A0A087YPG2_POEFO Loading...

Complex III subunit 9

Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The complex plays an important role in the uptake of multiple carbon sources present in different host niches.

AlphaFold DB , UniProt , Accession A0A087YPG2, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 64 aa.

						>A0A087YPG2_POEFO|A0A087YPG2
TDDMALAKTVYNLLFRRTSTFAVTIMVGAVLFERVFDQGGDAIFEQMNRGKLWKHIKHNYENEE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	T	62.9	Low	84.4	Confident	151 Å²	151	108.4 Å²	108.4	93%	0.926	59%	0.592	S	S	*	*				0	-32.4	0	-0.6	0	0	0	0	111.4	M4	T1-M4 PolarHBondContact O-N 3.09Å
2	D	64.7	Low	85.3	Confident	132 Å²	132	105.9 Å²	105.9	71%	0.706	58%	0.578	S	S	*	*	H	α-helix	trans	-71.6	-34.2	178.7	-53.2	-55.2	0	0	0	114.5	M4 A5 L6	D2-M4 PolarHBondContact O-N 3.11Å; D2-A5 WeakPolarHBondContact O-CA 3.49Å; D2-A5 WeakPolarHBondContact O-CB 3.23Å; D2-A5 PolarHBondContact O-N 2.66Å; D2-L6 PolarHBondContact O-N 2.66Å
3	D	66.1	Low	86.1	Confident	138 Å²	138	107 Å²	107	74%	0.738	58%	0.582	S	S	*	*	H	α-helix	trans	-57.7	-37.2	174.4	-61.7	-43.6	0	0	0	112.3	A5 L6 A7	D3-A5 VanDerWaalsContact C-N 3.29Å; D3-A5 PolarHBondContact O-N 2.94Å; D3-L6 PolarHBondContact O-N 3.06Å; D3-A7 WeakPolarHBondContact O-CB 2.88Å; D3-A7 PolarHBondContact O-N 2.94Å
4	M	78.6	Confident	86.8	Confident	134 Å²	134	104.3 Å²	104.3	66%	0.66	57%	0.566	S	S	*	*	H	α-helix	trans	-73.1	-24.6	177.9	-155.7	144.3	69.7	0	0	111.8	T1 D2 K8	T1-M4 PolarHBondContact O-N 3.09Å; D2-M4 PolarHBondContact O-N 3.11Å; M4-K8 VanDerWaalsContact O-CB 3.26Å; M4-K8 WeakPolarHBondContact O-CB 3.34Å; M4-K8 VanDerWaalsContact O-CG 3.29Å; M4-K8 WeakPolarHBondContact O-CG 3.29Å; M4-K8 PolarHBondContact O-N 3.19Å
5	A	88.3	Confident	87.4	Confident	51 Å²	51	102.5 Å²	102.5	42%	0.421	55%	0.551	S	S	.	*	H	α-helix	trans	-77.8	-42	174	0	0	0	0	0	111.8	D2 D3 T9	D2-A5 WeakPolarHBondContact O-CA 3.49Å; D2-A5 WeakPolarHBondContact O-CB 3.23Å; D2-A5 PolarHBondContact O-N 2.66Å; D3-A5 VanDerWaalsContact C-N 3.29Å; D3-A5 PolarHBondContact O-N 2.94Å; A5-T9 WeakPolarHBondContact O-CB 3.3Å; A5-T9 PolarHBondContact O-N 3.2Å; A5-T9 PolarHBondContact O-OG1 3.45Å
6	L	93.1	Very high	88	Confident	125 Å²	125	106.4 Å²	106.4	65%	0.654	56%	0.556	S	S	*	*	H	α-helix	trans	-63.9	-50.5	175.1	-171.5	102.7	0	0	0	110.9	D2 D3 K8 T9 V10	D2-L6 PolarHBondContact O-N 2.66Å; D3-L6 PolarHBondContact O-N 3.06Å; L6-K8 VanDerWaalsContact C-N 3.32Å; L6-K8 PolarHBondContact O-N 2.95Å; L6-T9 WeakPolarHBondContact O-CB 3.46Å; L6-T9 PolarHBondContact O-N 2.99Å; L6-V10 WeakPolarHBondContact O-CG2 3.27Å; L6-V10 PolarHBondContact O-N 2.61Å
7	A	93.7	Very high	88.5	Confident	59 Å²	59	110.9 Å²	110.9	49%	0.488	56%	0.564	S	S	.	*	H	α-helix	trans	-59.6	-41.6	178.6	0	0	0	0	0	112.1	D3 T9 V10 Y11	D3-A7 WeakPolarHBondContact O-CB 2.88Å; D3-A7 PolarHBondContact O-N 2.94Å; A7-T9 VanDerWaalsContact C-N 3.33Å; A7-T9 PolarHBondContact O-N 2.76Å; A7-V10 PolarHBondContact O-N 3.41Å; A7-Y11 WeakPolarHBondContact O-CB 3.21Å; A7-Y11 PolarHBondContact O-N 3.01Å
8	K	94.9	Very high	89	Confident	138 Å²	138	111.4 Å²	111.4	60%	0.6	57%	0.573	S	S	*	*	H	α-helix	trans	-61.2	-40.7	173.2	-89.5	-176.9	175	-174.9	0	112.5	M4 L6 N12	M4-K8 VanDerWaalsContact O-CB 3.26Å; M4-K8 WeakPolarHBondContact O-CB 3.34Å; M4-K8 VanDerWaalsContact O-CG 3.29Å; M4-K8 WeakPolarHBondContact O-CG 3.29Å; M4-K8 PolarHBondContact O-N 3.19Å; L6-K8 VanDerWaalsContact C-N 3.32Å; L6-K8 PolarHBondContact O-N 2.95Å; K8-N12 WeakPolarHBondContact O-CB 3.21Å; K8-N12 PolarHBondContact O-N 2.96Å; K8-N12 PolarHBondContact O-ND2 3.48Å
9	T	95.4	Very high	89.5	Confident	76 Å²	76	110 Å²	110	47%	0.466	57%	0.574	S	S	.	*	H	α-helix	trans	-66	-48.7	179.9	-58.8	0	0	0	0	110.4	A5 L6 A7 Y11 N12 L13	A5-T9 WeakPolarHBondContact O-CB 3.3Å; A5-T9 PolarHBondContact O-N 3.2Å; A5-T9 PolarHBondContact O-OG1 3.45Å; L6-T9 WeakPolarHBondContact O-CB 3.46Å; L6-T9 PolarHBondContact O-N 2.99Å; A7-T9 VanDerWaalsContact C-N 3.33Å; A7-T9 PolarHBondContact O-N 2.76Å; T9-Y11 PolarHBondContact O-N 2.9Å; T9-N12 PolarHBondContact O-N 3.16Å; T9-L13 HydrophobicContact CG2-CD1 3.75Å; T9-L13 HydrophobicContact CG2-CG 4.43Å; T9-L13 WeakPolarHBondContact O-CB 3.32Å; T9-L13 VanDerWaalsContact O-CG 3.29Å; T9-L13 WeakPolarHBondContact O-CG 3.27Å; T9-L13 PolarHBondContact O-N 3Å
10	V	95.1	Very high	89.8	Confident	56 Å²	56	107 Å²	107	34%	0.339	56%	0.561	S	S	.	*	H	α-helix	trans	-58.9	-46	176.3	169.7	0	0	0	0	111.3	L6 A7 N12 L13 L14 F15	L6-V10 WeakPolarHBondContact O-CG2 3.27Å; L6-V10 PolarHBondContact O-N 2.61Å; A7-V10 PolarHBondContact O-N 3.41Å; V10-N12 PolarHBondContact O-N 2.88Å; V10-L13 PolarHBondContact O-N 3.35Å; V10-L14 HydrophobicContact CG1-CD1 4.28Å; V10-L14 WeakPolarHBondContact O-CB 3.32Å; V10-L14 PolarHBondContact O-N 2.96Å; V10-F15 HydrophobicContact CG1-CD2 3.88Å; V10-F15 HydrophobicContact CG1-CE2 3.52Å
11	Y	95.7	Very high	90.2	Very high	132 Å²	132	105.9 Å²	105.9	52%	0.518	55%	0.552	S	S	.	*	I	π-helix	trans	-59.5	-49.2	176.3	177.4	-97.3	0	0	0	111.9	A7 T9 L13 F15 R16	A7-Y11 WeakPolarHBondContact O-CB 3.21Å; A7-Y11 PolarHBondContact O-N 3.01Å; T9-Y11 PolarHBondContact O-N 2.9Å; Y11-L13 VanDerWaalsContact C-N 3.3Å; Y11-L13 PolarHBondContact O-N 3.33Å; Y11-F15 HydrophobicContact CD2-CB 3.89Å; Y11-F15 HydrophobicContact CE2-CB 4.33Å; Y11-F15 CarbonylContact O-C 3.45Å; Y11-F15 PolarHBondContact O-N 3.41Å; Y11-R16 HydrophobicContact CD1-CB 4.3Å; Y11-R16 HydrophobicContact CE1-CB 3.97Å; Y11-R16 HydrophobicContact CE1-CG 4.23Å; Y11-R16 WeakPolarHBondContact O-CB 3.44Å; Y11-R16 PolarHBondContact O-N 2.83Å
12	N	95.5	Very high	91.9	Very high	79 Å²	79	101 Å²	101	42%	0.422	53%	0.527	S	S	.	.	I	π-helix	trans	-64.6	-33.4	-178.4	-78.4	-48	0	0	0	113.3	K8 T9 V10 R16	K8-N12 WeakPolarHBondContact O-CB 3.21Å; K8-N12 PolarHBondContact O-N 2.96Å; K8-N12 PolarHBondContact O-ND2 3.48Å; T9-N12 PolarHBondContact O-N 3.16Å; V10-N12 PolarHBondContact O-N 2.88Å; N12-R16 WeakPolarHBondContact OD1-CD 3.35Å; N12-R16 PolarHBondContact OD1-NH1 3.27Å
13	L	95.3	Very high	93.5	Very high	120 Å²	120	99 Å²	99	63%	0.628	52%	0.519	S	S	*	.	I	π-helix	trans	-81.9	-45.3	-178.6	-70.4	173.8	0	0	0	113	T9 V10 Y11	T9-L13 HydrophobicContact CG2-CD1 3.75Å; T9-L13 HydrophobicContact CG2-CG 4.43Å; T9-L13 WeakPolarHBondContact O-CB 3.32Å; T9-L13 VanDerWaalsContact O-CG 3.29Å; T9-L13 WeakPolarHBondContact O-CG 3.27Å; T9-L13 PolarHBondContact O-N 3Å; V10-L13 PolarHBondContact O-N 3.35Å; Y11-L13 VanDerWaalsContact C-N 3.3Å; Y11-L13 PolarHBondContact O-N 3.33Å
14	L	95.6	Very high	95	Very high	69 Å²	69	94.1 Å²	94.1	36%	0.361	49%	0.494	S	S	.	.	I	π-helix	trans	-106.1	-44.2	-168	-57.3	-177.2	0	0	0	112.1	V10 T20 F21 T24	V10-L14 HydrophobicContact CG1-CD1 4.28Å; V10-L14 WeakPolarHBondContact O-CB 3.32Å; V10-L14 PolarHBondContact O-N 2.96Å; L14-T20 CarbonylContact O-C 3.24Å; L14-T20 VanDerWaalsContact O-C 3.24Å; L14-T20 PolarHBondContact O-OG1 2.75Å; L14-F21 WeakPolarHBondContact O-CA 2.9Å; L14-F21 PolarHBondContact O-N 3.34Å; L14-F21 VanDerWaalsContact O-N 3.08Å; L14-T24 HydrophobicContact CB-CG2 4.09Å; L14-T24 HydrophobicContact CD1-CG2 4.12Å
15	F	96.4	Very high	95.9	Very high	78 Å²	78	91.9 Å²	91.9	34%	0.342	48%	0.484	S	S	.	.	I	π-helix	trans	-105.7	-9.6	-163.9	-56.8	-76.4	0	0	0	115.1	V10 Y11 F21 T24	V10-F15 HydrophobicContact CG1-CD2 3.88Å; V10-F15 HydrophobicContact CG1-CE2 3.52Å; Y11-F15 HydrophobicContact CD2-CB 3.89Å; Y11-F15 HydrophobicContact CE2-CB 4.33Å; Y11-F15 CarbonylContact O-C 3.45Å; Y11-F15 PolarHBondContact O-N 3.41Å; F15-F21 HydrophobicContact CB-CD2 4.23Å; F15-F21 AromaticContact CD1-CD2 3.57Å; F15-F21 HydrophobicContact CD1-CD2 3.57Å; F15-F21 AromaticContact CD1-CE2 3.81Å; F15-F21 HydrophobicContact CD1-CE2 3.81Å; F15-F21 HydrophobicContact CE1-CD2 4.46Å; F15-F21 HydrophobicContact CE1-CE2 4.49Å; F15-F21 HydrophobicContact CG-CD2 4.39Å; F15-T24 HydrophobicContact CE1-CG2 4.04Å; F15-T24 HydrophobicContact CZ-CG2 4.06Å
16	R	96.6	Very high	96.4	Very high	165 Å²	165	96 Å²	96	62%	0.623	50%	0.496	S	S	*	.	S	Bend	trans	-73	-34.7	-176.1	178.5	173.7	175.5	174.3	-2.1	114.2	Y11 N12	Y11-R16 HydrophobicContact CD1-CB 4.3Å; Y11-R16 HydrophobicContact CE1-CB 3.97Å; Y11-R16 HydrophobicContact CE1-CG 4.23Å; Y11-R16 WeakPolarHBondContact O-CB 3.44Å; Y11-R16 PolarHBondContact O-N 2.83Å; N12-R16 WeakPolarHBondContact OD1-CD 3.35Å; N12-R16 PolarHBondContact OD1-NH1 3.27Å
17	R	97.1	Very high	96.6	Very high	182 Å²	182	93.9 Å²	93.9	69%	0.687	49%	0.488	S	S	*	.	S	Bend	trans	-107.6	134.9	179.4	-62.5	-175.3	-178.9	-154.1	0.8	109.6	S19 T20 F21	R17-S19 PolarHBondContact O-N 3.39Å; R17-T20 HydrophobicContact CB-CG2 4.45Å; R17-T20 PolarHBondContact O-N 2.96Å; R17-T20 PolarHBondContact O-OG1 3.02Å; R17-F21 VanDerWaalsContact O-CB 3.24Å; R17-F21 WeakPolarHBondContact O-CB 3.48Å; R17-F21 PolarHBondContact O-N 3.19Å
18	T	97.3	Very high	96.8	Very high	120 Å²	120	92.8 Å²	92.8	74%	0.736	48%	0.483	S	S	*	.	H	α-helix	trans	-57.7	-35.3	-178.3	-48.9	0	0	0	0	113	F21 A22	T18-F21 WeakPolarHBondContact O-CB 3.4Å; T18-A22 WeakPolarHBondContact O-CB 3.47Å; T18-A22 PolarHBondContact O-N 3.08Å
19	S	97.4	Very high	97	Very high	85 Å²	85	88.7 Å²	88.7	59%	0.594	48%	0.475	S	S	*	.	H	α-helix	trans	-66.6	-47.7	177.2	53.3	0	0	0	0	112.8	R17 F21 A22 V23	R17-S19 PolarHBondContact O-N 3.39Å; S19-F21 VanDerWaalsContact C-N 3.31Å; S19-A22 PolarHBondContact O-N 3.36Å; S19-V23 WeakPolarHBondContact O-CG2 3.42Å; S19-V23 PolarHBondContact O-N 3.49Å
20	T	97	Very high	97.1	Very high	49 Å²	49	89.7 Å²	89.7	30%	0.301	48%	0.481	S	S	.	.	H	α-helix	trans	-68.9	-34	177.2	59.5	0	0	0	0	111.3	L14 R17 V23 T24	L14-T20 CarbonylContact O-C 3.24Å; L14-T20 VanDerWaalsContact O-C 3.24Å; L14-T20 PolarHBondContact O-OG1 2.75Å; R17-T20 HydrophobicContact CB-CG2 4.45Å; R17-T20 PolarHBondContact O-N 2.96Å; R17-T20 PolarHBondContact O-OG1 3.02Å; T20-V23 PolarHBondContact O-N 2.96Å; T20-T24 WeakPolarHBondContact O-CB 3.45Å; T20-T24 PolarHBondContact O-N 2.99Å; T20-T24 PolarHBondContact O-OG1 3.39Å
21	F	97.7	Very high	97.3	Very high	85 Å²	85	92.5 Å²	92.5	37%	0.373	49%	0.493	S	S	.	.	H	α-helix	trans	-58.9	-51.7	174.4	175.2	-94.3	0	0	0	111.3	L14 F15 R17 T18 S19 V23 T24 I25	L14-F21 WeakPolarHBondContact O-CA 2.9Å; L14-F21 PolarHBondContact O-N 3.34Å; L14-F21 VanDerWaalsContact O-N 3.08Å; F15-F21 HydrophobicContact CB-CD2 4.23Å; F15-F21 AromaticContact CD1-CD2 3.57Å; F15-F21 HydrophobicContact CD1-CD2 3.57Å; F15-F21 AromaticContact CD1-CE2 3.81Å; F15-F21 HydrophobicContact CD1-CE2 3.81Å; F15-F21 HydrophobicContact CE1-CD2 4.46Å; F15-F21 HydrophobicContact CE1-CE2 4.49Å; F15-F21 HydrophobicContact CG-CD2 4.39Å; R17-F21 VanDerWaalsContact O-CB 3.24Å; R17-F21 WeakPolarHBondContact O-CB 3.48Å; R17-F21 PolarHBondContact O-N 3.19Å; T18-F21 WeakPolarHBondContact O-CB 3.4Å; S19-F21 VanDerWaalsContact C-N 3.31Å; F21-V23 PolarHBondContact O-N 3.47Å; F21-T24 WeakPolarHBondContact O-CB 3.48Å; F21-T24 PolarHBondContact O-N 3.11Å; F21-I25 HydrophobicContact CD1-CD1 3.97Å; F21-I25 HydrophobicContact CE1-CD1 3.31Å; F21-I25 HydrophobicContact CE1-CG1 4.45Å; F21-I25 HydrophobicContact CE2-CD1 3.97Å; F21-I25 HydrophobicContact CZ-CD1 3.3Å; F21-I25 HydrophobicContact CZ-CG1 4.4Å; F21-I25 PolarHBondContact O-N 3.22Å
22	A	98.2	Very high	97.4	Very high	49 Å²	49	92.4 Å²	92.4	41%	0.405	50%	0.495	S	S	.	.	H	α-helix	trans	-60.8	-45.4	-180	0	0	0	0	0	112	T18 S19 T24 I25 M26	T18-A22 WeakPolarHBondContact O-CB 3.47Å; T18-A22 PolarHBondContact O-N 3.08Å; S19-A22 PolarHBondContact O-N 3.36Å; A22-T24 VanDerWaalsContact C-N 3.34Å; A22-T24 PolarHBondContact O-N 3.5Å; A22-I25 PolarHBondContact O-N 3.41Å; A22-M26 WeakPolarHBondContact O-CG 3.42Å; A22-M26 PolarHBondContact O-N 3.37Å
23	V	98.3	Very high	97.5	Very high	90 Å²	90	94 Å²	94	55%	0.545	50%	0.501	S	S	.	.	H	α-helix	trans	-62	-43.2	176.4	173.7	0	0	0	0	111.3	S19 T20 F21 I25 M26 V27	S19-V23 WeakPolarHBondContact O-CG2 3.42Å; S19-V23 PolarHBondContact O-N 3.49Å; T20-V23 PolarHBondContact O-N 2.96Å; F21-V23 PolarHBondContact O-N 3.47Å; V23-I25 VanDerWaalsContact C-N 3.31Å; V23-I25 PolarHBondContact O-N 3.41Å; V23-M26 PolarHBondContact O-N 2.84Å; V23-V27 HydrophobicContact CG1-CG2 4.26Å; V23-V27 WeakPolarHBondContact O-CG2 3.37Å; V23-V27 PolarHBondContact O-N 2.83Å
24	T	98.1	Very high	97.6	Very high	34 Å²	34	96.8 Å²	96.8	21%	0.209	50%	0.503	C	S	.	.	H	α-helix	trans	-58.9	-43.7	177.6	-58.9	0	0	0	0	111.1	L14 F15 T20 F21 A22 G28	L14-T24 HydrophobicContact CB-CG2 4.09Å; L14-T24 HydrophobicContact CD1-CG2 4.12Å; F15-T24 HydrophobicContact CE1-CG2 4.04Å; F15-T24 HydrophobicContact CZ-CG2 4.06Å; T20-T24 WeakPolarHBondContact O-CB 3.45Å; T20-T24 PolarHBondContact O-N 2.99Å; T20-T24 PolarHBondContact O-OG1 3.39Å; F21-T24 WeakPolarHBondContact O-CB 3.48Å; F21-T24 PolarHBondContact O-N 3.11Å; A22-T24 VanDerWaalsContact C-N 3.34Å; A22-T24 PolarHBondContact O-N 3.5Å; T24-G28 WeakPolarHBondContact O-CA 3.35Å; T24-G28 PolarHBondContact O-N 3.43Å
25	I	97.8	Very high	97.7	Very high	87 Å²	87	98.6 Å²	98.6	45%	0.446	52%	0.516	S	S	.	.	H	α-helix	trans	-65.4	-46.4	177.4	-70.5	179	0	0	0	111.2	F21 A22 V23 V27 G28 A29	F21-I25 HydrophobicContact CD1-CD1 3.97Å; F21-I25 HydrophobicContact CE1-CD1 3.31Å; F21-I25 HydrophobicContact CE1-CG1 4.45Å; F21-I25 HydrophobicContact CE2-CD1 3.97Å; F21-I25 HydrophobicContact CZ-CD1 3.3Å; F21-I25 HydrophobicContact CZ-CG1 4.4Å; F21-I25 PolarHBondContact O-N 3.22Å; A22-I25 PolarHBondContact O-N 3.41Å; V23-I25 VanDerWaalsContact C-N 3.31Å; V23-I25 PolarHBondContact O-N 3.41Å; I25-V27 PolarHBondContact O-N 3.26Å; I25-G28 PolarHBondContact O-N 3.28Å; I25-A29 VanDerWaalsContact O-CB 3.29Å; I25-A29 WeakPolarHBondContact O-CB 3.14Å; I25-A29 PolarHBondContact O-N 2.77Å
26	M	98.3	Very high	97.8	Very high	137 Å²	137	100.8 Å²	100.8	68%	0.675	53%	0.526	S	S	*	.	H	α-helix	trans	-62.2	-47.1	-178.5	-66.6	-137.9	-59.4	0	0	111.9	A22 V23 A29 V30	A22-M26 WeakPolarHBondContact O-CG 3.42Å; A22-M26 PolarHBondContact O-N 3.37Å; V23-M26 PolarHBondContact O-N 2.84Å; M26-A29 PolarHBondContact O-N 3.27Å; M26-V30 WeakPolarHBondContact O-CG2 3.31Å; M26-V30 PolarHBondContact O-N 2.91Å
27	V	98.2	Very high	97.8	Very high	81 Å²	81	96.9 Å²	96.9	49%	0.491	52%	0.517	S	S	.	.	H	α-helix	trans	-64.9	-44.1	176.9	174.4	0	0	0	0	110.6	V23 I25 A29 V30 L31	V23-V27 HydrophobicContact CG1-CG2 4.26Å; V23-V27 WeakPolarHBondContact O-CG2 3.37Å; V23-V27 PolarHBondContact O-N 2.83Å; I25-V27 PolarHBondContact O-N 3.26Å; V27-A29 VanDerWaalsContact C-N 3.31Å; V27-A29 PolarHBondContact O-N 2.87Å; V27-V30 PolarHBondContact O-N 3.33Å; V27-L31 HydrophobicContact CG1-CD1 4.03Å; V27-L31 WeakPolarHBondContact O-CG 3.34Å; V27-L31 PolarHBondContact O-N 3.23Å; V27-L31 VanDerWaalsContact O-N 3.11Å
28	G	98.1	Very high	97.9	Very high	36 Å²	36	93.9 Å²	93.9	37%	0.371	51%	0.511	S	S	.	.	H	α-helix	trans	-58.7	-42.1	177.5	0	0	0	0	0	112.3	T24 I25 L31 F32	T24-G28 WeakPolarHBondContact O-CA 3.35Å; T24-G28 PolarHBondContact O-N 3.43Å; I25-G28 PolarHBondContact O-N 3.28Å; G28-L31 PolarHBondContact O-N 2.78Å; G28-F32 WeakPolarHBondContact O-CB 3.29Å; G28-F32 PolarHBondContact O-N 3.38Å
29	A	98.3	Very high	97.9	Very high	53 Å²	53	89.7 Å²	89.7	44%	0.438	49%	0.492	S	S	.	.	H	α-helix	trans	-64	-47.2	178.9	0	0	0	0	0	112.2	I25 M26 V27 L31 F32 E33	I25-A29 VanDerWaalsContact O-CB 3.29Å; I25-A29 WeakPolarHBondContact O-CB 3.14Å; I25-A29 PolarHBondContact O-N 2.77Å; M26-A29 PolarHBondContact O-N 3.27Å; V27-A29 VanDerWaalsContact C-N 3.31Å; V27-A29 PolarHBondContact O-N 2.87Å; A29-L31 VanDerWaalsContact C-N 3.34Å; A29-L31 PolarHBondContact O-N 2.98Å; A29-F32 PolarHBondContact O-N 3.3Å; A29-E33 WeakPolarHBondContact O-CB 3.48Å; A29-E33 PolarHBondContact O-N 3.43Å
30	V	98	Very high	98	Very high	97 Å²	97	87.2 Å²	87.2	59%	0.588	48%	0.48	S	S	*	.	H	α-helix	trans	-63.2	-40.3	179.5	173.5	0	0	0	0	111.7	M26 V27	M26-V30 WeakPolarHBondContact O-CG2 3.31Å; M26-V30 PolarHBondContact O-N 2.91Å; V27-V30 PolarHBondContact O-N 3.33Å
31	L	98.3	Very high	98	Very high	115 Å²	115	89.4 Å²	89.4	60%	0.602	49%	0.49	S	S	*	.	H	α-helix	trans	-70.1	-41.7	176.3	-67.5	177.4	0	0	0	111.7	V27 G28 A29 V35	V27-L31 HydrophobicContact CG1-CD1 4.03Å; V27-L31 WeakPolarHBondContact O-CG 3.34Å; V27-L31 PolarHBondContact O-N 3.23Å; V27-L31 VanDerWaalsContact O-N 3.11Å; G28-L31 PolarHBondContact O-N 2.78Å; A29-L31 VanDerWaalsContact C-N 3.34Å; A29-L31 PolarHBondContact O-N 2.98Å; L31-V35 WeakPolarHBondContact O-CG2 3.49Å; L31-V35 PolarHBondContact O-N 3.46Å
32	F	97.9	Very high	98	Very high	129 Å²	129	88 Å²	88	57%	0.566	49%	0.493	S	S	*	.	H	α-helix	trans	-62.1	-47.5	178.5	178.4	-93.7	0	0	0	111.3	G28 A29 R34 V35 F36	G28-F32 WeakPolarHBondContact O-CB 3.29Å; G28-F32 PolarHBondContact O-N 3.38Å; A29-F32 PolarHBondContact O-N 3.3Å; F32-R34 PolarHBondContact O-N 3.49Å; F32-V35 PolarHBondContact O-N 2.92Å; F32-F36 HydrophobicContact CD1-CB 4.16Å; F32-F36 HydrophobicContact CE1-CB 3.81Å; F32-F36 HydrophobicContact CE1-CD1 4.49Å; F32-F36 AromaticContact CE1-CD2 3.96Å; F32-F36 HydrophobicContact CE1-CD2 3.96Å; F32-F36 AromaticContact CE1-CG 3.83Å; F32-F36 HydrophobicContact CE1-CG 3.83Å; F32-F36 HydrophobicContact CE2-CB 4.43Å; F32-F36 HydrophobicContact CE2-CD2 4.11Å; F32-F36 HydrophobicContact CZ-CB 3.97Å; F32-F36 AromaticContact CZ-CD2 3.43Å; F32-F36 HydrophobicContact CZ-CD2 3.43Å; F32-F36 VanDerWaalsContact CZ-CD2 3.43Å; F32-F36 HydrophobicContact CZ-CE2 4.11Å; F32-F36 AromaticContact CZ-CG 3.8Å; F32-F36 HydrophobicContact CZ-CG 3.8Å; F32-F36 WeakPolarHBondContact O-CB 3.33Å; F32-F36 PolarHBondContact O-N 3.5Å
33	E	97.7	Very high	98	Very high	114 Å²	114	90.6 Å²	90.6	53%	0.533	50%	0.5	S	S	.	.	H	α-helix	trans	-49.1	-55.5	177.5	179.3	-179.2	-169.6	0	0	111	A29 V35 F36 D37	A29-E33 WeakPolarHBondContact O-CB 3.48Å; A29-E33 PolarHBondContact O-N 3.43Å; E33-V35 PolarHBondContact O-N 2.97Å; E33-F36 PolarHBondContact O-N 3.45Å; E33-D37 WeakPolarHBondContact O-CB 3.31Å; E33-D37 VanDerWaalsContact O-CG 3.23Å; E33-D37 PolarHBondContact O-N 3.46Å
34	R	97.8	Very high	98	Very high	178 Å²	178	91.3 Å²	91.3	67%	0.672	50%	0.496	S	S	*	.	H	α-helix	trans	-63.7	-39	-176.7	-168.6	169.7	-175.3	94.5	-1.1	113.5	F32 Q38	F32-R34 PolarHBondContact O-N 3.49Å; R34-Q38 VanDerWaalsContact O-CG 3.32Å; R34-Q38 WeakPolarHBondContact O-CG 3.38Å; R34-Q38 PolarHBondContact O-N 3.4Å
35	V	98.1	Very high	98	Very high	107 Å²	107	93.1 Å²	93.1	65%	0.648	50%	0.502	S	S	*	.	H	α-helix	trans	-72.7	-42.4	179	173.2	0	0	0	0	110.6	L31 F32 E33 G39	L31-V35 WeakPolarHBondContact O-CG2 3.49Å; L31-V35 PolarHBondContact O-N 3.46Å; F32-V35 PolarHBondContact O-N 2.92Å; E33-V35 PolarHBondContact O-N 2.97Å; V35-G39 PolarHBondContact O-N 3.24Å
36	F	97.6	Very high	98	Very high	124 Å²	124	96.2 Å²	96.2	54%	0.544	51%	0.514	S	S	.	.	H	α-helix	trans	-67.7	-43.5	-177.9	-170.8	-94.1	0	0	0	111.3	F32 E33 G39 G40	F32-F36 HydrophobicContact CD1-CB 4.16Å; F32-F36 HydrophobicContact CE1-CB 3.81Å; F32-F36 HydrophobicContact CE1-CD1 4.49Å; F32-F36 AromaticContact CE1-CD2 3.96Å; F32-F36 HydrophobicContact CE1-CD2 3.96Å; F32-F36 AromaticContact CE1-CG 3.83Å; F32-F36 HydrophobicContact CE1-CG 3.83Å; F32-F36 HydrophobicContact CE2-CB 4.43Å; F32-F36 HydrophobicContact CE2-CD2 4.11Å; F32-F36 HydrophobicContact CZ-CB 3.97Å; F32-F36 AromaticContact CZ-CD2 3.43Å; F32-F36 HydrophobicContact CZ-CD2 3.43Å; F32-F36 VanDerWaalsContact CZ-CD2 3.43Å; F32-F36 HydrophobicContact CZ-CE2 4.11Å; F32-F36 AromaticContact CZ-CG 3.8Å; F32-F36 HydrophobicContact CZ-CG 3.8Å; F32-F36 WeakPolarHBondContact O-CB 3.33Å; F32-F36 PolarHBondContact O-N 3.5Å; E33-F36 PolarHBondContact O-N 3.45Å; F36-G39 PolarHBondContact O-N 3.4Å; F36-G40 WeakPolarHBondContact O-CA 3.47Å; F36-G40 PolarHBondContact O-N 2.99Å
37	D	97.9	Very high	98	Very high	83 Å²	83	96.6 Å²	96.6	44%	0.444	52%	0.516	S	S	.	.	H	α-helix	trans	-61.9	-51.3	177	-71	-16	0	0	0	111	E33 G39 G40 D41	E33-D37 WeakPolarHBondContact O-CB 3.31Å; E33-D37 VanDerWaalsContact O-CG 3.23Å; E33-D37 PolarHBondContact O-N 3.46Å; D37-G39 PolarHBondContact O-N 2.97Å; D37-G40 PolarHBondContact O-N 3.49Å; D37-D41 WeakPolarHBondContact O-CB 3.48Å; D37-D41 PolarHBondContact O-N 3.27Å
38	Q	97.8	Very high	97.9	Very high	118 Å²	118	94.8 Å²	94.8	55%	0.551	50%	0.504	S	S	*	.	H	α-helix	trans	-63.6	-40.7	179.4	-70.6	-178.3	22.8	0	0	112.5	R34 A42	R34-Q38 VanDerWaalsContact O-CG 3.32Å; R34-Q38 WeakPolarHBondContact O-CG 3.38Å; R34-Q38 PolarHBondContact O-N 3.4Å; Q38-A42 VanDerWaalsContact O-CB 3.27Å; Q38-A42 WeakPolarHBondContact O-CB 3.45Å; Q38-A42 PolarHBondContact O-N 2.99Å
39	G	98.1	Very high	97.9	Very high	32 Å²	32	103 Å²	103	33%	0.33	52%	0.524	S	S	.	.	H	α-helix	trans	-67	-43.9	177.6	0	0	0	0	0	112.1	V35 F36 D37 A42 I43	V35-G39 PolarHBondContact O-N 3.24Å; F36-G39 PolarHBondContact O-N 3.4Å; D37-G39 PolarHBondContact O-N 2.97Å; G39-A42 PolarHBondContact O-N 3.47Å; G39-I43 VanDerWaalsContact O-CG1 3.29Å; G39-I43 WeakPolarHBondContact O-CG1 3.11Å; G39-I43 PolarHBondContact O-N 3.29Å
40	G	98.2	Very high	97.7	Very high	34 Å²	34	102.8 Å²	102.8	35%	0.351	53%	0.526	S	S	.	.	H	α-helix	trans	-62.7	-47.6	177.2	0	0	0	0	0	111.7	F36 D37 I43 F44	F36-G40 WeakPolarHBondContact O-CA 3.47Å; F36-G40 PolarHBondContact O-N 2.99Å; D37-G40 PolarHBondContact O-N 3.49Å; G40-I43 PolarHBondContact O-N 2.9Å; G40-F44 WeakPolarHBondContact O-CB 3.47Å; G40-F44 PolarHBondContact O-N 3.32Å
41	D	97.9	Very high	97.6	Very high	95 Å²	95	105.9 Å²	105.9	51%	0.508	53%	0.532	S	S	.	.	H	α-helix	trans	-56.3	-53.4	173.4	-80.4	-19.1	0	0	0	110	D37 I43 F44 E45	D37-D41 WeakPolarHBondContact O-CB 3.48Å; D37-D41 PolarHBondContact O-N 3.27Å; D41-I43 VanDerWaalsContact C-N 3.34Å; D41-I43 PolarHBondContact O-N 2.8Å; D41-F44 CarbonylContact O-C 3.53Å; D41-F44 WeakPolarHBondContact O-CA 3.29Å; D41-F44 WeakPolarHBondContact O-CB 3.33Å; D41-F44 PolarHBondContact O-N 2.84Å; D41-E45 WeakPolarHBondContact O-CG 3.47Å; D41-E45 PolarHBondContact O-N 3.08Å
42	A	97.7	Very high	97.6	Very high	54 Å²	54	102.2 Å²	102.2	45%	0.446	51%	0.513	S	S	.	.	H	α-helix	trans	-54.7	-46.3	-179.6	0	0	0	0	0	112.9	Q38 G39 F44 E45 Q46	Q38-A42 VanDerWaalsContact O-CB 3.27Å; Q38-A42 WeakPolarHBondContact O-CB 3.45Å; Q38-A42 PolarHBondContact O-N 2.99Å; G39-A42 PolarHBondContact O-N 3.47Å; A42-F44 VanDerWaalsContact C-N 3.35Å; A42-E45 PolarHBondContact O-N 3.23Å; A42-Q46 VanDerWaalsContact O-CB 3.31Å; A42-Q46 WeakPolarHBondContact O-CB 3.45Å; A42-Q46 PolarHBondContact O-N 3.19Å
43	I	98.4	Very high	97.5	Very high	105 Å²	105	102.4 Å²	102.4	54%	0.538	51%	0.51	S	S	.	.	H	α-helix	trans	-60.7	-47.3	176.1	-69.8	166.7	0	0	0	110	G39 G40 D41 Q46 M47	G39-I43 VanDerWaalsContact O-CG1 3.29Å; G39-I43 WeakPolarHBondContact O-CG1 3.11Å; G39-I43 PolarHBondContact O-N 3.29Å; G40-I43 PolarHBondContact O-N 2.9Å; D41-I43 VanDerWaalsContact C-N 3.34Å; D41-I43 PolarHBondContact O-N 2.8Å; I43-Q46 PolarHBondContact O-N 3.36Å; I43-M47 HydrophobicContact CG2-SD 3.99Å; I43-M47 WeakPolarHBondContact O-CB 3.45Å; I43-M47 VanDerWaalsContact O-CG 3.31Å; I43-M47 WeakPolarHBondContact O-CG 3.44Å; I43-M47 PolarHBondContact O-N 2.9Å
44	F	97.9	Very high	97.3	Very high	104 Å²	104	101.2 Å²	101.2	46%	0.456	50%	0.503	S	S	.	.	H	α-helix	trans	-64.3	-41.4	-179.9	178.5	-104	0	0	0	112.6	G40 D41 A42 M47 N48 L52	G40-F44 WeakPolarHBondContact O-CB 3.47Å; G40-F44 PolarHBondContact O-N 3.32Å; D41-F44 CarbonylContact O-C 3.53Å; D41-F44 WeakPolarHBondContact O-CA 3.29Å; D41-F44 WeakPolarHBondContact O-CB 3.33Å; D41-F44 PolarHBondContact O-N 2.84Å; A42-F44 VanDerWaalsContact C-N 3.35Å; F44-M47 PolarHBondContact O-N 2.97Å; F44-N48 WeakPolarHBondContact CD2-ND2 3.24Å; F44-N48 VanDerWaalsContact CE2-ND2 3.33Å; F44-N48 WeakPolarHBondContact CE2-ND2 3.34Å; F44-N48 WeakPolarHBondContact O-CB 3.41Å; F44-N48 PolarHBondContact O-N 3.48Å; F44-N48 VanDerWaalsContact O-N 3.08Å; F44-N48 PolarHBondContact O-ND2 2.97Å; F44-L52 HydrophobicContact CD1-CD1 4.45Å; F44-L52 HydrophobicContact CD1-CD2 4.45Å; F44-L52 HydrophobicContact CE1-CD1 4.27Å; F44-L52 HydrophobicContact CE1-CD2 3.59Å; F44-L52 HydrophobicContact CZ-CD2 4.23Å
45	E	97.8	Very high	97.2	Very high	72 Å²	72	95.1 Å²	95.1	34%	0.336	48%	0.482	S	S	.	.	H	α-helix	trans	-63.2	-45.2	176.4	-33.5	-151.4	143.5	0	0	110.9	D41 A42 M47 N48 R49 L52 K54	D41-E45 WeakPolarHBondContact O-CG 3.47Å; D41-E45 PolarHBondContact O-N 3.08Å; A42-E45 PolarHBondContact O-N 3.23Å; E45-M47 PolarHBondContact O-N 2.71Å; E45-N48 CarbonylContact O-C 3.27Å; E45-N48 VanDerWaalsContact O-C 3.27Å; E45-N48 PolarHBondContact O-N 3.26Å; E45-R49 WeakPolarHBondContact O-CA 3.46Å; E45-R49 PolarHBondContact O-N 3.19Å; E45-L52 HydrophobicContact CB-CD1 4.41Å; E45-K54 WeakPolarHBondContact OE1-CE 3.29Å; E45-K54 IonicContact OE1-NZ 2.61Å; E45-K54 PolarHBondContact OE1-NZ 2.99Å; E45-K54 WeakPolarHBondContact OE2-CE 3.43Å; E45-K54 IonicContact OE2-NZ 3.45Å; E45-K54 PolarHBondContact OE2-NZ 2.87Å
46	Q	97.4	Very high	97.1	Very high	153 Å²	153	92.5 Å²	92.5	72%	0.715	46%	0.463	S	S	*	.	H	α-helix	trans	-62.9	-43.2	-179.7	-177.4	175.3	-8.1	0	0	111.2	A42 I43 N48 R49	A42-Q46 VanDerWaalsContact O-CB 3.31Å; A42-Q46 WeakPolarHBondContact O-CB 3.45Å; A42-Q46 PolarHBondContact O-N 3.19Å; I43-Q46 PolarHBondContact O-N 3.36Å; Q46-N48 VanDerWaalsContact C-N 3.27Å; Q46-N48 PolarHBondContact O-N 3.38Å; Q46-R49 PolarHBondContact O-N 2.98Å
47	M	98.1	Very high	96.9	Very high	144 Å²	144	90.1 Å²	90.1	71%	0.709	45%	0.453	S	S	*	.	H	α-helix	trans	-65.5	-30.6	176.7	-73.2	-179.7	64.6	0	0	112.9	I43 F44 E45	I43-M47 HydrophobicContact CG2-SD 3.99Å; I43-M47 WeakPolarHBondContact O-CB 3.45Å; I43-M47 VanDerWaalsContact O-CG 3.31Å; I43-M47 WeakPolarHBondContact O-CG 3.44Å; I43-M47 PolarHBondContact O-N 2.9Å; F44-M47 PolarHBondContact O-N 2.97Å; E45-M47 PolarHBondContact O-N 2.71Å
48	N	98	Very high	96.6	Very high	43 Å²	43	92.6 Å²	92.6	23%	0.23	46%	0.462	C	S	.	.	T	Hydrogen-bonded Turn	trans	-110.2	29.3	-177.7	-65.8	-77.9	0	0	0	112.8	F44 E45 Q46 G50 K51 L52 H55	F44-N48 WeakPolarHBondContact CD2-ND2 3.24Å; F44-N48 VanDerWaalsContact CE2-ND2 3.33Å; F44-N48 WeakPolarHBondContact CE2-ND2 3.34Å; F44-N48 WeakPolarHBondContact O-CB 3.41Å; F44-N48 PolarHBondContact O-N 3.48Å; F44-N48 VanDerWaalsContact O-N 3.08Å; F44-N48 PolarHBondContact O-ND2 2.97Å; E45-N48 CarbonylContact O-C 3.27Å; E45-N48 VanDerWaalsContact O-C 3.27Å; E45-N48 PolarHBondContact O-N 3.26Å; Q46-N48 VanDerWaalsContact C-N 3.27Å; Q46-N48 PolarHBondContact O-N 3.38Å; N48-G50 PolarHBondContact O-N 3.44Å; N48-K51 PolarHBondContact O-N 2.8Å; N48-L52 HydrophobicContact CB-CD1 3.46Å; N48-L52 VanDerWaalsContact CB-CD1 3.46Å; N48-L52 HydrophobicContact CB-CG 3.91Å; N48-L52 PolarHBondContact O-N 2.91Å; N48-H55 PolarHBondContact O-ND1 2.94Å
49	R	96.3	Very high	96.3	Very high	210 Å²	210	91.7 Å²	91.7	79%	0.792	46%	0.461	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.2	132.8	-179.8	-163.2	177.4	-175.4	-150.2	0.4	110.8	E45 Q46 K51	E45-R49 WeakPolarHBondContact O-CA 3.46Å; E45-R49 PolarHBondContact O-N 3.19Å; Q46-R49 PolarHBondContact O-N 2.98Å; R49-K51 PolarHBondContact O-N 3Å
50	G	94.9	Very high	96	Very high	48 Å²	48	97.7 Å²	97.7	50%	0.495	47%	0.474	S	S	.	.	T	Hydrogen-bonded Turn	trans	76.3	-9.3	-176.2	0	0	0	0	0	116.3	N48 H55	N48-G50 PolarHBondContact O-N 3.44Å; G50-H55 PolarHBondContact N-ND1 3.32Å
51	K	96.4	Very high	95.6	Very high	162 Å²	162	101 Å²	101	70%	0.704	48%	0.481	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.8	-33	179.2	-58.7	-179.1	-176.8	175.8	0	113.6	N48 R49	N48-K51 PolarHBondContact O-N 2.8Å; R49-K51 PolarHBondContact O-N 3Å
52	L	97.3	Very high	94.5	Very high	37 Å²	37	104 Å²	104	19%	0.194	50%	0.497	C	S	.	.	S	Bend	trans	-71.5	143.2	-178	-69.9	145.5	0	0	0	111.4	F44 E45 N48 K54 H55	F44-L52 HydrophobicContact CD1-CD1 4.45Å; F44-L52 HydrophobicContact CD1-CD2 4.45Å; F44-L52 HydrophobicContact CE1-CD1 4.27Å; F44-L52 HydrophobicContact CE1-CD2 3.59Å; F44-L52 HydrophobicContact CZ-CD2 4.23Å; E45-L52 HydrophobicContact CB-CD1 4.41Å; N48-L52 HydrophobicContact CB-CD1 3.46Å; N48-L52 VanDerWaalsContact CB-CD1 3.46Å; N48-L52 HydrophobicContact CB-CG 3.91Å; N48-L52 PolarHBondContact O-N 2.91Å; L52-K54 HydrophobicContact CB-CD 4.44Å; L52-K54 HydrophobicContact CB-CG 3.96Å; L52-K54 PolarHBondContact O-N 2.92Å; L52-H55 WeakPolarHBondContact O-CB 3.38Å; L52-H55 PolarHBondContact O-N 3.24Å
53	W	95.8	Very high	93.1	Very high	134 Å²	134	111 Å²	111	51%	0.508	52%	0.52	S	S	.	.	H	α-helix	trans	-49.9	-45.7	177.5	176.2	-117.2	0	0	0	112	H55 I56 K57 Y60	W53-H55 PolarHBondContact O-N 3.5Å; W53-I56 HydrophobicContact CE3-CD1 3.99Å; W53-I56 HydrophobicContact CE3-CG1 3.84Å; W53-I56 HydrophobicContact CZ3-CD1 4.36Å; W53-I56 HydrophobicContact CZ3-CG1 4.32Å; W53-I56 CarbonylContact O-C 3.56Å; W53-I56 WeakPolarHBondContact O-CG1 3.42Å; W53-I56 PolarHBondContact O-N 2.89Å; W53-K57 HydrophobicContact CD2-CB 4.19Å; W53-K57 HydrophobicContact CG-CB 4.49Å; W53-K57 HydrophobicContact CZ2-CB 4.12Å; W53-K57 HydrophobicContact CZ2-CG 3.77Å; W53-K57 VanDerWaalsContact O-CB 3.29Å; W53-K57 WeakPolarHBondContact O-CB 3.42Å; W53-K57 PolarHBondContact O-N 2.78Å; W53-Y60 AromaticContact CH2-CD2 3.73Å; W53-Y60 HydrophobicContact CH2-CD2 3.73Å; W53-Y60 HydrophobicContact CH2-CG 4.02Å; W53-Y60 AromaticContact CZ3-CD2 3.57Å; W53-Y60 HydrophobicContact CZ3-CD2 3.57Å; W53-Y60 HydrophobicContact CZ3-CE2 4.13Å; W53-Y60 HydrophobicContact CZ3-CG 4.24Å
54	K	94.5	Very high	91.2	Very high	89 Å²	89	118.6 Å²	118.6	39%	0.387	55%	0.554	S	S	.	*	H	α-helix	trans	-52.5	-27.1	176.8	71.9	-170.5	174.3	-147.8	0	114.8	E45 L52	E45-K54 WeakPolarHBondContact OE1-CE 3.29Å; E45-K54 IonicContact OE1-NZ 2.61Å; E45-K54 PolarHBondContact OE1-NZ 2.99Å; E45-K54 WeakPolarHBondContact OE2-CE 3.43Å; E45-K54 IonicContact OE2-NZ 3.45Å; E45-K54 PolarHBondContact OE2-NZ 2.87Å; L52-K54 HydrophobicContact CB-CD 4.44Å; L52-K54 HydrophobicContact CB-CG 3.96Å; L52-K54 PolarHBondContact O-N 2.92Å
55	H	95.4	Very high	90.8	Very high	49 Å²	49	119.4 Å²	119.4	23%	0.227	56%	0.558	C	S	.	*	H	α-helix	trans	-82.2	-30.2	177.5	-57.3	147	0	0	0	112.6	N48 G50 L52 W53 H58	N48-H55 PolarHBondContact O-ND1 2.94Å; G50-H55 PolarHBondContact N-ND1 3.32Å; L52-H55 WeakPolarHBondContact O-CB 3.38Å; L52-H55 PolarHBondContact O-N 3.24Å; W53-H55 PolarHBondContact O-N 3.5Å; H55-H58 PolarHBondContact O-CE1 2.97Å; H55-H58 PolarHBondContact O-ND1 2.99Å
56	I	94.9	Very high	90.5	Very high	52 Å²	52	121.8 Å²	121.8	27%	0.267	57%	0.57	S	S	.	*	H	α-helix	trans	-108	-9.9	-173.5	62.6	169.4	0	0	0	113.5	W53 H58 N59 Y60	W53-I56 HydrophobicContact CE3-CD1 3.99Å; W53-I56 HydrophobicContact CE3-CG1 3.84Å; W53-I56 HydrophobicContact CZ3-CD1 4.36Å; W53-I56 HydrophobicContact CZ3-CG1 4.32Å; W53-I56 CarbonylContact O-C 3.56Å; W53-I56 WeakPolarHBondContact O-CG1 3.42Å; W53-I56 PolarHBondContact O-N 2.89Å; I56-H58 PolarHBondContact O-N 3.05Å; I56-N59 VanDerWaalsContact O-CB 3.3Å; I56-N59 WeakPolarHBondContact O-CB 3.32Å; I56-N59 PolarHBondContact O-N 3.37Å; I56-N59 PolarHBondContact O-ND2 2.99Å; I56-N59 VanDerWaalsContact O-ND2 3.16Å; I56-Y60 HydrophobicContact CB-CE2 4.33Å; I56-Y60 HydrophobicContact CD1-CE2 4.21Å; I56-Y60 HydrophobicContact CG1-CE2 4.39Å; I56-Y60 VanDerWaalsContact O-CD2 3.27Å; I56-Y60 WeakPolarHBondContact O-CD2 3.33Å
57	K	94.1	Very high	90.1	Very high	74 Å²	74	120.1 Å²	120.1	32%	0.322	56%	0.562	S	S	.	*	G	3₁₀ helix	trans	-52.7	-38.9	-176.9	-175.4	176.6	-158.7	-105	0	112.7	W53 N59 Y60 E61	W53-K57 HydrophobicContact CD2-CB 4.19Å; W53-K57 HydrophobicContact CG-CB 4.49Å; W53-K57 HydrophobicContact CZ2-CB 4.12Å; W53-K57 HydrophobicContact CZ2-CG 3.77Å; W53-K57 VanDerWaalsContact O-CB 3.29Å; W53-K57 WeakPolarHBondContact O-CB 3.42Å; W53-K57 PolarHBondContact O-N 2.78Å; K57-N59 PolarHBondContact O-N 3.2Å; K57-Y60 PolarHBondContact O-N 3.49Å; K57-E61 WeakPolarHBondContact CD-OE2 3.29Å; K57-E61 WeakPolarHBondContact CE-OE1 3.36Å; K57-E61 VanDerWaalsContact CE-OE2 3.23Å; K57-E61 WeakPolarHBondContact CE-OE2 3.26Å; K57-E61 HydrophobicContact CG-CG 4Å; K57-E61 WeakPolarHBondContact CG-OE2 3.33Å; K57-E61 IonicContact NZ-OE1 2.66Å; K57-E61 PolarHBondContact NZ-OE1 2.93Å; K57-E61 IonicContact NZ-OE2 2.66Å; K57-E61 PolarHBondContact NZ-OE2 3.46Å; K57-E61 PolarHBondContact O-N 3.47Å; K57-E61 VanDerWaalsContact O-N 3.11Å
58	H	91.9	Very high	89.6	Confident	135 Å²	135	118.7 Å²	118.7	63%	0.625	55%	0.553	S	S	*	*	G	3₁₀ helix	trans	-59.6	-17.5	177.2	70.6	-86.6	0	0	0	114.4	H55 I56 Y60	H55-H58 PolarHBondContact O-CE1 2.97Å; H55-H58 PolarHBondContact O-ND1 2.99Å; I56-H58 PolarHBondContact O-N 3.05Å; H58-Y60 VanDerWaalsContact C-N 3.32Å
59	N	91.8	Very high	89.1	Confident	100 Å²	100	123.4 Å²	123.4	54%	0.535	57%	0.574	S	S	.	*	G	3₁₀ helix	trans	-82.1	-11.3	175.3	-60.1	-52.8	0	0	0	113.2	I56 K57	I56-N59 VanDerWaalsContact O-CB 3.3Å; I56-N59 WeakPolarHBondContact O-CB 3.32Å; I56-N59 PolarHBondContact O-N 3.37Å; I56-N59 PolarHBondContact O-ND2 2.99Å; I56-N59 VanDerWaalsContact O-ND2 3.16Å; K57-N59 PolarHBondContact O-N 3.2Å
60	Y	90.9	Very high	88.6	Confident	157 Å²	157	117.7 Å²	117.7	62%	0.616	56%	0.559	S	S	*	*	T	Hydrogen-bonded Turn	trans	-130.5	-12.8	-166.9	-57.8	-72	0	0	0	114.1	W53 I56 K57 H58	W53-Y60 AromaticContact CH2-CD2 3.73Å; W53-Y60 HydrophobicContact CH2-CD2 3.73Å; W53-Y60 HydrophobicContact CH2-CG 4.02Å; W53-Y60 AromaticContact CZ3-CD2 3.57Å; W53-Y60 HydrophobicContact CZ3-CD2 3.57Å; W53-Y60 HydrophobicContact CZ3-CE2 4.13Å; W53-Y60 HydrophobicContact CZ3-CG 4.24Å; I56-Y60 HydrophobicContact CB-CE2 4.33Å; I56-Y60 HydrophobicContact CD1-CE2 4.21Å; I56-Y60 HydrophobicContact CG1-CE2 4.39Å; I56-Y60 VanDerWaalsContact O-CD2 3.27Å; I56-Y60 WeakPolarHBondContact O-CD2 3.33Å; K57-Y60 PolarHBondContact O-N 3.49Å; H58-Y60 VanDerWaalsContact C-N 3.32Å
61	E	90.4	Very high	88.1	Confident	105 Å²	105	122.6 Å²	122.6	49%	0.491	56%	0.564	S	S	.	*			trans	-95.2	123	171.1	-70	-173.3	155.9	0	0	109.3	K57	K57-E61 WeakPolarHBondContact CD-OE2 3.29Å; K57-E61 WeakPolarHBondContact CE-OE1 3.36Å; K57-E61 VanDerWaalsContact CE-OE2 3.23Å; K57-E61 WeakPolarHBondContact CE-OE2 3.26Å; K57-E61 HydrophobicContact CG-CG 4Å; K57-E61 WeakPolarHBondContact CG-OE2 3.33Å; K57-E61 IonicContact NZ-OE1 2.66Å; K57-E61 PolarHBondContact NZ-OE1 2.93Å; K57-E61 IonicContact NZ-OE2 2.66Å; K57-E61 PolarHBondContact NZ-OE2 3.46Å; K57-E61 PolarHBondContact O-N 3.47Å; K57-E61 VanDerWaalsContact O-N 3.11Å
62	N	75.4	Confident	87.5	Confident	156 Å²	156	119.6 Å²	119.6	83%	0.834	55%	0.553	S	S	*	*			trans	-75.4	137.5	167.8	-68.2	-41.2	0	0	0	108.2	E64	N62-E64 PolarHBondContact O-N 3.48Å; N62-E64 VanDerWaalsContact O-N 3.09Å
63	E	66.4	Low	86.7	Confident	203 Å²	203	126.5 Å²	126.5	95%	0.949	58%	0.583	S	S	*	*			trans	-65.6	104.5	165.2	-67.1	178.7	170.9	0	0	107.4
64	E	58.8	Low	85.9	Confident	264 Å²	264	125.8 Å²	125.8	100%	1.234	59%	0.59	S	S	*	*			trans	-75.1	0	157.9	-80.8	-168.3	163.2	0	0	110.2	N62	N62-E64 PolarHBondContact O-N 3.48Å; N62-E64 VanDerWaalsContact O-N 3.09Å

Retrieved 64 of 64 residues in 179.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).