A0A087YMX1_POEFO Loading...

Transcription and mRNA export factor ENY2

Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. The transcription regulatory histone acetylation (HAT) complex SAGA is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histones. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery. Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. The transcription regulatory histone acetylation (HAT) complex SAGA is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates to a subcomplex that specifically deubiquitinates histones. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery.

AlphaFold DB , UniProt , Accession A0A087YMX1, Species POEFO (Poecilia formosa, Amazon molly), Gene ENY2, Length 95 aa.

						>A0A087YMX1_POEFO|A0A087YMX1|ENY2
MNKEARLKASINQKLTETGERDRLKELLRAKLTECGWKDQMKAQCKDVIKQKGLEHVTVEDLVVEVTPKGRALVPDSVKKELLQRIRAFLTQHAS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	65.3	Low	91.3	Very high	167 Å²	167	111.6 Å²	111.6	82%	0.823	56%	0.563	S	S	*	*				0	124.3	0	-87	168.8	56	0	0	109.7	R6	M1-R6 HydrophobicContact CB-CG 4.4Å; M1-R6 HydrophobicContact CE-CG 3.65Å
2	N	92.3	Very high	91.7	Very high	115 Å²	115	108.8 Å²	108.8	62%	0.615	55%	0.551	S	S	*	*			trans	-66.9	153.2	174.9	-173	3.1	0	0	0	111	E4 A5 R6	N2-E4 PolarHBondContact O-N 3.08Å; N2-A5 WeakPolarHBondContact O-CB 3.36Å; N2-A5 PolarHBondContact O-N 3.32Å; N2-R6 PolarHBondContact O-N 3.4Å
3	K	91.5	Very high	92	Very high	178 Å²	178	109 Å²	109	77%	0.774	55%	0.549	S	S	*	.	H	α-helix	trans	-51.5	-40.6	178.4	-174.6	176.8	179.2	179.9	0	112.4	R6 L7	K3-R6 PolarHBondContact O-N 2.93Å; K3-L7 PolarHBondContact O-N 3.43Å
4	E	93.3	Very high	92.3	Very high	145 Å²	145	105.9 Å²	105.9	68%	0.678	53%	0.53	S	S	*	.	H	α-helix	trans	-62.1	-43.4	176.7	-171.2	-174.6	165.5	0	0	112.5	N2 R6 L7 K8	N2-E4 PolarHBondContact O-N 3.08Å; E4-R6 VanDerWaalsContact C-N 3.33Å; E4-R6 PolarHBondContact O-N 2.99Å; E4-L7 PolarHBondContact O-N 3.06Å; E4-K8 WeakPolarHBondContact O-CB 3.27Å; E4-K8 PolarHBondContact O-N 3.49Å
5	A	94.8	Very high	92.6	Very high	46 Å²	46	99.7 Å²	99.7	38%	0.38	50%	0.499	S	S	.	.	H	α-helix	trans	-64.7	-37.9	178.2	0	0	0	0	0	111.8	N2 A9	N2-A5 WeakPolarHBondContact O-CB 3.36Å; N2-A5 PolarHBondContact O-N 3.32Å; A5-A9 WeakPolarHBondContact O-CB 3.47Å; A5-A9 PolarHBondContact O-N 2.97Å
6	R	94.2	Very high	92.9	Very high	162 Å²	162	97.9 Å²	97.9	61%	0.611	50%	0.495	S	S	*	.	H	α-helix	trans	-63.4	-45.1	173.5	-74.2	178.7	-177.3	170.7	2.8	111.8	M1 N2 K3 E4 A9 S10	M1-R6 HydrophobicContact CB-CG 4.4Å; M1-R6 HydrophobicContact CE-CG 3.65Å; N2-R6 PolarHBondContact O-N 3.4Å; K3-R6 PolarHBondContact O-N 2.93Å; E4-R6 VanDerWaalsContact C-N 3.33Å; E4-R6 PolarHBondContact O-N 2.99Å; R6-A9 PolarHBondContact O-N 3.22Å; R6-S10 PolarHBondContact O-N 2.97Å
7	L	93.1	Very high	93.1	Very high	110 Å²	110	100.4 Å²	100.4	58%	0.576	51%	0.505	S	S	*	.	H	α-helix	trans	-61.3	-47.2	177.5	179.1	61	0	0	0	111.3	K3 E4 A9 S10 I11	K3-L7 PolarHBondContact O-N 3.43Å; E4-L7 PolarHBondContact O-N 3.06Å; L7-A9 VanDerWaalsContact C-N 3.32Å; L7-A9 PolarHBondContact O-N 2.87Å; L7-S10 PolarHBondContact O-N 3.35Å; L7-I11 HydrophobicContact CD1-CD1 4.11Å; L7-I11 HydrophobicContact CD1-CG1 4.4Å; L7-I11 HydrophobicContact CG-CD1 4Å; L7-I11 WeakPolarHBondContact O-CG1 3.43Å; L7-I11 PolarHBondContact O-N 3.47Å
8	K	94.1	Very high	93.3	Very high	141 Å²	141	97.8 Å²	97.8	61%	0.613	50%	0.495	S	S	*	.	H	α-helix	trans	-60.4	-41	177.3	-172.2	176.2	-178.2	177.8	0	112.2	E4 N12	E4-K8 WeakPolarHBondContact O-CB 3.27Å; E4-K8 PolarHBondContact O-N 3.49Å; K8-N12 WeakPolarHBondContact O-CB 3.4Å; K8-N12 PolarHBondContact O-N 2.83Å; K8-N12 PolarHBondContact O-ND2 3.38Å
9	A	95.8	Very high	93.6	Very high	49 Å²	49	93.9 Å²	93.9	41%	0.405	48%	0.482	S	S	.	.	H	α-helix	trans	-63	-46.8	176.3	0	0	0	0	0	111.7	A5 R6 L7 I11 N12 Q13	A5-A9 WeakPolarHBondContact O-CB 3.47Å; A5-A9 PolarHBondContact O-N 2.97Å; R6-A9 PolarHBondContact O-N 3.22Å; L7-A9 VanDerWaalsContact C-N 3.32Å; L7-A9 PolarHBondContact O-N 2.87Å; A9-I11 PolarHBondContact O-N 2.96Å; A9-N12 PolarHBondContact O-N 3.32Å; A9-Q13 WeakPolarHBondContact O-CB 3.48Å; A9-Q13 PolarHBondContact O-N 3.37Å
10	S	94.7	Very high	93.8	Very high	71 Å²	71	90.1 Å²	90.1	50%	0.497	46%	0.462	S	S	.	.	H	α-helix	trans	-61.5	-42.5	177.8	177.2	0	0	0	0	112.5	R6 L7 Q13 K14	R6-S10 PolarHBondContact O-N 2.97Å; L7-S10 PolarHBondContact O-N 3.35Å; S10-Q13 PolarHBondContact O-N 3.49Å; S10-K14 WeakPolarHBondContact O-CB 3.42Å; S10-K14 PolarHBondContact O-N 3.23Å
11	I	95.1	Very high	94	Very high	44 Å²	44	93.1 Å²	93.1	23%	0.226	47%	0.467	C	S	.	.	H	α-helix	trans	-60.1	-48.9	174.2	-71.1	168.1	0	0	0	110.8	L7 A9 Q13 K14 L15 L90	L7-I11 HydrophobicContact CD1-CD1 4.11Å; L7-I11 HydrophobicContact CD1-CG1 4.4Å; L7-I11 HydrophobicContact CG-CD1 4Å; L7-I11 WeakPolarHBondContact O-CG1 3.43Å; L7-I11 PolarHBondContact O-N 3.47Å; A9-I11 PolarHBondContact O-N 2.96Å; I11-Q13 VanDerWaalsContact C-N 3.33Å; I11-Q13 PolarHBondContact O-N 3.16Å; I11-K14 PolarHBondContact O-N 3.06Å; I11-L15 HydrophobicContact CG2-CD1 3.88Å; I11-L15 HydrophobicContact CG2-CG 4.39Å; I11-L15 WeakPolarHBondContact O-CG 3.23Å; I11-L15 PolarHBondContact O-N 2.91Å; I11-L90 HydrophobicContact CD1-CD1 4.08Å; I11-L90 HydrophobicContact CG1-CD1 4.28Å; I11-L90 HydrophobicContact CG1-CD2 4.06Å; I11-L90 HydrophobicContact CG2-CD1 4.23Å; I11-L90 HydrophobicContact CG2-CD2 4.14Å
12	N	96	Very high	95.5	Very high	77 Å²	77	89.7 Å²	89.7	41%	0.412	45%	0.452	S	S	.	.	H	α-helix	trans	-63.6	-38	-179.5	-78.3	-28.7	0	0	0	112.8	K8 A9 T16	K8-N12 WeakPolarHBondContact O-CB 3.4Å; K8-N12 PolarHBondContact O-N 2.83Å; K8-N12 PolarHBondContact O-ND2 3.38Å; A9-N12 PolarHBondContact O-N 3.32Å; N12-T16 WeakPolarHBondContact O-CB 3.25Å; N12-T16 PolarHBondContact O-N 2.8Å; N12-T16 VanDerWaalsContact O-N 3.08Å; N12-T16 PolarHBondContact O-OG1 3.38Å
13	Q	96.3	Very high	95.8	Very high	112 Å²	112	91 Å²	91	52%	0.523	45%	0.449	S	S	.	.	H	α-helix	trans	-60.1	-52.2	174.5	179.7	175.8	5.1	0	0	110	A9 S10 I11 L15 T16 E17	A9-Q13 WeakPolarHBondContact O-CB 3.48Å; A9-Q13 PolarHBondContact O-N 3.37Å; S10-Q13 PolarHBondContact O-N 3.49Å; I11-Q13 VanDerWaalsContact C-N 3.33Å; I11-Q13 PolarHBondContact O-N 3.16Å; Q13-L15 PolarHBondContact O-N 2.61Å; Q13-T16 WeakPolarHBondContact O-CA 3.42Å; Q13-T16 WeakPolarHBondContact O-CB 3.21Å; Q13-T16 PolarHBondContact O-N 2.84Å; Q13-E17 HydrophobicContact CG-CG 4.3Å; Q13-E17 WeakPolarHBondContact CG-OE1 3.37Å; Q13-E17 PolarHBondContact NE2-OE1 3.35Å; Q13-E17 WeakPolarHBondContact O-CG 3.34Å; Q13-E17 PolarHBondContact O-N 3.28Å
14	K	95.9	Very high	96.2	Very high	66 Å²	66	83.4 Å²	83.4	29%	0.287	42%	0.416	S	S	.	.	H	α-helix	trans	-59.8	-42.5	179.6	-169.1	170.6	-171.5	161.5	0	113.2	S10 I11 T16 T18 F89 H93	S10-K14 WeakPolarHBondContact O-CB 3.42Å; S10-K14 PolarHBondContact O-N 3.23Å; I11-K14 PolarHBondContact O-N 3.06Å; K14-T16 PolarHBondContact O-N 3.42Å; K14-T18 WeakPolarHBondContact O-CB 3.34Å; K14-T18 WeakPolarHBondContact O-CG2 3.38Å; K14-T18 PolarHBondContact O-N 3.34Å; K14-T18 VanDerWaalsContact O-N 3.15Å; K14-T18 PolarHBondContact O-OG1 3.45Å; K14-F89 HydrophobicContact CD-CE1 4.36Å; K14-F89 HydrophobicContact CG-CE1 4.04Å; K14-F89 HydrophobicContact CG-CZ 4.12Å; K14-H93 PolarHBondContact NZ-O 3.15Å
15	L	96.8	Very high	96.4	Very high	12 Å²	12	82.3 Å²	82.3	6%	0.063	41%	0.409	C	S	.	.	H	α-helix	trans	-62.1	-33.9	175	-71.8	171.1	0	0	0	112.1	I11 Q13 E20 R21 L24 F89	I11-L15 HydrophobicContact CG2-CD1 3.88Å; I11-L15 HydrophobicContact CG2-CG 4.39Å; I11-L15 WeakPolarHBondContact O-CG 3.23Å; I11-L15 PolarHBondContact O-N 2.91Å; Q13-L15 PolarHBondContact O-N 2.61Å; L15-E20 HydrophobicContact CD2-CB 3.92Å; L15-E20 HydrophobicContact CD2-CG 3.66Å; L15-E20 PolarHBondContact O-N 3.12Å; L15-E20 VanDerWaalsContact O-N 3.07Å; L15-R21 HydrophobicContact CB-CB 4.28Å; L15-R21 WeakPolarHBondContact O-CB 3.04Å; L15-R21 PolarHBondContact O-N 3.47Å; L15-L24 HydrophobicContact CD2-CD1 4.16Å; L15-F89 HydrophobicContact CD2-CD1 3.51Å; L15-F89 HydrophobicContact CD2-CE1 3.62Å; L15-F89 HydrophobicContact CD2-CG 4.19Å; L15-F89 HydrophobicContact CD2-CZ 4.37Å; L15-F89 HydrophobicContact CG-CE1 4.3Å
16	T	97.6	Very high	96.6	Very high	72 Å²	72	86 Å²	86	44%	0.442	42%	0.419	S	S	.	.	H	α-helix	trans	-76.2	-49.2	179.9	-56	0	0	0	0	110.9	N12 Q13 K14 T18 G19	N12-T16 WeakPolarHBondContact O-CB 3.25Å; N12-T16 PolarHBondContact O-N 2.8Å; N12-T16 VanDerWaalsContact O-N 3.08Å; N12-T16 PolarHBondContact O-OG1 3.38Å; Q13-T16 WeakPolarHBondContact O-CA 3.42Å; Q13-T16 WeakPolarHBondContact O-CB 3.21Å; Q13-T16 PolarHBondContact O-N 2.84Å; K14-T16 PolarHBondContact O-N 3.42Å; T16-T18 VanDerWaalsContact C-N 3.3Å; T16-T18 PolarHBondContact O-N 2.94Å; T16-G19 PolarHBondContact O-N 3.27Å; T16-G19 VanDerWaalsContact O-N 3.1Å
17	E	96.8	Very high	96.8	Very high	140 Å²	140	79.4 Å²	79.4	65%	0.654	40%	0.396	S	S	*	.	H	α-helix	trans	-65.5	-30.7	-176.8	-70.3	170.9	174.1	0	0	113.3	Q13 G19	Q13-E17 HydrophobicContact CG-CG 4.3Å; Q13-E17 WeakPolarHBondContact CG-OE1 3.37Å; Q13-E17 PolarHBondContact NE2-OE1 3.35Å; Q13-E17 WeakPolarHBondContact O-CG 3.34Å; Q13-E17 PolarHBondContact O-N 3.28Å; E17-G19 VanDerWaalsContact C-N 3.33Å
18	T	96.7	Very high	97	Very high	53 Å²	53	77 Å²	77	33%	0.325	38%	0.383	S	S	.	.	T	Hydrogen-bonded Turn	trans	-85.4	-4.5	176.7	56.9	0	0	0	0	113.8	K14 T16 E20 F89	K14-T18 WeakPolarHBondContact O-CB 3.34Å; K14-T18 WeakPolarHBondContact O-CG2 3.38Å; K14-T18 PolarHBondContact O-N 3.34Å; K14-T18 VanDerWaalsContact O-N 3.15Å; K14-T18 PolarHBondContact O-OG1 3.45Å; T16-T18 VanDerWaalsContact C-N 3.3Å; T16-T18 PolarHBondContact O-N 2.94Å; T18-E20 PolarHBondContact O-N 3.29Å; T18-F89 HydrophobicContact CG2-CE2 4.31Å; T18-F89 HydrophobicContact CG2-CZ 3.92Å; T18-F89 VanDerWaalsContact OG1-CZ 3.22Å; T18-F89 WeakPolarHBondContact OG1-CZ 3.33Å
19	G	97.5	Very high	97.3	Very high	24 Å²	24	77.3 Å²	77.3	25%	0.247	38%	0.38	C	S	.	.	S	Bend	trans	71	3	-173.1	0	0	0	0	0	114.5	T16 E17 R21 D22 R23	T16-G19 PolarHBondContact O-N 3.27Å; T16-G19 VanDerWaalsContact O-N 3.1Å; E17-G19 VanDerWaalsContact C-N 3.33Å; G19-R21 PolarHBondContact O-N 3.08Å; G19-D22 PolarHBondContact O-N 2.85Å; G19-D22 VanDerWaalsContact O-N 3.14Å; G19-R23 PolarHBondContact O-N 3.35Å
20	E	97.8	Very high	97.4	Very high	18 Å²	18	76.9 Å²	76.9	8%	0.084	38%	0.377	C	S	.	.	H	α-helix	trans	-62.4	-32	179.6	-175.1	60.1	-158.1	0	0	111.7	L15 T18 D22 R23 L24 F89	L15-E20 HydrophobicContact CD2-CB 3.92Å; L15-E20 HydrophobicContact CD2-CG 3.66Å; L15-E20 PolarHBondContact O-N 3.12Å; L15-E20 VanDerWaalsContact O-N 3.07Å; T18-E20 PolarHBondContact O-N 3.29Å; E20-D22 VanDerWaalsContact C-N 3.28Å; E20-D22 PolarHBondContact O-N 3.04Å; E20-R23 PolarHBondContact O-N 3.45Å; E20-R23 IonicContact OE2-NH1 2.61Å; E20-L24 HydrophobicContact CG-CD1 4.08Å; E20-L24 HydrophobicContact CG-CG 4.26Å; E20-L24 WeakPolarHBondContact O-CB 3.16Å; E20-L24 VanDerWaalsContact O-CG 3.28Å; E20-L24 WeakPolarHBondContact O-CG 3.36Å; E20-L24 PolarHBondContact O-N 3.18Å; E20-F89 HydrophobicContact CB-CD2 4.01Å; E20-F89 HydrophobicContact CB-CE2 3.82Å; E20-F89 HydrophobicContact CB-CZ 4.19Å; E20-F89 HydrophobicContact CG-CB 4.35Å; E20-F89 HydrophobicContact CG-CD1 4.42Å; E20-F89 HydrophobicContact CG-CD2 3.65Å; E20-F89 HydrophobicContact CG-CE2 4.02Å; E20-F89 HydrophobicContact CG-CG 3.88Å
21	R	97.9	Very high	97.6	Very high	153 Å²	153	76 Å²	76	58%	0.577	36%	0.364	S	S	*	.	H	α-helix	trans	-57.9	-40.9	174.9	-177.1	176	174.7	-179.3	-3.4	112.2	L15 G19 K25	L15-R21 HydrophobicContact CB-CB 4.28Å; L15-R21 WeakPolarHBondContact O-CB 3.04Å; L15-R21 PolarHBondContact O-N 3.47Å; G19-R21 PolarHBondContact O-N 3.08Å; R21-K25 WeakPolarHBondContact O-CB 3.17Å; R21-K25 PolarHBondContact O-N 3.25Å
22	D	98.4	Very high	97.7	Very high	96 Å²	96	74.8 Å²	74.8	51%	0.513	36%	0.358	S	S	.	.	H	α-helix	trans	-72.7	-40	179.4	-71.3	-32.9	0	0	0	111.1	G19 E20 L24 K25 E26	G19-D22 PolarHBondContact O-N 2.85Å; G19-D22 VanDerWaalsContact O-N 3.14Å; E20-D22 VanDerWaalsContact C-N 3.28Å; E20-D22 PolarHBondContact O-N 3.04Å; D22-L24 VanDerWaalsContact C-N 3.33Å; D22-L24 PolarHBondContact O-N 3.34Å; D22-K25 WeakPolarHBondContact O-CB 3.41Å; D22-K25 PolarHBondContact O-N 3.14Å; D22-K25 VanDerWaalsContact O-N 3.13Å; D22-E26 WeakPolarHBondContact O-CG 3.47Å; D22-E26 PolarHBondContact O-N 3.38Å
23	R	98.3	Very high	97.8	Very high	143 Å²	143	74.2 Å²	74.2	54%	0.54	36%	0.357	S	S	.	.	H	α-helix	trans	-60.3	-41.6	173.1	-59.5	-179.4	-154.9	178.4	3.2	112.3	G19 E20 E26 L27	G19-R23 PolarHBondContact O-N 3.35Å; E20-R23 PolarHBondContact O-N 3.45Å; E20-R23 IonicContact OE2-NH1 2.61Å; R23-E26 PolarHBondContact O-N 3.05Å; R23-L27 WeakPolarHBondContact O-CB 3.37Å; R23-L27 PolarHBondContact O-N 3.37Å
24	L	98.4	Very high	97.9	Very high	17 Å²	17	75.7 Å²	75.7	9%	0.089	36%	0.364	C	S	.	.	H	α-helix	trans	-65.8	-37.9	175.2	-71.2	169.4	0	0	0	111.8	L15 E20 D22 L27 L28 L82 R85 I86	L15-L24 HydrophobicContact CD2-CD1 4.16Å; E20-L24 HydrophobicContact CG-CD1 4.08Å; E20-L24 HydrophobicContact CG-CG 4.26Å; E20-L24 WeakPolarHBondContact O-CB 3.16Å; E20-L24 VanDerWaalsContact O-CG 3.28Å; E20-L24 WeakPolarHBondContact O-CG 3.36Å; E20-L24 PolarHBondContact O-N 3.18Å; D22-L24 VanDerWaalsContact C-N 3.33Å; D22-L24 PolarHBondContact O-N 3.34Å; L24-L27 PolarHBondContact O-N 3.04Å; L24-L28 WeakPolarHBondContact O-CB 3.28Å; L24-L28 PolarHBondContact O-N 3.3Å; L24-L82 HydrophobicContact CB-CD2 4.24Å; L24-L82 HydrophobicContact CD2-CD2 3.81Å; L24-R85 HydrophobicContact CD2-CB 3.75Å; L24-I86 HydrophobicContact CD1-CD1 4.33Å; L24-I86 HydrophobicContact CD1-CG1 3.65Å; L24-I86 HydrophobicContact CD2-CG1 4.32Å
25	K	98.4	Very high	98	Very high	123 Å²	123	75 Å²	75	54%	0.535	37%	0.367	S	S	.	.	H	α-helix	trans	-65.7	-41.1	176	-176.4	-178.1	178.1	-175.2	0	111.6	R21 D22 R29	R21-K25 WeakPolarHBondContact O-CB 3.17Å; R21-K25 PolarHBondContact O-N 3.25Å; D22-K25 WeakPolarHBondContact O-CB 3.41Å; D22-K25 PolarHBondContact O-N 3.14Å; D22-K25 VanDerWaalsContact O-N 3.13Å; K25-R29 WeakPolarHBondContact O-CB 3.49Å; K25-R29 PolarHBondContact O-N 3.22Å
26	E	98.6	Very high	98.1	Very high	123 Å²	123	75.3 Å²	75.3	58%	0.575	37%	0.373	S	S	*	.	H	α-helix	trans	-65	-46.9	174.7	-73.1	178.6	167.2	0	0	111.7	D22 R23 L28 R29 A30	D22-E26 WeakPolarHBondContact O-CG 3.47Å; D22-E26 PolarHBondContact O-N 3.38Å; R23-E26 PolarHBondContact O-N 3.05Å; E26-L28 PolarHBondContact O-N 2.91Å; E26-R29 WeakPolarHBondContact O-CB 3.32Å; E26-R29 PolarHBondContact O-N 2.92Å; E26-R29 VanDerWaalsContact O-N 3.15Å; E26-A30 PolarHBondContact O-N 3.02Å
27	L	98.4	Very high	98.1	Very high	24 Å²	24	74.7 Å²	74.7	13%	0.126	36%	0.363	C	S	.	.	H	α-helix	trans	-56.5	-48.8	175	177.3	64.2	0	0	0	111.5	R23 L24 R29 A30 K31 L82 R85	R23-L27 WeakPolarHBondContact O-CB 3.37Å; R23-L27 PolarHBondContact O-N 3.37Å; L24-L27 PolarHBondContact O-N 3.04Å; L27-R29 VanDerWaalsContact C-N 3.31Å; L27-R29 PolarHBondContact O-N 3.39Å; L27-A30 PolarHBondContact O-N 3.19Å; L27-K31 HydrophobicContact CD1-CG 4.11Å; L27-K31 HydrophobicContact CG-CG 4.42Å; L27-K31 VanDerWaalsContact O-CG 3.28Å; L27-K31 WeakPolarHBondContact O-CG 3.45Å; L27-K31 PolarHBondContact O-N 3.23Å; L27-L82 HydrophobicContact CD2-CD2 4.11Å; L27-L82 HydrophobicContact CG-CD2 4.49Å; L27-R85 HydrophobicContact CD2-CG 4.27Å
28	L	98.6	Very high	98.2	Very high	59 Å²	59	73.9 Å²	73.9	31%	0.309	36%	0.357	S	S	.	.	H	α-helix	trans	-57.3	-45.7	176.9	175	60	0	0	0	111	L24 E26 A30 K31 L32 V78 L82	L24-L28 WeakPolarHBondContact O-CB 3.28Å; L24-L28 PolarHBondContact O-N 3.3Å; E26-L28 PolarHBondContact O-N 2.91Å; L28-A30 PolarHBondContact O-N 3.45Å; L28-K31 PolarHBondContact O-N 3.02Å; L28-L32 HydrophobicContact CD1-CD1 3.76Å; L28-L32 HydrophobicContact CD1-CD2 4.25Å; L28-L32 HydrophobicContact CD1-CG 3.76Å; L28-L32 HydrophobicContact CG-CD1 3.94Å; L28-L32 HydrophobicContact CG-CG 4.3Å; L28-L32 WeakPolarHBondContact O-CB 3.29Å; L28-L32 VanDerWaalsContact O-CG 3.27Å; L28-L32 WeakPolarHBondContact O-CG 3.38Å; L28-L32 PolarHBondContact O-N 3.46Å; L28-V78 HydrophobicContact CD1-CG1 3.72Å; L28-L82 HydrophobicContact CB-CD1 3.96Å; L28-L82 HydrophobicContact CB-CD2 4.39Å; L28-L82 HydrophobicContact CD1-CD1 3.67Å; L28-L82 HydrophobicContact CD2-CD1 4.39Å; L28-L82 HydrophobicContact CG-CD1 4.19Å
29	R	98.5	Very high	98.3	Very high	148 Å²	148	76.4 Å²	76.4	56%	0.558	37%	0.368	S	S	*	.	H	α-helix	trans	-61.5	-43.1	178.9	-176.5	-173.7	-70	140.4	-8.1	112	K25 E26 L27 T33	K25-R29 WeakPolarHBondContact O-CB 3.49Å; K25-R29 PolarHBondContact O-N 3.22Å; E26-R29 WeakPolarHBondContact O-CB 3.32Å; E26-R29 PolarHBondContact O-N 2.92Å; E26-R29 VanDerWaalsContact O-N 3.15Å; L27-R29 VanDerWaalsContact C-N 3.31Å; L27-R29 PolarHBondContact O-N 3.39Å; R29-T33 PolarHBondContact O-N 2.84Å; R29-T33 VanDerWaalsContact O-N 3.1Å; R29-T33 PolarHBondContact O-OG1 3.47Å
30	A	98.5	Very high	98.3	Very high	40 Å²	40	79.5 Å²	79.5	33%	0.331	38%	0.377	S	S	.	.	H	α-helix	trans	-59.9	-52.8	175.9	0	0	0	0	0	110.3	E26 L27 L28 L32 T33 E34	E26-A30 PolarHBondContact O-N 3.02Å; L27-A30 PolarHBondContact O-N 3.19Å; L28-A30 PolarHBondContact O-N 3.45Å; A30-L32 PolarHBondContact O-N 2.93Å; A30-T33 CarbonylContact O-C 3.6Å; A30-T33 WeakPolarHBondContact O-CA 3.25Å; A30-T33 WeakPolarHBondContact O-CB 3.37Å; A30-T33 PolarHBondContact O-N 3.34Å; A30-E34 WeakPolarHBondContact O-CG 3.4Å; A30-E34 PolarHBondContact O-N 3.49Å
31	K	98.4	Very high	98.3	Very high	51 Å²	51	79.7 Å²	79.7	22%	0.222	38%	0.378	C	S	.	.	H	α-helix	trans	-60.7	-41.2	-178.8	-66.3	-73.7	169.2	158.2	0	113.4	L27 L28 T33 E34 C35 V78 E81	L27-K31 HydrophobicContact CD1-CG 4.11Å; L27-K31 HydrophobicContact CG-CG 4.42Å; L27-K31 VanDerWaalsContact O-CG 3.28Å; L27-K31 WeakPolarHBondContact O-CG 3.45Å; L27-K31 PolarHBondContact O-N 3.23Å; L28-K31 PolarHBondContact O-N 3.02Å; K31-T33 VanDerWaalsContact C-N 3.26Å; K31-T33 PolarHBondContact O-N 2.98Å; K31-E34 PolarHBondContact O-N 3.32Å; K31-C35 WeakPolarHBondContact O-CB 3.15Å; K31-C35 PolarHBondContact O-N 3.45Å; K31-C35 PolarHBondContact O-SG 2.97Å; K31-V78 HydrophobicContact CB-CG1 3.91Å; K31-V78 HydrophobicContact CB-CG2 4.08Å; K31-E81 WeakPolarHBondContact CE-OE1 3.44Å; K31-E81 VanDerWaalsContact CE-OE2 3.23Å; K31-E81 WeakPolarHBondContact CE-OE2 3.42Å; K31-E81 IonicContact NZ-OE1 3.81Å; K31-E81 PolarHBondContact NZ-OE1 3.04Å; K31-E81 IonicContact NZ-OE2 2.87Å; K31-E81 PolarHBondContact NZ-OE2 3.3Å
32	L	98.6	Very high	98.3	Very high	20 Å²	20	78.6 Å²	78.6	11%	0.105	38%	0.377	C	S	.	.	H	α-helix	trans	-68.1	-25.5	175.3	-68.8	-180	0	0	0	112.9	L28 A30 W37 K38 V74	L28-L32 HydrophobicContact CD1-CD1 3.76Å; L28-L32 HydrophobicContact CD1-CD2 4.25Å; L28-L32 HydrophobicContact CD1-CG 3.76Å; L28-L32 HydrophobicContact CG-CD1 3.94Å; L28-L32 HydrophobicContact CG-CG 4.3Å; L28-L32 WeakPolarHBondContact O-CB 3.29Å; L28-L32 VanDerWaalsContact O-CG 3.27Å; L28-L32 WeakPolarHBondContact O-CG 3.38Å; L28-L32 PolarHBondContact O-N 3.46Å; A30-L32 PolarHBondContact O-N 2.93Å; L32-W37 HydrophobicContact CB-CB 4.19Å; L32-W37 HydrophobicContact CB-CD2 4.31Å; L32-W37 HydrophobicContact CB-CE3 3.93Å; L32-W37 HydrophobicContact CB-CG 4.45Å; L32-W37 HydrophobicContact CD1-CD2 4.2Å; L32-W37 HydrophobicContact CD1-CE3 3.91Å; L32-W37 HydrophobicContact CD1-CZ3 4.12Å; L32-W37 HydrophobicContact CD2-CB 3.94Å; L32-W37 HydrophobicContact CD2-CD2 3.97Å; L32-W37 HydrophobicContact CD2-CE3 4.38Å; L32-W37 HydrophobicContact CD2-CG 3.76Å; L32-W37 HydrophobicContact CG-CD2 4.39Å; L32-W37 HydrophobicContact CG-CE3 4.3Å; L32-W37 VanDerWaalsContact O-CB 3.29Å; L32-W37 WeakPolarHBondContact O-CB 3.49Å; L32-W37 PolarHBondContact O-N 3.15Å; L32-K38 PolarHBondContact O-N 3.4Å; L32-K38 VanDerWaalsContact O-N 3.14Å; L32-V74 HydrophobicContact CD2-CG1 4.22Å; L32-V74 HydrophobicContact CD2-CG2 4.27Å
33	T	98.4	Very high	98.3	Very high	65 Å²	65	76.1 Å²	76.1	40%	0.399	37%	0.37	S	S	.	.	H	α-helix	trans	-78	-48.4	173.1	-55.4	0	0	0	0	109.9	R29 A30 K31 C35 G36	R29-T33 PolarHBondContact O-N 2.84Å; R29-T33 VanDerWaalsContact O-N 3.1Å; R29-T33 PolarHBondContact O-OG1 3.47Å; A30-T33 CarbonylContact O-C 3.6Å; A30-T33 WeakPolarHBondContact O-CA 3.25Å; A30-T33 WeakPolarHBondContact O-CB 3.37Å; A30-T33 PolarHBondContact O-N 3.34Å; K31-T33 VanDerWaalsContact C-N 3.26Å; K31-T33 PolarHBondContact O-N 2.98Å; T33-C35 PolarHBondContact O-N 2.95Å; T33-G36 PolarHBondContact O-N 3.36Å
34	E	98.1	Very high	98.2	Very high	142 Å²	142	72 Å²	72	66%	0.664	36%	0.357	S	S	*	.	H	α-helix	trans	-60.1	-39.8	-179.9	-71.8	167.4	-169.8	0	0	113.1	A30 K31 G36	A30-E34 WeakPolarHBondContact O-CG 3.4Å; A30-E34 PolarHBondContact O-N 3.49Å; K31-E34 PolarHBondContact O-N 3.32Å; E34-G36 PolarHBondContact O-N 3.32Å
35	C	97.8	Very high	98.1	Very high	53 Å²	53	72.5 Å²	72.5	36%	0.358	36%	0.362	S	S	.	.	T	Hydrogen-bonded Turn	trans	-82.3	4.6	177.9	76.1	0	0	0	0	113.8	K31 T33 W37 P75	K31-C35 WeakPolarHBondContact O-CB 3.15Å; K31-C35 PolarHBondContact O-N 3.45Å; K31-C35 PolarHBondContact O-SG 2.97Å; T33-C35 PolarHBondContact O-N 2.95Å; C35-W37 VanDerWaalsContact C-N 3.27Å; C35-W37 PolarHBondContact O-N 2.61Å; C35-P75 HydrophobicContact CB-CG 4.47Å
36	G	98.3	Very high	98	Very high	18 Å²	18	72 Å²	72	19%	0.186	36%	0.36	C	S	.	.	T	Hydrogen-bonded Turn	trans	76.1	5.4	178.2	0	0	0	0	0	115.1	T33 E34 K38 D39 Q40	T33-G36 PolarHBondContact O-N 3.36Å; E34-G36 PolarHBondContact O-N 3.32Å; G36-K38 VanDerWaalsContact C-N 3.27Å; G36-K38 PolarHBondContact O-N 2.91Å; G36-D39 PolarHBondContact O-N 3.37Å; G36-Q40 WeakPolarHBondContact O-CG 3.37Å; G36-Q40 PolarHBondContact O-N 2.87Å
37	W	98.6	Very high	97.9	Very high	58 Å²	58	69.2 Å²	69.2	22%	0.22	35%	0.349	C	S	.	.	H	α-helix	trans	-57	-41.4	179.1	176.5	96.8	0	0	0	111.9	L32 C35 D39 Q40 M41 G70	L32-W37 HydrophobicContact CB-CB 4.19Å; L32-W37 HydrophobicContact CB-CD2 4.31Å; L32-W37 HydrophobicContact CB-CE3 3.93Å; L32-W37 HydrophobicContact CB-CG 4.45Å; L32-W37 HydrophobicContact CD1-CD2 4.2Å; L32-W37 HydrophobicContact CD1-CE3 3.91Å; L32-W37 HydrophobicContact CD1-CZ3 4.12Å; L32-W37 HydrophobicContact CD2-CB 3.94Å; L32-W37 HydrophobicContact CD2-CD2 3.97Å; L32-W37 HydrophobicContact CD2-CE3 4.38Å; L32-W37 HydrophobicContact CD2-CG 3.76Å; L32-W37 HydrophobicContact CG-CD2 4.39Å; L32-W37 HydrophobicContact CG-CE3 4.3Å; L32-W37 VanDerWaalsContact O-CB 3.29Å; L32-W37 WeakPolarHBondContact O-CB 3.49Å; L32-W37 PolarHBondContact O-N 3.15Å; C35-W37 VanDerWaalsContact C-N 3.27Å; C35-W37 PolarHBondContact O-N 2.61Å; W37-D39 VanDerWaalsContact C-N 3.32Å; W37-D39 PolarHBondContact O-N 3.21Å; W37-Q40 PolarHBondContact O-N 3.5Å; W37-M41 HydrophobicContact CD2-CG 3.8Å; W37-M41 HydrophobicContact CE3-CG 4.03Å; W37-M41 HydrophobicContact CG-CG 4.5Å; W37-M41 HydrophobicContact CH2-CG 3.77Å; W37-M41 HydrophobicContact CZ2-CG 3.54Å; W37-M41 HydrophobicContact CZ2-SD 4.19Å; W37-M41 HydrophobicContact CZ3-CG 4.01Å; W37-M41 WeakPolarHBondContact O-CB 3.17Å; W37-M41 WeakPolarHBondContact O-CG 3.44Å; W37-M41 PolarHBondContact O-N 3.02Å; W37-G70 PolarHBondContact NE1-O 3.01Å
38	K	97.9	Very high	97.8	Very high	123 Å²	123	68.1 Å²	68.1	54%	0.535	34%	0.343	S	S	.	.	H	α-helix	trans	-59.9	-42.5	179.4	-174.8	-179	179.1	-174.8	0	112.1	L32 G36 M41 K42	L32-K38 PolarHBondContact O-N 3.4Å; L32-K38 VanDerWaalsContact O-N 3.14Å; G36-K38 VanDerWaalsContact C-N 3.27Å; G36-K38 PolarHBondContact O-N 2.91Å; K38-M41 PolarHBondContact O-N 3.3Å; K38-K42 PolarHBondContact O-N 3.1Å
39	D	98.3	Very high	97.7	Very high	106 Å²	106	67.8 Å²	67.8	57%	0.567	34%	0.341	S	S	*	.	H	α-helix	trans	-73.3	-39.3	-178.8	-66.6	-34.3	0	0	0	111.6	G36 W37 M41 K42 A43	G36-D39 PolarHBondContact O-N 3.37Å; W37-D39 VanDerWaalsContact C-N 3.32Å; W37-D39 PolarHBondContact O-N 3.21Å; D39-M41 VanDerWaalsContact C-N 3.32Å; D39-M41 PolarHBondContact O-N 3.11Å; D39-K42 PolarHBondContact O-N 2.94Å; D39-A43 PolarHBondContact O-N 3.31Å
40	Q	97.9	Very high	97.6	Very high	90 Å²	90	68.4 Å²	68.4	42%	0.421	35%	0.348	S	S	.	.	H	α-helix	trans	-59.2	-44.1	172	-68.8	175.8	34.1	0	0	111.3	G36 W37 K42 A43 Q44 L73	G36-Q40 WeakPolarHBondContact O-CG 3.37Å; G36-Q40 PolarHBondContact O-N 2.87Å; W37-Q40 PolarHBondContact O-N 3.5Å; Q40-K42 PolarHBondContact O-N 3.44Å; Q40-A43 WeakPolarHBondContact O-CB 3.35Å; Q40-A43 PolarHBondContact O-N 2.91Å; Q40-Q44 WeakPolarHBondContact O-CG 3.47Å; Q40-Q44 PolarHBondContact O-N 3.41Å; Q40-L73 HydrophobicContact CB-CD1 4.2Å
41	M	98	Very high	97.4	Very high	21 Å²	21	73.9 Å²	73.9	10%	0.103	37%	0.366	C	S	.	.	H	α-helix	trans	-63.3	-41	176.2	-75	-55	-62.3	0	0	112.7	W37 K38 D39 A43 Q44 C45 V66 G70 L73	W37-M41 HydrophobicContact CD2-CG 3.8Å; W37-M41 HydrophobicContact CE3-CG 4.03Å; W37-M41 HydrophobicContact CG-CG 4.5Å; W37-M41 HydrophobicContact CH2-CG 3.77Å; W37-M41 HydrophobicContact CZ2-CG 3.54Å; W37-M41 HydrophobicContact CZ2-SD 4.19Å; W37-M41 HydrophobicContact CZ3-CG 4.01Å; W37-M41 WeakPolarHBondContact O-CB 3.17Å; W37-M41 WeakPolarHBondContact O-CG 3.44Å; W37-M41 PolarHBondContact O-N 3.02Å; K38-M41 PolarHBondContact O-N 3.3Å; D39-M41 VanDerWaalsContact C-N 3.32Å; D39-M41 PolarHBondContact O-N 3.11Å; M41-A43 VanDerWaalsContact C-N 3.31Å; M41-A43 PolarHBondContact O-N 3.1Å; M41-Q44 PolarHBondContact O-N 2.64Å; M41-C45 PolarHBondContact O-N 2.87Å; M41-C45 PolarHBondContact O-SG 3.43Å; M41-V66 HydrophobicContact CE-CB 3.75Å; M41-V66 HydrophobicContact CE-CG2 3.74Å; M41-G70 WeakPolarHBondContact SD-CA 3.42Å; M41-L73 HydrophobicContact SD-CD1 4.26Å
42	K	97.8	Very high	97.2	Very high	130 Å²	130	75.9 Å²	75.9	57%	0.565	38%	0.375	S	S	*	.	H	α-helix	trans	-62.2	-39.6	174.9	-171.9	178.6	-177.5	-179.7	0	111.7	K38 D39 Q40 K46	K38-K42 PolarHBondContact O-N 3.1Å; D39-K42 PolarHBondContact O-N 2.94Å; Q40-K42 PolarHBondContact O-N 3.44Å; K42-K46 WeakPolarHBondContact O-CG 3.15Å; K42-K46 PolarHBondContact O-N 3.1Å; K42-K46 VanDerWaalsContact O-N 3.15Å
43	A	97.7	Very high	97	Very high	44 Å²	44	76.1 Å²	76.1	36%	0.364	38%	0.383	S	S	.	.	H	α-helix	trans	-64	-47.7	175.2	0	0	0	0	0	111.3	D39 Q40 M41 C45 K46 D47	D39-A43 PolarHBondContact O-N 3.31Å; Q40-A43 WeakPolarHBondContact O-CB 3.35Å; Q40-A43 PolarHBondContact O-N 2.91Å; M41-A43 VanDerWaalsContact C-N 3.31Å; M41-A43 PolarHBondContact O-N 3.1Å; A43-C45 VanDerWaalsContact C-N 3.32Å; A43-C45 PolarHBondContact O-N 2.95Å; A43-K46 WeakPolarHBondContact O-CB 3.47Å; A43-K46 PolarHBondContact O-N 3.3Å; A43-D47 PolarHBondContact O-N 2.97Å
44	Q	96.4	Very high	96.7	Very high	56 Å²	56	79.6 Å²	79.6	26%	0.262	40%	0.398	S	S	.	.	H	α-helix	trans	-57.8	-42.7	176.4	-69.1	-61.5	-51.4	0	0	112.4	Q40 M41 K46 D47 V48 K69	Q40-Q44 WeakPolarHBondContact O-CG 3.47Å; Q40-Q44 PolarHBondContact O-N 3.41Å; M41-Q44 PolarHBondContact O-N 2.64Å; Q44-K46 VanDerWaalsContact C-N 3.34Å; Q44-K46 PolarHBondContact O-N 3.37Å; Q44-D47 PolarHBondContact O-N 2.78Å; Q44-V48 WeakPolarHBondContact O-CG2 3.28Å; Q44-V48 PolarHBondContact O-N 3.35Å; Q44-V48 VanDerWaalsContact O-N 3.08Å; Q44-K69 HydrophobicContact CG-CD 4.4Å; Q44-K69 VanDerWaalsContact OE1-CD 3.29Å
45	C	97.1	Very high	96.5	Very high	29 Å²	29	81.7 Å²	81.7	20%	0.196	41%	0.408	C	S	.	.	H	α-helix	trans	-60.6	-42.9	175.3	-69.3	0	0	0	0	112.3	M41 A43 D47 V48 I49 L62	M41-C45 PolarHBondContact O-N 2.87Å; M41-C45 PolarHBondContact O-SG 3.43Å; A43-C45 VanDerWaalsContact C-N 3.32Å; A43-C45 PolarHBondContact O-N 2.95Å; C45-D47 VanDerWaalsContact C-N 3.32Å; C45-D47 PolarHBondContact O-N 3.36Å; C45-V48 PolarHBondContact O-N 2.95Å; C45-I49 WeakPolarHBondContact O-CD1 3.23Å; C45-I49 VanDerWaalsContact O-CG1 3.28Å; C45-I49 WeakPolarHBondContact O-CG1 3.27Å; C45-I49 PolarHBondContact O-N 3.43Å; C45-L62 HydrophobicContact CB-CD1 4.15Å; C45-L62 HydrophobicContact CB-CD2 4.06Å; C45-L62 HydrophobicContact CB-CG 4.42Å
46	K	96.8	Very high	96.3	Very high	112 Å²	112	86.1 Å²	86.1	49%	0.487	42%	0.423	S	S	.	.	H	α-helix	trans	-63.2	-39.5	177.7	-72.9	175.4	177.7	-174.2	0	111.8	K42 A43 Q44 I49 K50	K42-K46 WeakPolarHBondContact O-CG 3.15Å; K42-K46 PolarHBondContact O-N 3.1Å; K42-K46 VanDerWaalsContact O-N 3.15Å; A43-K46 WeakPolarHBondContact O-CB 3.47Å; A43-K46 PolarHBondContact O-N 3.3Å; Q44-K46 VanDerWaalsContact C-N 3.34Å; Q44-K46 PolarHBondContact O-N 3.37Å; K46-I49 PolarHBondContact O-N 2.83Å; K46-K50 WeakPolarHBondContact O-CB 3.43Å; K46-K50 VanDerWaalsContact O-CG 3.25Å; K46-K50 WeakPolarHBondContact O-CG 3.37Å; K46-K50 PolarHBondContact O-N 3.47Å
47	D	96.1	Very high	96.1	Very high	65 Å²	65	86.6 Å²	86.6	35%	0.348	42%	0.422	S	S	.	.	H	α-helix	trans	-66.5	-42.4	179.8	-65.5	-22.4	0	0	0	111.2	A43 Q44 C45 K50 Q51	A43-D47 PolarHBondContact O-N 2.97Å; Q44-D47 PolarHBondContact O-N 2.78Å; C45-D47 VanDerWaalsContact C-N 3.32Å; C45-D47 PolarHBondContact O-N 3.36Å; D47-K50 PolarHBondContact O-N 2.99Å; D47-Q51 WeakPolarHBondContact O-CB 3.4Å; D47-Q51 VanDerWaalsContact O-CG 3.27Å; D47-Q51 WeakPolarHBondContact O-CG 3.45Å; D47-Q51 PolarHBondContact O-N 2.92Å
48	V	95.4	Very high	96	Very high	1 Å²	1	87.1 Å²	87.1	1%	0.006	43%	0.432	C	S	.	.	H	α-helix	trans	-60	-48.6	174.1	171.9	0	0	0	0	111.3	Q44 C45 K50 Q51 K52 L62 E65 V66	Q44-V48 WeakPolarHBondContact O-CG2 3.28Å; Q44-V48 PolarHBondContact O-N 3.35Å; Q44-V48 VanDerWaalsContact O-N 3.08Å; C45-V48 PolarHBondContact O-N 2.95Å; V48-K50 VanDerWaalsContact C-N 3.32Å; V48-K50 PolarHBondContact O-N 3.45Å; V48-Q51 PolarHBondContact O-N 3.4Å; V48-K52 HydrophobicContact CG1-CD 4.11Å; V48-K52 PolarHBondContact O-N 3.08Å; V48-L62 HydrophobicContact CB-CD1 3.82Å; V48-L62 HydrophobicContact CG1-CD1 3.67Å; V48-E65 VanDerWaalsContact CG1-CD 3.44Å; V48-E65 HydrophobicContact CG1-CG 4.33Å; V48-E65 WeakPolarHBondContact CG1-OE2 3.29Å; V48-E65 HydrophobicContact CG2-CG 3.97Å; V48-E65 WeakPolarHBondContact CG2-OE1 3.34Å; V48-V66 HydrophobicContact CG2-CG1 4.18Å
49	I	96.4	Very high	95.9	Very high	51 Å²	51	86.1 Å²	86.1	26%	0.262	44%	0.436	S	S	.	.	H	α-helix	trans	-61.3	-41.1	178.9	-67.9	164.9	0	0	0	111	C45 K46 G53 L54 V57 L62	C45-I49 WeakPolarHBondContact O-CD1 3.23Å; C45-I49 VanDerWaalsContact O-CG1 3.28Å; C45-I49 WeakPolarHBondContact O-CG1 3.27Å; C45-I49 PolarHBondContact O-N 3.43Å; K46-I49 PolarHBondContact O-N 2.83Å; I49-G53 CarbonylContact O-C 3.51Å; I49-G53 WeakPolarHBondContact O-CA 3.36Å; I49-G53 PolarHBondContact O-N 3.24Å; I49-L54 HydrophobicContact CG2-CB 4.35Å; I49-L54 HydrophobicContact CG2-CD1 3.89Å; I49-V57 HydrophobicContact CG1-CG1 4.46Å; I49-L62 HydrophobicContact CD1-CD2 4.15Å; I49-L62 HydrophobicContact CG1-CD1 4.25Å
50	K	96.3	Very high	95.9	Very high	162 Å²	162	87.5 Å²	87.5	70%	0.704	44%	0.439	S	S	*	.	H	α-helix	trans	-64.6	-39.3	177	-77.1	174.3	-179.9	-178.8	0	112.6	K46 D47 V48	K46-K50 WeakPolarHBondContact O-CB 3.43Å; K46-K50 VanDerWaalsContact O-CG 3.25Å; K46-K50 WeakPolarHBondContact O-CG 3.37Å; K46-K50 PolarHBondContact O-N 3.47Å; D47-K50 PolarHBondContact O-N 2.99Å; V48-K50 VanDerWaalsContact C-N 3.32Å; V48-K50 PolarHBondContact O-N 3.45Å
51	Q	95	Very high	95.7	Very high	155 Å²	155	86.5 Å²	86.5	72%	0.724	44%	0.437	S	S	*	.	H	α-helix	trans	-72.1	-39.3	-178.7	-74.5	174.1	0.8	0	0	112.4	D47 V48	D47-Q51 WeakPolarHBondContact O-CB 3.4Å; D47-Q51 VanDerWaalsContact O-CG 3.27Å; D47-Q51 WeakPolarHBondContact O-CG 3.45Å; D47-Q51 PolarHBondContact O-N 2.92Å; V48-Q51 PolarHBondContact O-N 3.4Å
52	K	94	Very high	95.6	Very high	92 Å²	92	86.9 Å²	86.9	40%	0.4	44%	0.439	S	S	.	.	H	α-helix	trans	-89.4	-25.4	-177.2	-69.8	-175.2	168.5	-176.8	0	113.8	V48 H56 V57 E65	V48-K52 HydrophobicContact CG1-CD 4.11Å; V48-K52 PolarHBondContact O-N 3.08Å; K52-H56 WeakPolarHBondContact O-CB 3.33Å; K52-H56 PolarHBondContact O-CD2 3.43Å; K52-V57 HydrophobicContact CB-CG2 3.3Å; K52-V57 HydrophobicContact CD-CG2 3.65Å; K52-V57 HydrophobicContact CG-CG2 4.1Å; K52-E65 WeakPolarHBondContact CE-OE2 3.49Å; K52-E65 IonicContact NZ-OE2 2.78Å; K52-E65 PolarHBondContact NZ-OE2 3.23Å
53	G	94.4	Very high	95.6	Very high	26 Å²	26	84.3 Å²	84.3	27%	0.268	43%	0.434	S	S	.	.			trans	88	139.1	-170.6	0	0	0	0	0	111.8	I49 E55 H56	I49-G53 CarbonylContact O-C 3.51Å; I49-G53 WeakPolarHBondContact O-CA 3.36Å; I49-G53 PolarHBondContact O-N 3.24Å; G53-E55 PolarHBondContact O-N 3.01Å; G53-H56 PolarHBondContact O-N 2.89Å; G53-H56 VanDerWaalsContact O-N 3.08Å
54	L	92.4	Very high	95.6	Very high	138 Å²	138	87.4 Å²	87.4	72%	0.723	45%	0.448	S	S	*	.	G	3₁₀ helix	trans	-60.9	-33.3	-174.1	-175.2	64.5	0	0	0	113	I49 H56	I49-L54 HydrophobicContact CG2-CB 4.35Å; I49-L54 HydrophobicContact CG2-CD1 3.89Å; L54-H56 PolarHBondContact O-N 3.44Å
55	E	94.3	Very high	95.5	Very high	186 Å²	186	87.5 Å²	87.5	87%	0.869	45%	0.448	S	S	*	.	G	3₁₀ helix	trans	-74.3	-12.9	-179.8	-58.8	-174.6	-173.3	0	0	113.4	G53	G53-E55 PolarHBondContact O-N 3.01Å
56	H	93.1	Very high	95.5	Very high	145 Å²	145	86.7 Å²	86.7	67%	0.671	44%	0.442	S	S	*	.	G	3₁₀ helix	trans	-112.8	11.5	-174.3	-57.1	-58.2	0	0	0	113.5	K52 G53 L54	K52-H56 WeakPolarHBondContact O-CB 3.33Å; K52-H56 PolarHBondContact O-CD2 3.43Å; G53-H56 PolarHBondContact O-N 2.89Å; G53-H56 VanDerWaalsContact O-N 3.08Å; L54-H56 PolarHBondContact O-N 3.44Å
57	V	95.1	Very high	95.5	Very high	28 Å²	28	83.6 Å²	83.6	17%	0.17	43%	0.433	C	S	.	.			trans	-127.3	120.1	-177.5	176.8	0	0	0	0	110.7	I49 K52 L62	I49-V57 HydrophobicContact CG1-CG1 4.46Å; K52-V57 HydrophobicContact CB-CG2 3.3Å; K52-V57 HydrophobicContact CD-CG2 3.65Å; K52-V57 HydrophobicContact CG-CG2 4.1Å; V57-L62 HydrophobicContact CG1-CB 4.1Å
58	T	96.4	Very high	95.6	Very high	69 Å²	69	84.4 Å²	84.4	42%	0.423	44%	0.442	S	S	.	.			trans	-85.8	165.8	165.6	68.1	0	0	0	0	111.1	E60 D61 L62	T58-E60 PolarHBondContact O-N 3.31Å; T58-D61 WeakPolarHBondContact CB-OD2 3.43Å; T58-D61 PolarHBondContact N-OD2 2.92Å; T58-D61 VanDerWaalsContact N-OD2 3.1Å; T58-D61 PolarHBondContact O-N 3.5Å; T58-D61 PolarHBondContact OG1-N 2.94Å; T58-D61 VanDerWaalsContact OG1-N 3.08Å; T58-D61 PolarHBondContact OG1-OD2 3.43Å; T58-L62 PolarHBondContact O-N 3.25Å; T58-L62 VanDerWaalsContact O-N 3.11Å
59	V	96.1	Very high	95.7	Very high	103 Å²	103	88.5 Å²	88.5	62%	0.624	46%	0.46	S	S	*	.	H	α-helix	trans	-62.3	-38.8	173.5	175.4	0	0	0	0	110.2	L62 V63	V59-L62 WeakPolarHBondContact O-CB 3.37Å; V59-L62 PolarHBondContact O-N 3.4Å; V59-V63 HydrophobicContact CG1-CG2 4.33Å; V59-V63 VanDerWaalsContact O-CG2 3.29Å; V59-V63 WeakPolarHBondContact O-CG2 3.49Å; V59-V63 PolarHBondContact O-N 2.94Å
60	E	96.6	Very high	95.7	Very high	134 Å²	134	86.3 Å²	86.3	63%	0.626	45%	0.45	S	S	*	.	H	α-helix	trans	-61.4	-46.7	177.6	-72.2	66.3	-151.2	0	0	111.6	T58 L62 V63 V64	T58-E60 PolarHBondContact O-N 3.31Å; E60-L62 VanDerWaalsContact C-N 3.3Å; E60-L62 PolarHBondContact O-N 3.5Å; E60-V63 PolarHBondContact O-N 3.15Å; E60-V64 WeakPolarHBondContact O-CG2 3.47Å; E60-V64 PolarHBondContact O-N 2.92Å
61	D	94.7	Very high	95.8	Very high	70 Å²	70	87.5 Å²	87.5	37%	0.374	45%	0.45	S	S	.	.	H	α-helix	trans	-59	-44.6	176.1	-63.4	-46	0	0	0	111.1	T58 V63 V64 E65	T58-D61 WeakPolarHBondContact CB-OD2 3.43Å; T58-D61 PolarHBondContact N-OD2 2.92Å; T58-D61 VanDerWaalsContact N-OD2 3.1Å; T58-D61 PolarHBondContact O-N 3.5Å; T58-D61 PolarHBondContact OG1-N 2.94Å; T58-D61 VanDerWaalsContact OG1-N 3.08Å; T58-D61 PolarHBondContact OG1-OD2 3.43Å; D61-V63 PolarHBondContact O-N 3.02Å; D61-V64 PolarHBondContact O-N 3.16Å; D61-E65 WeakPolarHBondContact O-CB 3.28Å; D61-E65 PolarHBondContact O-N 3.34Å
62	L	96.1	Very high	95.9	Very high	29 Å²	29	84 Å²	84	15%	0.152	45%	0.448	C	S	.	.	H	α-helix	trans	-61.9	-45.3	178	-170.4	64.5	0	0	0	110.9	C45 V48 I49 V57 T58 V59 E60 E65 V66	C45-L62 HydrophobicContact CB-CD1 4.15Å; C45-L62 HydrophobicContact CB-CD2 4.06Å; C45-L62 HydrophobicContact CB-CG 4.42Å; V48-L62 HydrophobicContact CB-CD1 3.82Å; V48-L62 HydrophobicContact CG1-CD1 3.67Å; I49-L62 HydrophobicContact CD1-CD2 4.15Å; I49-L62 HydrophobicContact CG1-CD1 4.25Å; V57-L62 HydrophobicContact CG1-CB 4.1Å; T58-L62 PolarHBondContact O-N 3.25Å; T58-L62 VanDerWaalsContact O-N 3.11Å; V59-L62 WeakPolarHBondContact O-CB 3.37Å; V59-L62 PolarHBondContact O-N 3.4Å; E60-L62 VanDerWaalsContact C-N 3.3Å; E60-L62 PolarHBondContact O-N 3.5Å; L62-E65 PolarHBondContact O-N 3.43Å; L62-V66 HydrophobicContact CD1-CG1 3.96Å; L62-V66 HydrophobicContact CG-CG1 4.36Å; L62-V66 WeakPolarHBondContact O-CG1 3.29Å; L62-V66 WeakPolarHBondContact O-CG2 3.43Å; L62-V66 PolarHBondContact O-N 3Å
63	V	96.9	Very high	96.1	Very high	75 Å²	75	82.6 Å²	82.6	46%	0.455	44%	0.444	S	S	.	.	H	α-helix	trans	-60.2	-48	177.3	167.7	0	0	0	0	110.8	V59 E60 D61 E65 T67	V59-V63 HydrophobicContact CG1-CG2 4.33Å; V59-V63 VanDerWaalsContact O-CG2 3.29Å; V59-V63 WeakPolarHBondContact O-CG2 3.49Å; V59-V63 PolarHBondContact O-N 2.94Å; E60-V63 PolarHBondContact O-N 3.15Å; D61-V63 PolarHBondContact O-N 3.02Å; V63-E65 VanDerWaalsContact C-N 3.26Å; V63-E65 PolarHBondContact O-N 2.92Å; V63-T67 WeakPolarHBondContact O-CB 3.42Å; V63-T67 PolarHBondContact O-N 3.49Å; V63-T67 PolarHBondContact O-OG1 3.44Å
64	V	96.9	Very high	96.3	Very high	110 Å²	110	82.7 Å²	82.7	67%	0.667	44%	0.439	S	S	*	.	H	α-helix	trans	-57.5	-43.8	179	168.7	0	0	0	0	110.6	E60 D61 P68	E60-V64 WeakPolarHBondContact O-CG2 3.47Å; E60-V64 PolarHBondContact O-N 2.92Å; D61-V64 PolarHBondContact O-N 3.16Å; V64-P68 VanDerWaalsContact O-CD 3.25Å; V64-P68 WeakPolarHBondContact O-CD 3.28Å
65	E	95.4	Very high	96.6	Very high	57 Å²	57	78.2 Å²	78.2	27%	0.266	42%	0.418	S	S	.	.	H	α-helix	trans	-75	-40.9	-175.7	-172	165.1	173.6	0	0	113.7	V48 K52 D61 L62 V63	V48-E65 VanDerWaalsContact CG1-CD 3.44Å; V48-E65 HydrophobicContact CG1-CG 4.33Å; V48-E65 WeakPolarHBondContact CG1-OE2 3.29Å; V48-E65 HydrophobicContact CG2-CG 3.97Å; V48-E65 WeakPolarHBondContact CG2-OE1 3.34Å; K52-E65 WeakPolarHBondContact CE-OE2 3.49Å; K52-E65 IonicContact NZ-OE2 2.78Å; K52-E65 PolarHBondContact NZ-OE2 3.23Å; D61-E65 WeakPolarHBondContact O-CB 3.28Å; D61-E65 PolarHBondContact O-N 3.34Å; L62-E65 PolarHBondContact O-N 3.43Å; V63-E65 VanDerWaalsContact C-N 3.26Å; V63-E65 PolarHBondContact O-N 2.92Å
66	V	96.8	Very high	96.7	Very high	12 Å²	12	74 Å²	74	7%	0.073	40%	0.402	C	S	.	.	H	α-helix	trans	-87.5	-20.6	-175.4	-53.7	0	0	0	0	112.9	M41 V48 L62 K69 G70	M41-V66 HydrophobicContact CE-CB 3.75Å; M41-V66 HydrophobicContact CE-CG2 3.74Å; V48-V66 HydrophobicContact CG2-CG1 4.18Å; L62-V66 HydrophobicContact CD1-CG1 3.96Å; L62-V66 HydrophobicContact CG-CG1 4.36Å; L62-V66 WeakPolarHBondContact O-CG1 3.29Å; L62-V66 WeakPolarHBondContact O-CG2 3.43Å; L62-V66 PolarHBondContact O-N 3Å; V66-K69 PolarHBondContact O-N 3.31Å; V66-G70 PolarHBondContact O-N 2.91Å
67	T	97.6	Very high	97	Very high	48 Å²	48	70.9 Å²	70.9	29%	0.294	40%	0.396	S	S	.	.	H	α-helix	trans	-58.1	-46.6	-177.2	-69.3	0	0	0	0	113.7	V63 K69 G70 R71	V63-T67 WeakPolarHBondContact O-CB 3.42Å; V63-T67 PolarHBondContact O-N 3.49Å; V63-T67 PolarHBondContact O-OG1 3.44Å; T67-K69 VanDerWaalsContact C-N 3.33Å; T67-K69 PolarHBondContact O-N 3.45Å; T67-G70 PolarHBondContact O-N 3.3Å; T67-R71 HydrophobicContact CG2-CG 4.41Å; T67-R71 WeakPolarHBondContact O-CG 3.41Å; T67-R71 PolarHBondContact O-N 3.13Å
68	P	97.9	Very high	97.1	Very high	82 Å²	82	69.9 Å²	69.9	53%	0.532	39%	0.39	S	S	.	.	H	α-helix	trans	-58.9	-43.7	177.2	-24.6	34.7	0	0	0	112.4	V64 R71 A72	V64-P68 VanDerWaalsContact O-CD 3.25Å; V64-P68 WeakPolarHBondContact O-CD 3.28Å; P68-R71 PolarHBondContact O-N 3.43Å; P68-A72 PolarHBondContact O-N 2.87Å
69	K	96.3	Very high	97.2	Very high	86 Å²	86	71.2 Å²	71.2	37%	0.374	39%	0.39	S	S	.	.	H	α-helix	trans	-62.8	-46.2	176.4	-62.1	-179.1	178.6	177.8	0	111.1	Q44 V66 T67 R71 A72 L73	Q44-K69 HydrophobicContact CG-CD 4.4Å; Q44-K69 VanDerWaalsContact OE1-CD 3.29Å; V66-K69 PolarHBondContact O-N 3.31Å; T67-K69 VanDerWaalsContact C-N 3.33Å; T67-K69 PolarHBondContact O-N 3.45Å; K69-R71 VanDerWaalsContact C-N 3.33Å; K69-R71 PolarHBondContact O-N 2.96Å; K69-A72 PolarHBondContact O-N 3.43Å; K69-A72 VanDerWaalsContact O-N 3.16Å; K69-L73 WeakPolarHBondContact O-CG 3.45Å; K69-L73 PolarHBondContact O-N 3.26Å
70	G	97.6	Very high	97.3	Very high	5 Å²	5	72.9 Å²	72.9	5%	0.052	39%	0.389	C	S	.	.	H	α-helix	trans	-59.2	-42.4	177.8	0	0	0	0	0	112.9	W37 M41 V66 T67 L73 V74	W37-G70 PolarHBondContact NE1-O 3.01Å; M41-G70 WeakPolarHBondContact SD-CA 3.42Å; V66-G70 PolarHBondContact O-N 2.91Å; T67-G70 PolarHBondContact O-N 3.3Å; G70-L73 PolarHBondContact O-N 3.35Å; G70-V74 WeakPolarHBondContact O-CG2 3.45Å
71	R	98	Very high	97.4	Very high	188 Å²	188	69.2 Å²	69.2	71%	0.709	37%	0.372	S	S	*	.	H	α-helix	trans	-65.5	-39.6	175.7	-70	177.9	-176.3	-176.1	3.6	112.5	T67 P68 K69 V74	T67-R71 HydrophobicContact CG2-CG 4.41Å; T67-R71 WeakPolarHBondContact O-CG 3.41Å; T67-R71 PolarHBondContact O-N 3.13Å; P68-R71 PolarHBondContact O-N 3.43Å; K69-R71 VanDerWaalsContact C-N 3.33Å; K69-R71 PolarHBondContact O-N 2.96Å; R71-V74 PolarHBondContact O-N 3.4Å
72	A	97.7	Very high	97.5	Very high	82 Å²	82	67.2 Å²	67.2	68%	0.678	36%	0.361	S	S	*	.	H	α-helix	trans	-67.7	-35.2	179.4	0	0	0	0	0	112.7	P68 K69 V74	P68-A72 PolarHBondContact O-N 2.87Å; K69-A72 PolarHBondContact O-N 3.43Å; K69-A72 VanDerWaalsContact O-N 3.16Å; A72-V74 VanDerWaalsContact C-N 3.28Å; A72-V74 PolarHBondContact O-N 2.89Å
73	L	97.5	Very high	97.6	Very high	62 Å²	62	69.5 Å²	69.5	33%	0.325	37%	0.373	S	S	.	.	T	Hydrogen-bonded Turn	trans	-75.5	-9.8	-179	-71.2	174.9	0	0	0	114.3	Q40 M41 K69 G70 P75	Q40-L73 HydrophobicContact CB-CD1 4.2Å; M41-L73 HydrophobicContact SD-CD1 4.26Å; K69-L73 WeakPolarHBondContact O-CG 3.45Å; K69-L73 PolarHBondContact O-N 3.26Å; G70-L73 PolarHBondContact O-N 3.35Å; L73-P75 WeakPolarHBondContact O-CD 3.48Å
74	V	98.3	Very high	97.7	Very high	28 Å²	28	71.9 Å²	71.9	17%	0.17	38%	0.379	C	S	.	.	S	Bend	trans	-69.5	115.8	178.5	-178.5	0	0	0	0	109.6	L32 G70 R71 A72 K79	L32-V74 HydrophobicContact CD2-CG1 4.22Å; L32-V74 HydrophobicContact CD2-CG2 4.27Å; G70-V74 WeakPolarHBondContact O-CG2 3.45Å; R71-V74 PolarHBondContact O-N 3.4Å; A72-V74 VanDerWaalsContact C-N 3.28Å; A72-V74 PolarHBondContact O-N 2.89Å; V74-K79 HydrophobicContact CG1-CG 4.08Å; V74-K79 WeakPolarHBondContact O-CE 3.45Å; V74-K79 PolarHBondContact O-NZ 2.96Å
75	P	98.4	Very high	97.7	Very high	43 Å²	43	72 Å²	72	28%	0.279	37%	0.368	S	S	.	.			trans	-65	144.4	-178.1	-20.7	33.8	0	0	0	112.1	C35 L73 S77 V78 K79	C35-P75 HydrophobicContact CB-CG 4.47Å; L73-P75 WeakPolarHBondContact O-CD 3.48Å; P75-S77 PolarHBondContact O-N 3.04Å; P75-V78 HydrophobicContact CB-CG2 4.23Å; P75-V78 HydrophobicContact CG-CG2 4.24Å; P75-V78 PolarHBondContact O-N 2.91Å; P75-V78 VanDerWaalsContact O-N 3.12Å; P75-K79 PolarHBondContact O-N 3.26Å
76	D	98.3	Very high	97.8	Very high	99 Å²	99	71.7 Å²	71.7	53%	0.529	37%	0.367	S	S	.	.	H	α-helix	trans	-65.4	-25.6	177.6	-75.3	-13	0	0	0	112.8	V78 K79 K80	D76-V78 VanDerWaalsContact C-N 3.33Å; D76-V78 PolarHBondContact O-N 3Å; D76-K79 PolarHBondContact O-N 3.32Å; D76-K79 IonicContact OD1-NZ 2.83Å; D76-K79 PolarHBondContact OD1-NZ 3.47Å; D76-K80 WeakPolarHBondContact O-CB 3.38Å; D76-K80 WeakPolarHBondContact O-CG 3.44Å; D76-K80 PolarHBondContact O-N 3.17Å
77	S	97.9	Very high	97.8	Very high	79 Å²	79	78.3 Å²	78.3	55%	0.552	39%	0.391	S	S	*	.	H	α-helix	trans	-58.7	-43.8	171.6	51.9	0	0	0	0	111.9	P75 K80 E81	P75-S77 PolarHBondContact O-N 3.04Å; S77-K80 PolarHBondContact O-N 3.27Å; S77-E81 WeakPolarHBondContact O-CB 3.34Å; S77-E81 PolarHBondContact O-N 3.02Å
78	V	98.3	Very high	97.8	Very high	7 Å²	7	78.2 Å²	78.2	4%	0.042	40%	0.395	C	S	.	.	H	α-helix	trans	-64.9	-43.3	177.8	-179.6	0	0	0	0	110.9	L28 K31 P75 D76 E81 L82	L28-V78 HydrophobicContact CD1-CG1 3.72Å; K31-V78 HydrophobicContact CB-CG1 3.91Å; K31-V78 HydrophobicContact CB-CG2 4.08Å; P75-V78 HydrophobicContact CB-CG2 4.23Å; P75-V78 HydrophobicContact CG-CG2 4.24Å; P75-V78 PolarHBondContact O-N 2.91Å; P75-V78 VanDerWaalsContact O-N 3.12Å; D76-V78 VanDerWaalsContact C-N 3.33Å; D76-V78 PolarHBondContact O-N 3Å; V78-E81 PolarHBondContact O-N 3.28Å; V78-L82 HydrophobicContact CG1-CD1 4.29Å; V78-L82 PolarHBondContact O-N 3.26Å; V78-L82 VanDerWaalsContact O-N 3.1Å
79	K	98	Very high	97.7	Very high	97 Å²	97	74.8 Å²	74.8	42%	0.422	37%	0.372	S	S	.	.	H	α-helix	trans	-62.6	-43.5	176.5	-60	175.6	-162.6	150	0	111.4	V74 P75 D76 L82 L83	V74-K79 HydrophobicContact CG1-CG 4.08Å; V74-K79 WeakPolarHBondContact O-CE 3.45Å; V74-K79 PolarHBondContact O-NZ 2.96Å; P75-K79 PolarHBondContact O-N 3.26Å; D76-K79 PolarHBondContact O-N 3.32Å; D76-K79 IonicContact OD1-NZ 2.83Å; D76-K79 PolarHBondContact OD1-NZ 3.47Å; K79-L82 PolarHBondContact O-N 3.44Å; K79-L83 WeakPolarHBondContact O-CB 3.39Å; K79-L83 PolarHBondContact O-N 2.99Å
80	K	98.4	Very high	97.6	Very high	137 Å²	137	73.2 Å²	73.2	60%	0.596	37%	0.367	S	S	*	.	H	α-helix	trans	-62.5	-45	178.2	-76.2	171.7	-178	178	0	111.5	D76 S77 L83 Q84	D76-K80 WeakPolarHBondContact O-CB 3.38Å; D76-K80 WeakPolarHBondContact O-CG 3.44Å; D76-K80 PolarHBondContact O-N 3.17Å; S77-K80 PolarHBondContact O-N 3.27Å; K80-L83 PolarHBondContact O-N 3.4Å; K80-Q84 WeakPolarHBondContact O-CG 3.44Å; K80-Q84 PolarHBondContact O-N 3.29Å
81	E	97.9	Very high	97.5	Very high	58 Å²	58	78.1 Å²	78.1	27%	0.271	40%	0.396	S	S	.	.	H	α-helix	trans	-62.3	-44.9	178.5	-172.5	175.6	168.5	0	0	111.9	K31 S77 V78 L83 Q84 R85	K31-E81 WeakPolarHBondContact CE-OE1 3.44Å; K31-E81 VanDerWaalsContact CE-OE2 3.23Å; K31-E81 WeakPolarHBondContact CE-OE2 3.42Å; K31-E81 IonicContact NZ-OE1 3.81Å; K31-E81 PolarHBondContact NZ-OE1 3.04Å; K31-E81 IonicContact NZ-OE2 2.87Å; K31-E81 PolarHBondContact NZ-OE2 3.3Å; S77-E81 WeakPolarHBondContact O-CB 3.34Å; S77-E81 PolarHBondContact O-N 3.02Å; V78-E81 PolarHBondContact O-N 3.28Å; E81-L83 PolarHBondContact O-N 2.95Å; E81-Q84 PolarHBondContact O-N 3.43Å; E81-R85 PolarHBondContact O-N 3.1Å
82	L	98.2	Very high	97.3	Very high	28 Å²	28	76.2 Å²	76.2	15%	0.147	40%	0.395	C	S	.	.	H	α-helix	trans	-62.6	-43.5	175	-77.2	165.5	0	0	0	112.3	L24 L27 L28 V78 K79 Q84 R85 I86	L24-L82 HydrophobicContact CB-CD2 4.24Å; L24-L82 HydrophobicContact CD2-CD2 3.81Å; L27-L82 HydrophobicContact CD2-CD2 4.11Å; L27-L82 HydrophobicContact CG-CD2 4.49Å; L28-L82 HydrophobicContact CB-CD1 3.96Å; L28-L82 HydrophobicContact CB-CD2 4.39Å; L28-L82 HydrophobicContact CD1-CD1 3.67Å; L28-L82 HydrophobicContact CD2-CD1 4.39Å; L28-L82 HydrophobicContact CG-CD1 4.19Å; V78-L82 HydrophobicContact CG1-CD1 4.29Å; V78-L82 PolarHBondContact O-N 3.26Å; V78-L82 VanDerWaalsContact O-N 3.1Å; K79-L82 PolarHBondContact O-N 3.44Å; L82-Q84 VanDerWaalsContact C-N 3.31Å; L82-Q84 PolarHBondContact O-N 2.77Å; L82-R85 PolarHBondContact O-N 3.31Å; L82-I86 WeakPolarHBondContact O-CG1 3.49Å; L82-I86 PolarHBondContact O-N 3.47Å
83	L	97.9	Very high	96.9	Very high	76 Å²	76	75.7 Å²	75.7	40%	0.398	38%	0.378	S	S	.	.	H	α-helix	trans	-63.1	-39	177.9	-178.4	60.1	0	0	0	111.7	K79 K80 E81 I86 R87	K79-L83 WeakPolarHBondContact O-CB 3.39Å; K79-L83 PolarHBondContact O-N 2.99Å; K80-L83 PolarHBondContact O-N 3.4Å; E81-L83 PolarHBondContact O-N 2.95Å; L83-I86 PolarHBondContact O-N 3.37Å; L83-R87 WeakPolarHBondContact O-CG 3.18Å; L83-R87 PolarHBondContact O-N 3.29Å
84	Q	98	Very high	95.9	Very high	126 Å²	126	76.5 Å²	76.5	59%	0.589	39%	0.394	S	S	*	.	H	α-helix	trans	-62.2	-45	174	-76.7	174.2	-30.6	0	0	111.5	K80 E81 L82 R87 A88	K80-Q84 WeakPolarHBondContact O-CG 3.44Å; K80-Q84 PolarHBondContact O-N 3.29Å; E81-Q84 PolarHBondContact O-N 3.43Å; L82-Q84 VanDerWaalsContact C-N 3.31Å; L82-Q84 PolarHBondContact O-N 2.77Å; Q84-R87 PolarHBondContact O-N 2.85Å; Q84-A88 WeakPolarHBondContact O-CB 3.22Å; Q84-A88 PolarHBondContact O-N 3.08Å
85	R	97.5	Very high	93.9	Very high	113 Å²	113	83.8 Å²	83.8	43%	0.426	45%	0.446	S	S	.	.	H	α-helix	trans	-61.5	-44.4	175.2	-81.8	-143.3	-179.8	177.6	2	113	L24 L27 E81 L82 R87 A88 F89	L24-R85 HydrophobicContact CD2-CB 3.75Å; L27-R85 HydrophobicContact CD2-CG 4.27Å; E81-R85 PolarHBondContact O-N 3.1Å; L82-R85 PolarHBondContact O-N 3.31Å; R85-R87 VanDerWaalsContact C-N 3.32Å; R85-R87 PolarHBondContact O-N 3.29Å; R85-A88 PolarHBondContact O-N 3.26Å; R85-F89 WeakPolarHBondContact O-CB 3.49Å; R85-F89 PolarHBondContact O-N 3.14Å
86	I	97.1	Very high	93.7	Very high	50 Å²	50	85.8 Å²	85.8	26%	0.256	46%	0.455	S	S	.	.	H	α-helix	trans	-59.1	-45.9	176.6	-68.3	164.5	0	0	0	110.3	L24 L82 L83 F89 L90	L24-I86 HydrophobicContact CD1-CD1 4.33Å; L24-I86 HydrophobicContact CD1-CG1 3.65Å; L24-I86 HydrophobicContact CD2-CG1 4.32Å; L82-I86 WeakPolarHBondContact O-CG1 3.49Å; L82-I86 PolarHBondContact O-N 3.47Å; L83-I86 PolarHBondContact O-N 3.37Å; I86-F89 PolarHBondContact O-N 2.85Å; I86-L90 HydrophobicContact CG2-CD1 4.02Å; I86-L90 HydrophobicContact CG2-CG 4.48Å; I86-L90 VanDerWaalsContact O-CG 3.28Å; I86-L90 WeakPolarHBondContact O-CG 3.46Å; I86-L90 PolarHBondContact O-N 2.98Å
87	R	96.8	Very high	93.4	Very high	151 Å²	151	85.1 Å²	85.1	57%	0.57	45%	0.451	S	S	*	.	H	α-helix	trans	-61.8	-47.2	177.2	-74.1	172.3	177.9	161.1	-2.2	111.9	L83 Q84 R85 F89 L90 T91	L83-R87 WeakPolarHBondContact O-CG 3.18Å; L83-R87 PolarHBondContact O-N 3.29Å; Q84-R87 PolarHBondContact O-N 2.85Å; R85-R87 VanDerWaalsContact C-N 3.32Å; R85-R87 PolarHBondContact O-N 3.29Å; R87-F89 VanDerWaalsContact C-N 3.34Å; R87-F89 PolarHBondContact O-N 3.07Å; R87-L90 PolarHBondContact O-N 3.32Å; R87-T91 PolarHBondContact O-N 3.01Å; R87-T91 PolarHBondContact O-OG1 2.89Å
88	A	97	Very high	93.2	Very high	45 Å²	45	85.4 Å²	85.4	37%	0.372	45%	0.445	S	S	.	.	H	α-helix	trans	-59.5	-45.1	178.9	0	0	0	0	0	111.7	Q84 R85 L90 T91 Q92	Q84-A88 WeakPolarHBondContact O-CB 3.22Å; Q84-A88 PolarHBondContact O-N 3.08Å; R85-A88 PolarHBondContact O-N 3.26Å; A88-L90 PolarHBondContact O-N 2.89Å; A88-T91 PolarHBondContact O-N 2.6Å; A88-Q92 WeakPolarHBondContact O-CB 3.48Å; A88-Q92 VanDerWaalsContact O-CG 3.29Å; A88-Q92 WeakPolarHBondContact O-CG 3.45Å; A88-Q92 PolarHBondContact O-N 3.28Å
89	F	96.6	Very high	92.9	Very high	11 Å²	11	90.1 Å²	90.1	5%	0.048	47%	0.469	C	S	.	.	H	α-helix	trans	-58.3	-48.7	174.9	172.1	-94.4	0	0	0	111.7	K14 L15 T18 E20 R85 I86 R87 T91 Q92 H93	K14-F89 HydrophobicContact CD-CE1 4.36Å; K14-F89 HydrophobicContact CG-CE1 4.04Å; K14-F89 HydrophobicContact CG-CZ 4.12Å; L15-F89 HydrophobicContact CD2-CD1 3.51Å; L15-F89 HydrophobicContact CD2-CE1 3.62Å; L15-F89 HydrophobicContact CD2-CG 4.19Å; L15-F89 HydrophobicContact CD2-CZ 4.37Å; L15-F89 HydrophobicContact CG-CE1 4.3Å; T18-F89 HydrophobicContact CG2-CE2 4.31Å; T18-F89 HydrophobicContact CG2-CZ 3.92Å; T18-F89 VanDerWaalsContact OG1-CZ 3.22Å; T18-F89 WeakPolarHBondContact OG1-CZ 3.33Å; E20-F89 HydrophobicContact CB-CD2 4.01Å; E20-F89 HydrophobicContact CB-CE2 3.82Å; E20-F89 HydrophobicContact CB-CZ 4.19Å; E20-F89 HydrophobicContact CG-CB 4.35Å; E20-F89 HydrophobicContact CG-CD1 4.42Å; E20-F89 HydrophobicContact CG-CD2 3.65Å; E20-F89 HydrophobicContact CG-CE2 4.02Å; E20-F89 HydrophobicContact CG-CG 3.88Å; R85-F89 WeakPolarHBondContact O-CB 3.49Å; R85-F89 PolarHBondContact O-N 3.14Å; I86-F89 PolarHBondContact O-N 2.85Å; R87-F89 VanDerWaalsContact C-N 3.34Å; R87-F89 PolarHBondContact O-N 3.07Å; F89-T91 VanDerWaalsContact C-N 3.33Å; F89-T91 PolarHBondContact O-N 3.03Å; F89-Q92 PolarHBondContact O-N 2.99Å; F89-H93 AromaticContact CD2-CE1 3.54Å; F89-H93 AromaticContact CD2-ND1 3.6Å; F89-H93 AromaticContact CE2-CE1 3.42Å; F89-H93 VanDerWaalsContact CE2-CE1 3.42Å; F89-H93 WeakPolarHBondContact CE2-CE1 3.44Å; F89-H93 AromaticContact CE2-ND1 3.59Å; F89-H93 AromaticContact CE2-NE2 3.85Å; F89-H93 PolarHBondContact O-N 2.7Å; F89-H93 VanDerWaalsContact O-N 3.1Å; F89-H93 PolarHBondContact O-ND1 3.34Å
90	L	95.1	Very high	92.6	Very high	52 Å²	52	89.6 Å²	89.6	27%	0.272	47%	0.472	S	S	.	.	H	α-helix	trans	-63.4	-38.5	-179.9	-70.3	175.5	0	0	0	112.4	I11 I86 R87 A88 H93 A94	I11-L90 HydrophobicContact CD1-CD1 4.08Å; I11-L90 HydrophobicContact CG1-CD1 4.28Å; I11-L90 HydrophobicContact CG1-CD2 4.06Å; I11-L90 HydrophobicContact CG2-CD1 4.23Å; I11-L90 HydrophobicContact CG2-CD2 4.14Å; I86-L90 HydrophobicContact CG2-CD1 4.02Å; I86-L90 HydrophobicContact CG2-CG 4.48Å; I86-L90 VanDerWaalsContact O-CG 3.28Å; I86-L90 WeakPolarHBondContact O-CG 3.46Å; I86-L90 PolarHBondContact O-N 2.98Å; R87-L90 PolarHBondContact O-N 3.32Å; A88-L90 PolarHBondContact O-N 2.89Å; L90-H93 CarbonylContact O-C 3.51Å; L90-H93 PolarHBondContact O-N 3.24Å; L90-A94 PolarHBondContact O-N 3.38Å
91	T	95.3	Very high	92.2	Very high	108 Å²	108	86.5 Å²	86.5	66%	0.663	46%	0.463	S	S	*	.	H	α-helix	trans	-66	-44.2	175.4	-62.9	0	0	0	0	111.9	R87 A88 F89 H93 A94	R87-T91 PolarHBondContact O-N 3.01Å; R87-T91 PolarHBondContact O-OG1 2.89Å; A88-T91 PolarHBondContact O-N 2.6Å; F89-T91 VanDerWaalsContact C-N 3.33Å; F89-T91 PolarHBondContact O-N 3.03Å; T91-H93 PolarHBondContact O-N 3.4Å; T91-A94 PolarHBondContact O-N 3.1Å
92	Q	93.4	Very high	91.8	Very high	149 Å²	149	88.5 Å²	88.5	70%	0.696	48%	0.477	S	S	*	.	H	α-helix	trans	-65.1	-26.9	179.3	-73.7	171.2	3.6	0	0	113.1	A88 F89	A88-Q92 WeakPolarHBondContact O-CB 3.48Å; A88-Q92 VanDerWaalsContact O-CG 3.29Å; A88-Q92 WeakPolarHBondContact O-CG 3.45Å; A88-Q92 PolarHBondContact O-N 3.28Å; F89-Q92 PolarHBondContact O-N 2.99Å
93	H	88.3	Confident	91.3	Very high	70 Å²	70	93.2 Å²	93.2	32%	0.324	50%	0.503	S	S	.	.	T	Hydrogen-bonded Turn	trans	-110	19.1	-179.5	-57.7	75.5	0	0	0	111.9	K14 F89 L90 T91 S95	K14-H93 PolarHBondContact NZ-O 3.15Å; F89-H93 AromaticContact CD2-CE1 3.54Å; F89-H93 AromaticContact CD2-ND1 3.6Å; F89-H93 AromaticContact CE2-CE1 3.42Å; F89-H93 VanDerWaalsContact CE2-CE1 3.42Å; F89-H93 WeakPolarHBondContact CE2-CE1 3.44Å; F89-H93 AromaticContact CE2-ND1 3.59Å; F89-H93 AromaticContact CE2-NE2 3.85Å; F89-H93 PolarHBondContact O-N 2.7Å; F89-H93 VanDerWaalsContact O-N 3.1Å; F89-H93 PolarHBondContact O-ND1 3.34Å; L90-H93 CarbonylContact O-C 3.51Å; L90-H93 PolarHBondContact O-N 3.24Å; T91-H93 PolarHBondContact O-N 3.4Å; H93-S95 VanDerWaalsContact C-N 3.34Å; H93-S95 PolarHBondContact O-N 2.79Å
94	A	76.6	Confident	90.7	Very high	80 Å²	80	94.6 Å²	94.6	66%	0.661	51%	0.511	S	S	*	.			trans	-73.4	93	170.3	0	0	0	0	0	108	L90 T91	L90-A94 PolarHBondContact O-N 3.38Å; T91-A94 PolarHBondContact O-N 3.1Å
95	S	56.9	Low	90	Very high	180 Å²	180	91.7 Å²	91.7	100%	1.259	50%	0.504	S	S	*	.			trans	-137.2	0	170.2	-55.8	0	0	0	0	107.3	H93	H93-S95 VanDerWaalsContact C-N 3.34Å; H93-S95 PolarHBondContact O-N 2.79Å

Retrieved 95 of 95 residues in 606.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).