact O-N 2.85Å; L29-E32 PolarHBondContact O-N 3.08Å; L29-A33 WeakPolarHBondContact O-CB 3.48Å; L29-A33 PolarHBondContact O-N 2.83Å
30	K	97.6	Very high	95.9	Very high	118 Å²	118	108.9 Å²	108.9	51%	0.513	56%	0.559	S	S	.	*	H	α-helix	trans	-62.7	-39.5	173.4	-74.5	170.5	-179.5	171.3	0	111.8	V26 E27 Q28 S34	V26-K30 HydrophobicContact CG1-CD 4.39Å; V26-K30 WeakPolarHBondContact O-CG 3.15Å; V26-K30 PolarHBondContact O-N 3.26Å; E27-K30 PolarHBondContact O-N 3.3Å; E27-K30 IonicContact OE1-NZ 3.47Å; E27-K30 PolarHBondContact OE1-NZ 3.35Å; E27-K30 IonicContact OE2-NZ 2.88Å; E27-K30 PolarHBondContact OE2-NZ 3.42Å; Q28-K30 VanDerWaalsContact C-N 3.28Å; Q28-K30 PolarHBondContact O-N 3.15Å; K30-S34 PolarHBondContact O-N 3.14Å
31	I	97.1	Very high	96.2	Very high	92 Å²	92	111.1 Å²	111.1	47%	0.472	57%	0.568	S	S	.	*	H	α-helix	trans	-66.9	-47.3	175.6	-62.1	166.3	0	0	0	109.7	E27 Q28 L29 A33 S34 F35	E27-I31 WeakPolarHBondContact O-CG1 3.32Å; E27-I31 PolarHBondContact O-N 3.42Å; Q28-I31 WeakPolarHBondContact O-CB 3.3Å; Q28-I31 PolarHBondContact O-N 2.8Å; Q28-I31 VanDerWaalsContact O-N 3.08Å; L29-I31 VanDerWaalsContact C-N 3.31Å; L29-I31 PolarHBondContact O-N 2.85Å; I31-A33 VanDerWaalsContact C-N 3.28Å; I31-A33 PolarHBondContact O-N 3.27Å; I31-S34 PolarHBondContact O-N 3.32Å; I31-S34 VanDerWaalsContact O-N 3.14Å; I31-S34 PolarHBondContact O-OG 3.28Å; I31-F35 HydrophobicContact CG2-CE2 4.13Å; I31-F35 VanDerWaalsContact O-CD2 3.23Å; I31-F35 WeakPolarHBondContact O-CD2 3.44Å
32	E	96.3	Very high	96.5	Very high	90 Å²	90	111.2 Å²	111.2	42%	0.421	57%	0.567	S	S	.	*	H	α-helix	trans	-63.9	-33.5	179.3	-71.9	176.1	-163	0	0	113.1	Q28 L29 S34	Q28-E32 WeakPolarHBondContact CG-OE1 3.39Å; Q28-E32 PolarHBondContact NE2-OE1 3.31Å; Q28-E32 PolarHBondContact O-N 3.31Å; L29-E32 PolarHBondContact O-N 3.08Å; E32-S34 VanDerWaalsContact C-N 3.32Å
33	A	96.1	Very high	96.7	Very high	69 Å²	69	111 Å²	111	57%	0.57	56%	0.564	S	S	*	*	H	α-helix	trans	-70.4	-28.4	176.4	0	0	0	0	0	112.8	L29 I31 F35	L29-A33 WeakPolarHBondContact O-CB 3.48Å; L29-A33 PolarHBondContact O-N 2.83Å; I31-A33 VanDerWaalsContact C-N 3.28Å; I31-A33 PolarHBondContact O-N 3.27Å; A33-F35 VanDerWaalsContact C-N 3.29Å; A33-F35 PolarHBondContact O-N 3.06Å
34	S	95.7	Very high	96.9	Very high	91 Å²	91	104.8 Å²	104.8	64%	0.636	55%	0.551	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.6	-6	-178.2	73	0	0	0	0	113.8	K30 I31 E32 C36	K30-S34 PolarHBondContact O-N 3.14Å; I31-S34 PolarHBondContact O-N 3.32Å; I31-S34 VanDerWaalsContact O-N 3.14Å; I31-S34 PolarHBondContact O-OG 3.28Å; E32-S34 VanDerWaalsContact C-N 3.32Å; S34-C36 PolarHBondContact O-N 3.17Å
35	F	94.9	Very high	97	Very high	138 Å²	138	99.4 Å²	99.4	61%	0.605	54%	0.537	S	S	*	.	S	Bend	trans	-66.5	124.2	174.4	-80.6	-88.7	0	0	0	112.1	I31 A33 R37	I31-F35 HydrophobicContact CG2-CE2 4.13Å; I31-F35 VanDerWaalsContact O-CD2 3.23Å; I31-F35 WeakPolarHBondContact O-CD2 3.44Å; A33-F35 VanDerWaalsContact C-N 3.29Å; A33-F35 PolarHBondContact O-N 3.06Å; F35-R37 PolarHBondContact O-N 3.34Å
36	C	95.6	Very high	97.2	Very high	132 Å²	132	99 Å²	99	89%	0.892	54%	0.535	S	S	*	.			trans	-67.5	110.6	169	-75.4	0	0	0	0	110.2	S34	S34-C36 PolarHBondContact O-N 3.17Å
37	R	96.4	Very high	97.2	Very high	196 Å²	196	101.2 Å²	101.2	74%	0.74	54%	0.544	S	S	*	.	P	Polyproline II helix	trans	-83.2	144.4	174.4	-63.8	178.2	-176.1	75.8	3.1	110.3	F35	F35-R37 PolarHBondContact O-N 3.34Å
38	I	97.2	Very high	97.3	Very high	108 Å²	108	102.1 Å²	102.1	55%	0.554	55%	0.55	S	S	*	.	P	Polyproline II helix	trans	-87.2	159.2	167.9	62.5	172.4	0	0	0	110.5	A43	I38-A43 HydrophobicContact CD1-CB 3.76Å; I38-A43 HydrophobicContact CG1-CB 4.27Å
39	K	98.1	Very high	97.3	Very high	166 Å²	166	100.6 Å²	100.6	72%	0.722	55%	0.553	S	S	*	*	P	Polyproline II helix	trans	-63.8	137.5	174.1	-68.4	-177.7	-179.3	174.2	0	109.9	S41 K42 A43	K39-S41 PolarHBondContact O-N 3.31Å; K39-K42 HydrophobicContact CB-CB 4.36Å; K39-K42 WeakPolarHBondContact O-CB 3.34Å; K39-K42 PolarHBondContact O-N 3.08Å; K39-A43 PolarHBondContact O-N 2.89Å
40	V	98.3	Very high	97.3	Very high	123 Å²	123	103.4 Å²	103.4	75%	0.745	56%	0.558	S	S	*	*	H	α-helix	trans	-57.9	-39.4	177.1	179.3	0	0	0	0	111.2	K42 A43 A44	V40-K42 VanDerWaalsContact C-N 3.26Å; V40-K42 PolarHBondContact O-N 3.06Å; V40-A43 PolarHBondContact O-N 3.25Å; V40-A44 WeakPolarHBondContact O-CB 3.28Å; V40-A44 PolarHBondContact O-N 3.15Å
41	S	98	Very high	97.3	Very high	89 Å²	89	101.4 Å²	101.4	62%	0.622	56%	0.558	S	S	*	*	H	α-helix	trans	-60.5	-34.9	176.2	61.8	0	0	0	0	113.1	K39 A45	K39-S41 PolarHBondContact O-N 3.31Å; S41-A45 WeakPolarHBondContact O-CB 3.38Å; S41-A45 PolarHBondContact O-N 2.98Å; S41-A45 VanDerWaalsContact O-N 3.12Å
42	K	98	Very high	97.2	Very high	110 Å²	110	102.5 Å²	102.5	48%	0.478	57%	0.565	S	S	.	*	H	α-helix	trans	-71.8	-48.2	175.3	177.3	171.6	168.9	42	0	110.8	K39 V40 A44 A45 D46	K39-K42 HydrophobicContact CB-CB 4.36Å; K39-K42 WeakPolarHBondContact O-CB 3.34Å; K39-K42 PolarHBondContact O-N 3.08Å; V40-K42 VanDerWaalsContact C-N 3.26Å; V40-K42 PolarHBondContact O-N 3.06Å; K42-A44 VanDerWaalsContact C-N 3.26Å; K42-A44 PolarHBondContact O-N 3.04Å; K42-A45 PolarHBondContact O-N 2.87Å; K42-A45 VanDerWaalsContact O-N 3.17Å; K42-D46 IonicContact NZ-OD1 2.71Å; K42-D46 PolarHBondContact NZ-OD1 2.92Å; K42-D46 VanDerWaalsContact NZ-OD1 3.08Å; K42-D46 IonicContact NZ-OD2 3.08Å; K42-D46 PolarHBondContact NZ-OD2 3.4Å; K42-D46 PolarHBondContact O-N 2.97Å
43	A	98.3	Very high	97.2	Very high	32 Å²	32	101.4 Å²	101.4	26%	0.264	57%	0.572	S	S	.	*	H	α-helix	trans	-57.2	-42.3	177.5	0	0	0	0	0	111.7	I38 K39 V40 D46 L47	I38-A43 HydrophobicContact CD1-CB 3.76Å; I38-A43 HydrophobicContact CG1-CB 4.27Å; K39-A43 PolarHBondContact O-N 2.89Å; V40-A43 PolarHBondContact O-N 3.25Å; A43-D46 PolarHBondContact O-N 3.09Å; A43-L47 VanDerWaalsContact O-CG 3.32Å; A43-L47 WeakPolarHBondContact O-CG 3.47Å; A43-L47 PolarHBondContact O-N 3.03Å
44	A	98.3	Very high	97.2	Very high	45 Å²	45	102.1 Å²	102.1	37%	0.372	56%	0.563	S	S	.	*	H	α-helix	trans	-63.5	-44.6	176.3	0	0	0	0	0	112.1	V40 K42 D46 L47 M48	V40-A44 WeakPolarHBondContact O-CB 3.28Å; V40-A44 PolarHBondContact O-N 3.15Å; K42-A44 VanDerWaalsContact C-N 3.26Å; K42-A44 PolarHBondContact O-N 3.04Å; A44-D46 VanDerWaalsContact C-N 3.35Å; A44-D46 PolarHBondContact O-N 3.22Å; A44-L47 PolarHBondContact O-N 3.11Å; A44-M48 WeakPolarHBondContact O-CG 3.21Å; A44-M48 PolarHBondContact O-N 3.46Å
45	A	98.3	Very high	97.1	Very high	53 Å²	53	99.4 Å²	99.4	44%	0.438	55%	0.546	S	S	.	.	H	α-helix	trans	-62.7	-42	176.5	0	0	0	0	0	112.1	S41 K42 L47 M48 A49	S41-A45 WeakPolarHBondContact O-CB 3.38Å; S41-A45 PolarHBondContact O-N 2.98Å; S41-A45 VanDerWaalsContact O-N 3.12Å; K42-A45 PolarHBondContact O-N 2.87Å; K42-A45 VanDerWaalsContact O-N 3.17Å; A45-L47 VanDerWaalsContact C-N 3.33Å; A45-L47 PolarHBondContact O-N 2.93Å; A45-M48 PolarHBondContact O-N 2.86Å; A45-A49 WeakPolarHBondContact O-CB 3.43Å; A45-A49 PolarHBondContact O-N 2.88Å
46	D	98.1	Very high	96.9	Very high	76 Å²	76	97.5 Å²	97.5	41%	0.406	55%	0.549	S	S	.	.	H	α-helix	trans	-64.2	-39	177.9	-64.1	-16.1	0	0	0	110.6	K42 A43 A44 Y50	K42-D46 IonicContact NZ-OD1 2.71Å; K42-D46 PolarHBondContact NZ-OD1 2.92Å; K42-D46 VanDerWaalsContact NZ-OD1 3.08Å; K42-D46 IonicContact NZ-OD2 3.08Å; K42-D46 PolarHBondContact NZ-OD2 3.4Å; K42-D46 PolarHBondContact O-N 2.97Å; A43-D46 PolarHBondContact O-N 3.09Å; A44-D46 VanDerWaalsContact C-N 3.35Å; A44-D46 PolarHBondContact O-N 3.22Å; D46-Y50 PolarHBondContact O-N 3.01Å; D46-Y50 VanDerWaalsContact O-N 3.09Å
47	L	98.3	Very high	96.7	Very high	120 Å²	120	97.2 Å²	97.2	63%	0.628	54%	0.538	S	S	*	.	H	α-helix	trans	-66	-45.7	174	-73	173.6	0	0	0	112.6	A43 A44 A45 Y50 C51	A43-L47 VanDerWaalsContact O-CG 3.32Å; A43-L47 WeakPolarHBondContact O-CG 3.47Å; A43-L47 PolarHBondContact O-N 3.03Å; A44-L47 PolarHBondContact O-N 3.11Å; A45-L47 VanDerWaalsContact C-N 3.33Å; A45-L47 PolarHBondContact O-N 2.93Å; L47-Y50 PolarHBondContact O-N 2.91Å; L47-C51 PolarHBondContact O-N 3.32Å; L47-C51 PolarHBondContact O-SG 3.17Å
48	M	97.5	Very high	96.6	Very high	119 Å²	119	90.9 Å²	90.9	59%	0.586	52%	0.519	S	S	*	.	H	α-helix	trans	-60.3	-47.6	177.3	-72.3	177.9	68	0	0	111	A44 A45 Y50 C51 D52	A44-M48 WeakPolarHBondContact O-CG 3.21Å; A44-M48 PolarHBondContact O-N 3.46Å; A45-M48 PolarHBondContact O-N 2.86Å; M48-Y50 VanDerWaalsContact C-N 3.26Å; M48-Y50 PolarHBondContact O-N 3.33Å; M48-C51 PolarHBondContact O-N 3.5Å; M48-C51 VanDerWaalsContact O-N 3.15Å; M48-D52 WeakPolarHBondContact O-CB 3.32Å; M48-D52 VanDerWaalsContact O-CG 3.26Å; M48-D52 PolarHBondContact O-N 3.24Å
49	A	98	Very high	96.4	Very high	59 Å²	59	89.2 Å²	89.2	49%	0.488	52%	0.516	S	S	.	.	H	α-helix	trans	-59	-38.7	177.9	0	0	0	0	0	112.1	A45 A53	A45-A49 WeakPolarHBondContact O-CB 3.43Å; A45-A49 PolarHBondContact O-N 2.88Å; A49-A53 VanDerWaalsContact O-CB 3.28Å; A49-A53 WeakPolarHBondContact O-CB 3.35Å; A49-A53 PolarHBondContact O-N 3.38Å; A49-A53 VanDerWaalsContact O-N 3.08Å
50	Y	98.1	Very high	96.1	Very high	145 Å²	145	88.9 Å²	88.9	57%	0.569	52%	0.521	S	S	*	.	H	α-helix	trans	-64.6	-47.9	175.1	-178.6	-96.1	0	0	0	111.8	D46 L47 M48 A53 H54	D46-Y50 PolarHBondContact O-N 3.01Å; D46-Y50 VanDerWaalsContact O-N 3.09Å; L47-Y50 PolarHBondContact O-N 2.91Å; M48-Y50 VanDerWaalsContact C-N 3.26Å; M48-Y50 PolarHBondContact O-N 3.33Å; Y50-A53 PolarHBondContact O-N 2.86Å; Y50-H54 AromaticContact CD2-CE1 3.59Å; Y50-H54 AromaticContact CD2-ND1 3.76Å; Y50-H54 AromaticContact CE2-CE1 3.32Å; Y50-H54 WeakPolarHBondContact CE2-CE1 3.32Å; Y50-H54 AromaticContact CE2-ND1 3.65Å; Y50-H54 AromaticContact CE2-NE2 3.92Å; Y50-H54 AromaticContact CZ-CE1 3.95Å; Y50-H54 AromaticContact CZ-ND1 3.93Å; Y50-H54 PolarHBondContact O-N 2.83Å; Y50-H54 PolarHBondContact O-ND1 2.89Å
51	C	97.3	Very high	95.8	Very high	76 Å²	76	88.5 Å²	88.5	51%	0.514	51%	0.513	S	S	.	.	H	α-helix	trans	-61.4	-47.2	177.9	-69.6	0	0	0	0	111.7	L47 M48 A53 H54 A55	L47-C51 PolarHBondContact O-N 3.32Å; L47-C51 PolarHBondContact O-SG 3.17Å; M48-C51 PolarHBondContact O-N 3.5Å; M48-C51 VanDerWaalsContact O-N 3.15Å; C51-A53 VanDerWaalsContact C-N 3.29Å; C51-A53 PolarHBondContact O-N 3Å; C51-H54 PolarHBondContact O-N 3.47Å; C51-H54 VanDerWaalsContact O-N 3.14Å; C51-A55 VanDerWaalsContact O-CB 3.32Å; C51-A55 WeakPolarHBondContact O-CB 3.21Å; C51-A55 PolarHBondContact O-N 3Å
52	D	95.3	Very high	95.5	Very high	115 Å²	115	87.1 Å²	87.1	62%	0.615	50%	0.501	S	S	*	.	H	α-helix	trans	-61.6	-38.2	-179.4	-67.9	-19.5	0	0	0	111.9	M48 H54	M48-D52 WeakPolarHBondContact O-CB 3.32Å; M48-D52 VanDerWaalsContact O-CG 3.26Å; M48-D52 PolarHBondContact O-N 3.24Å; D52-H54 VanDerWaalsContact C-N 3.3Å; D52-H54 PolarHBondContact O-N 3.14Å
53	A	96.4	Very high	95	Very high	68 Å²	68	87.4 Å²	87.4	56%	0.562	51%	0.514	S	S	*	.	H	α-helix	trans	-68	-26.3	178.3	0	0	0	0	0	113.7	A49 Y50 C51	A49-A53 VanDerWaalsContact O-CB 3.28Å; A49-A53 WeakPolarHBondContact O-CB 3.35Å; A49-A53 PolarHBondContact O-N 3.38Å; A49-A53 VanDerWaalsContact O-N 3.08Å; Y50-A53 PolarHBondContact O-N 2.86Å; C51-A53 VanDerWaalsContact C-N 3.29Å; C51-A53 PolarHBondContact O-N 3Å
54	H	95.9	Very high	94.6	Very high	84 Å²	84	88.5 Å²	88.5	39%	0.389	52%	0.518	S	S	.	.	H	α-helix	trans	-114.7	-3.5	-174.4	-59.8	82.8	0	0	0	113.7	Y50 C51 D52 C56 D57 D58	Y50-H54 AromaticContact CD2-CE1 3.59Å; Y50-H54 AromaticContact CD2-ND1 3.76Å; Y50-H54 AromaticContact CE2-CE1 3.32Å; Y50-H54 WeakPolarHBondContact CE2-CE1 3.32Å; Y50-H54 AromaticContact CE2-ND1 3.65Å; Y50-H54 AromaticContact CE2-NE2 3.92Å; Y50-H54 AromaticContact CZ-CE1 3.95Å; Y50-H54 AromaticContact CZ-ND1 3.93Å; Y50-H54 PolarHBondContact O-N 2.83Å; Y50-H54 PolarHBondContact O-ND1 2.89Å; C51-H54 PolarHBondContact O-N 3.47Å; C51-H54 VanDerWaalsContact O-N 3.14Å; D52-H54 VanDerWaalsContact C-N 3.3Å; D52-H54 PolarHBondContact O-N 3.14Å; H54-C56 PolarHBondContact O-N 3.29Å; H54-D57 PolarHBondContact O-N 3.38Å; H54-D58 PolarHBondContact O-N 3.5Å
55	A	93.2	Very high	94.2	Very high	33 Å²	33	89.9 Å²	89.9	27%	0.273	52%	0.523	S	S	.	.	T	Hydrogen-bonded Turn	trans	-60.6	-33.9	-176.8	0	0	0	0	0	113	C51 D57 T62	C51-A55 VanDerWaalsContact O-CB 3.32Å; C51-A55 WeakPolarHBondContact O-CB 3.21Å; C51-A55 PolarHBondContact O-N 3Å; A55-D57 VanDerWaalsContact C-N 3.29Å; A55-D57 PolarHBondContact O-N 3.35Å; A55-T62 PolarHBondContact O-OG1 3.08Å
56	C	90.4	Very high	93.6	Very high	99 Å²	99	91.5 Å²	91.5	67%	0.669	53%	0.527	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69.8	-27.7	177.6	-62.5	0	0	0	0	112.8	H54	H54-C56 PolarHBondContact O-N 3.29Å
57	D	92.1	Very high	93	Very high	125 Å²	125	92.7 Å²	92.7	67%	0.668	54%	0.542	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.9	-10.5	-176.6	-63.3	-26.7	0	0	0	112.5	H54 A55 P59	H54-D57 PolarHBondContact O-N 3.38Å; A55-D57 VanDerWaalsContact C-N 3.29Å; A55-D57 PolarHBondContact O-N 3.35Å; D57-P59 WeakPolarHBondContact O-CD 3.31Å
58	D	94.5	Very high	92.5	Very high	63 Å²	63	93.1 Å²	93.1	34%	0.337	54%	0.54	S	S	.	.			trans	-83.8	109.3	176.3	-172.9	-26.2	0	0	0	110.3	H54 L60 I61 T62	H54-D58 PolarHBondContact O-N 3.5Å; D58-L60 PolarHBondContact O-N 3.37Å; D58-L60 VanDerWaalsContact O-N 3.11Å; D58-L60 VanDerWaalsContact OD1-CB 3.3Å; D58-L60 WeakPolarHBondContact OD1-CB 3.23Å; D58-L60 PolarHBondContact OD1-N 3.34Å; D58-I61 HydrophobicContact CB-CB 4.09Å; D58-I61 HydrophobicContact CB-CG1 4Å; D58-I61 PolarHBondContact O-N 2.91Å; D58-I61 VanDerWaalsContact O-N 3.13Å; D58-I61 PolarHBondContact OD1-N 2.96Å; D58-I61 WeakPolarHBondContact OD2-CG1 3.33Å; D58-T62 PolarHBondContact O-N 2.99Å
59	P	92.1	Very high	92.1	Very high	74 Å²	74	90.3 Å²	90.3	48%	0.481	53%	0.528	S	S	.	.	T	Hydrogen-bonded Turn	trans	-65.7	-15.5	-177.6	-21.7	36.4	0	0	0	114.3	D57 T62 V64	D57-P59 WeakPolarHBondContact O-CD 3.31Å; P59-T62 CarbonylContact C-O 3.52Å; P59-T62 WeakPolarHBondContact CA-O 3.42Å; P59-V64 HydrophobicContact CB-CG1 3.84Å; P59-V64 HydrophobicContact CB-CG2 4.3Å; P59-V64 HydrophobicContact CG-CG1 4.28Å
60	L	91.6	Very high	91.7	Very high	159 Å²	159	93.1 Å²	93.1	83%	0.832	54%	0.541	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.4	-26.8	178.5	-56.5	-179.8	0	0	0	112.1	D58	D58-L60 PolarHBondContact O-N 3.37Å; D58-L60 VanDerWaalsContact O-N 3.11Å; D58-L60 VanDerWaalsContact OD1-CB 3.3Å; D58-L60 WeakPolarHBondContact OD1-CB 3.23Å; D58-L60 PolarHBondContact OD1-N 3.34Å
61	I	92.8	Very high	91.2	Very high	115 Å²	115	95.3 Å²	95.3	59%	0.59	55%	0.554	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.8	-45.7	176.4	-57.1	-63.8	0	0	0	110.2	D58 P63	D58-I61 HydrophobicContact CB-CB 4.09Å; D58-I61 HydrophobicContact CB-CG1 4Å; D58-I61 PolarHBondContact O-N 2.91Å; D58-I61 VanDerWaalsContact O-N 3.13Å; D58-I61 PolarHBondContact OD1-N 2.96Å; D58-I61 WeakPolarHBondContact OD2-CG1 3.33Å; I61-P63 WeakPolarHBondContact O-CD 3.45Å
62	T	91	Very high	90.6	Very high	60 Å²	60	96.9 Å²	96.9	37%	0.368	55%	0.549	S	S	.	.	T	Hydrogen-bonded Turn	trans	-108.6	102.5	176.1	-56.4	0	0	0	0	108.9	A55 D58 P59 V64	A55-T62 PolarHBondContact O-OG1 3.08Å; D58-T62 PolarHBondContact O-N 2.99Å; P59-T62 CarbonylContact C-O 3.52Å; P59-T62 WeakPolarHBondContact CA-O 3.42Å; T62-V64 PolarHBondContact O-N 3.19Å
63	P	88.2	Confident	89.9	Confident	115 Å²	115	99.6 Å²	99.6	75%	0.747	56%	0.558	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.9	125.5	-175.5	-24	33.6	0	0	0	111.9	I61	I61-P63 WeakPolarHBondContact O-CD 3.45Å
64	V	89.8	Confident	88.9	Confident	56 Å²	56	104.6 Å²	104.6	34%	0.339	57%	0.567	S	S	.	*	P	Polyproline II helix	trans	-78.7	153.8	174.6	-64.3	0	0	0	0	111.3	P59 T62 E68 N69	P59-V64 HydrophobicContact CB-CG1 3.84Å; P59-V64 HydrophobicContact CB-CG2 4.3Å; P59-V64 HydrophobicContact CG-CG1 4.28Å; T62-V64 PolarHBondContact O-N 3.19Å; V64-E68 HydrophobicContact CB-CB 4.45Å; V64-N69 HydrophobicContact CG2-CB 4.27Å
65	P	89.6	Confident	87.7	Confident	73 Å²	73	107.8 Å²	107.8	47%	0.474	58%	0.58	S	S	.	*	P	Polyproline II helix	trans	-53.9	147.1	172.6	-24.2	33.9	0	0	0	111.5	S67 E68 N69	P65-S67 PolarHBondContact O-N 3.42Å; P65-S67 VanDerWaalsContact O-N 3.1Å; P65-E68 PolarHBondContact O-N 3.27Å; P65-N69 PolarHBondContact O-N 3.34Å
66	T	84.8	Confident	86.3	Confident	87 Å²	87	115 Å²	115	53%	0.534	61%	0.605	S	S	.	*	T	Hydrogen-bonded Turn	trans	-59.4	-32.8	-175.8	-26.3	0	0	0	0	111.9	E68 N69 R72	T66-E68 VanDerWaalsContact C-N 3.26Å; T66-E68 PolarHBondContact O-N 3.4Å; T66-N69 PolarHBondContact O-N 3.01Å; T66-R72 HydrophobicContact CG2-CB 3.99Å; T66-R72 HydrophobicContact CG2-CG 3.51Å; T66-R72 WeakPolarHBondContact O-CB 3.44Å; T66-R72 WeakPolarHBondContact O-CD 3.37Å
67	S	85.9	Confident	84.5	Confident	102 Å²	102	119.5 Å²	119.5	71%	0.713	61%	0.614	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.5	-30.7	176.9	47.9	0	0	0	0	114.1	P65	P65-S67 PolarHBondContact O-N 3.42Å; P65-S67 VanDerWaalsContact O-N 3.1Å
68	E	87.1	Confident	82.4	Confident	129 Å²	129	118.5 Å²	118.5	60%	0.603	62%	0.616	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.3	-21.4	179.2	-66.3	178.8	-162.7	0	0	111.8	V64 P65 T66 P70	V64-E68 HydrophobicContact CB-CB 4.45Å; P65-E68 PolarHBondContact O-N 3.27Å; T66-E68 VanDerWaalsContact C-N 3.26Å; T66-E68 PolarHBondContact O-N 3.4Å; E68-P70 WeakPolarHBondContact O-CD 3.31Å
69	N	90.4	Very high	80.8	Confident	59 Å²	59	119.3 Å²	119.3	32%	0.316	63%	0.631	S	S	.	*			trans	-69.1	112.5	176.1	-176.3	-5.3	0	0	0	111	V64 P65 T66 F71 R72	V64-N69 HydrophobicContact CG2-CB 4.27Å; P65-N69 PolarHBondContact O-N 3.34Å; T66-N69 PolarHBondContact O-N 3.01Å; N69-F71 PolarHBondContact O-N 3.07Å; N69-F71 VanDerWaalsContact O-N 3.15Å; N69-F71 WeakPolarHBondContact OD1-CA 3.32Å; N69-F71 WeakPolarHBondContact OD1-CB 3.48Å; N69-F71 PolarHBondContact OD1-N 3.07Å; N69-R72 VanDerWaalsContact O-CB 3.3Å; N69-R72 WeakPolarHBondContact O-CB 3.47Å; N69-R72 PolarHBondContact O-N 3.09Å
70	P	88.6	Confident	79.2	Confident	119 Å²	119	123.7 Å²	123.7	77%	0.773	65%	0.649	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.8	-21.7	179	-19.2	33.5	0	0	0	113.4	E68 R72	E68-P70 WeakPolarHBondContact O-CD 3.31Å; P70-R72 VanDerWaalsContact C-N 3.33Å
71	F	88.6	Confident	77.3	Confident	190 Å²	190	127.2 Å²	127.2	83%	0.833	67%	0.668	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.4	9.6	178.5	-56.7	-77.9	0	0	0	113.3	N69	N69-F71 PolarHBondContact O-N 3.07Å; N69-F71 VanDerWaalsContact O-N 3.15Å; N69-F71 WeakPolarHBondContact OD1-CA 3.32Å; N69-F71 WeakPolarHBondContact OD1-CB 3.48Å; N69-F71 PolarHBondContact OD1-N 3.07Å
72	R	84.4	Confident	76.5	Confident	110 Å²	110	127.8 Å²	127.8	42%	0.415	67%	0.672	S	S	.	*			trans	-62.4	138.9	174.5	176.7	176.4	-174.4	-102.6	11.6	111.4	T66 N69 P70 K74	T66-R72 HydrophobicContact CG2-CB 3.99Å; T66-R72 HydrophobicContact CG2-CG 3.51Å; T66-R72 WeakPolarHBondContact O-CB 3.44Å; T66-R72 WeakPolarHBondContact O-CD 3.37Å; N69-R72 VanDerWaalsContact O-CB 3.3Å; N69-R72 WeakPolarHBondContact O-CB 3.47Å; N69-R72 PolarHBondContact O-N 3.09Å; P70-R72 VanDerWaalsContact C-N 3.33Å; R72-K74 PolarHBondContact O-N 2.94Å
73	E	81.2	Confident	75.7	Confident	172 Å²	172	131.4 Å²	131.4	80%	0.804	69%	0.688	S	S	*	*			trans	-56.8	121.9	168.3	-68.3	-176.6	-178.8	0	0	111.2	K75	E73-K75 PolarHBondContact O-N 2.99Å
74	K	75.9	Confident	75	Confident	172 Å²	172	132.3 Å²	132.3	75%	0.748	68%	0.684	S	S	*	*			trans	-68.9	107.6	169.9	-68.4	179.1	-177.3	176.2	0	107.3	R72 F76	R72-K74 PolarHBondContact O-N 2.94Å; K74-F76 VanDerWaalsContact C-N 3.32Å; K74-F76 PolarHBondContact O-N 3.26Å
75	K	68.8	Low	74.2	Confident	151 Å²	151	136.8 Å²	136.8	66%	0.657	71%	0.705	S	S	*	*			trans	-62.1	99.4	165.7	-68.8	-165	177.7	-172.1	0	107.3	E73 F77	E73-K75 PolarHBondContact O-N 2.99Å; K75-F77 PolarHBondContact O-N 3.47Å; K75-F77 VanDerWaalsContact O-N 3.14Å
76	F	64.9	Low	73.2	Confident	185 Å²	185	140.8 Å²	140.8	81%	0.811	72%	0.719	S	S	*	*			trans	-65.7	110	163	-68.9	-80.8	0	0	0	106	K74 C78	K74-F76 VanDerWaalsContact C-N 3.32Å; K74-F76 PolarHBondContact O-N 3.26Å; F76-C78 PolarHBondContact O-N 2.8Å
77	F	53	Low	72.4	Confident	194 Å²	194	144.3 Å²	144.3	85%	0.851	73%	0.731	S	S	*	*			trans	-67.6	93	167.1	-60.1	-83.7	0	0	0	106.5	K75 A79	K75-F77 PolarHBondContact O-N 3.47Å; K75-F77 VanDerWaalsContact O-N 3.14Å; F77-A79 VanDerWaalsContact C-N 3.29Å; F77-A79 PolarHBondContact O-N 2.71Å
78	C	47.7	Very low	71.5	Confident	104 Å²	104	147.4 Å²	147.4	70%	0.703	73%	0.733	S	S	*	*			trans	-69.7	96.3	162.4	-173.5	0	0	0	0	106.3	F76 L80	F76-C78 PolarHBondContact O-N 2.8Å; C78-L80 PolarHBondContact O-N 3.2Å
79	A	60.6	Low	70.3	Confident	80 Å²	80	148.8 Å²	148.8	66%	0.661	74%	0.743	S	S	*	*			trans	-73.5	105.2	155.9	0	0	0	0	0	105.9	F77 L81	F77-A79 VanDerWaalsContact C-N 3.29Å; F77-A79 PolarHBondContact O-N 2.71Å; A79-L81 PolarHBondContact O-N 3.26Å; A79-L81 VanDerWaalsContact O-N 3.1Å
80	L	57.6	Low	68.6	Low	165 Å²	165	156.3 Å²	156.3	86%	0.864	78%	0.778	S	S	*	*			trans	-67	102.6	159.5	-74.1	166.5	0	0	0	106	C78	C78-L80 PolarHBondContact O-N 3.2Å
81	L	52.2	Low	66.8	Low	233 Å²	233	159.6 Å²	159.6	100%	1.22	78%	0.779	S	S	*	*			trans	-83.8	0	167.1	-95.3	154.4	0	0	0	109.5	A79	A79-L81 PolarHBondContact O-N 3.26Å; A79-L81 VanDerWaalsContact O-N 3.1Å

Retrieved 81 of 81 residues in 13.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).