A0A087YPM0_POEFO Loading...

Bublin coiled coil protein

AlphaFold DB , UniProt , Accession A0A087YPM0, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 82 aa.

						>A0A087YPM0_POEFO|A0A087YPM0
MSGPNGDPNISSEDGIINDDDEYGDEEYAAINNMLDQINSYLDNLEERNDALNEKLHELLESNRQARLDFRAQLTGSPTQEE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.9	Low	57.8	Low	243 Å²	243	123.7 Å²	123.7	100%	1.197	75%	0.749	S	S	*	*				0	84	0	-64	-69.4	-101.5	0	0	106.8
2	S	54.2	Low	57.6	Low	122 Å²	122	123.7 Å²	123.7	85%	0.853	76%	0.759	S	S	*	*			trans	-70.3	134.7	176.8	-59.7	0	0	0	0	109
3	G	57	Low	57.3	Low	51 Å²	51	127.6 Å²	127.6	53%	0.526	76%	0.763	S	S	.	*			trans	-67.4	178	-175.6	0	0	0	0	0	113.9	N5 G6	G3-N5 PolarHBondContact O-N 3.39Å; G3-G6 PolarHBondContact O-N 2.86Å
4	P	63.4	Low	57.2	Low	136 Å²	136	129.6 Å²	129.6	88%	0.883	77%	0.768	S	S	*	*	S	Bend	trans	-64.1	-10	-174.6	27.4	-34.8	0	0	0	114.3	G6	P4-G6 PolarHBondContact O-N 2.76Å
5	N	59	Low	56.8	Low	153 Å²	153	124.9 Å²	124.9	82%	0.818	76%	0.758	S	S	*	*	S	Bend	trans	-99.8	61.3	173	-59.9	-9.2	0	0	0	108.7	G3 D7	G3-N5 PolarHBondContact O-N 3.39Å; N5-D7 PolarHBondContact O-N 2.9Å
6	G	58.2	Low	56.7	Low	53 Å²	53	125.6 Å²	125.6	55%	0.546	75%	0.754	S	S	.	*	P	Polyproline II helix	trans	-48.8	128.1	173.9	0	0	0	0	0	109.2	G3 P4	G3-G6 PolarHBondContact O-N 2.86Å; P4-G6 PolarHBondContact O-N 2.76Å
7	D	62.8	Low	56.7	Low	156 Å²	156	126.9 Å²	126.9	83%	0.834	75%	0.754	S	S	*	*	P	Polyproline II helix	trans	-47.7	133.3	176	-99.9	-35.7	0	0	0	108.5	N5 N9	N5-D7 PolarHBondContact O-N 2.9Å; D7-N9 PolarHBondContact O-N 3.11Å
8	P	61.4	Low	56.5	Low	99 Å²	99	124.2 Å²	124.2	64%	0.643	74%	0.735	S	S	*	*	P	Polyproline II helix	trans	-56.6	117.1	173.4	22.7	-28.5	0	0	0	106.5	I10	P8-I10 PolarHBondContact O-N 2.77Å
9	N	57.8	Low	56.4	Low	146 Å²	146	124.4 Å²	124.4	78%	0.781	73%	0.733	S	S	*	*			trans	-65.9	82.9	168	-175.8	19.3	0	0	0	106.2	D7 S11	D7-N9 PolarHBondContact O-N 3.11Å; N9-S11 PolarHBondContact O-N 3.29Å
10	I	57.9	Low	56.2	Low	135 Å²	135	125.7 Å²	125.7	69%	0.692	74%	0.736	S	S	*	*			trans	-67	84.2	158.8	-65.6	173.3	0	0	0	103.2	P8 S12	P8-I10 PolarHBondContact O-N 2.77Å; I10-S12 VanDerWaalsContact C-N 3.28Å; I10-S12 PolarHBondContact O-N 3.2Å
11	S	52.8	Low	56.3	Low	67 Å²	67	125.9 Å²	125.9	47%	0.469	73%	0.734	S	S	.	*			trans	-56.9	104.9	160.9	-168.2	0	0	0	0	104.1	N9 E13 D14	N9-S11 PolarHBondContact O-N 3.29Å; S11-E13 PolarHBondContact O-N 3.07Å; S11-D14 PolarHBondContact O-N 3.44Å
12	S	56.3	Low	57	Low	123 Å²	123	121.5 Å²	121.5	86%	0.86	71%	0.711	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.8	18.7	178.7	-32.1	0	0	0	0	113.1	I10	I10-S12 VanDerWaalsContact C-N 3.28Å; I10-S12 PolarHBondContact O-N 3.2Å
13	E	53.6	Low	57.6	Low	175 Å²	175	123.1 Å²	123.1	82%	0.818	70%	0.7	S	S	*	*	T	Hydrogen-bonded Turn	trans	-146.3	16.3	-160	-163.9	143.4	-163.2	0	0	112.6	S11	S11-E13 PolarHBondContact O-N 3.07Å
14	D	55.8	Low	58.8	Low	155 Å²	155	122.1 Å²	122.1	83%	0.829	69%	0.689	S	S	*	*	S	Bend	trans	-144.8	114	161.3	-158.8	23.3	0	0	0	110.2	S11	S11-D14 PolarHBondContact O-N 3.44Å
15	G	51.6	Low	59.8	Low	60 Å²	60	122.8 Å²	122.8	62%	0.619	69%	0.685	S	S	*	*			trans	108.6	60.7	-170.3	0	0	0	0	0	111.8	I17	G15-I17 PolarHBondContact O-N 2.94Å
16	I	53.8	Low	61.3	Low	136 Å²	136	123.3 Å²	123.3	70%	0.697	68%	0.683	S	S	*	*			trans	-34.1	114.2	142.5	-57.5	168.3	0	0	0	105.3	N18	I16-N18 WeakPolarHBondContact CG2-OD1 3.07Å; I16-N18 PolarHBondContact O-N 2.93Å
17	I	56.7	Low	62.8	Low	147 Å²	147	125 Å²	125	75%	0.754	68%	0.676	S	S	*	*			trans	-59.9	96.8	156.8	-63.8	172.9	0	0	0	101.2	G15 D19	G15-I17 PolarHBondContact O-N 2.94Å; I17-D19 PolarHBondContact O-N 3.32Å
18	N	53.8	Low	64.2	Low	78 Å²	78	123.3 Å²	123.3	42%	0.417	66%	0.659	S	S	.	*			trans	-63.2	116.5	177.2	-76.6	-55.1	0	0	0	103.3	I16 D20 D21	I16-N18 WeakPolarHBondContact CG2-OD1 3.07Å; I16-N18 PolarHBondContact O-N 2.93Å; N18-D20 HydrophobicContact CB-CB 4.13Å; N18-D20 PolarHBondContact O-N 2.89Å; N18-D21 PolarHBondContact O-N 3.23Å
19	D	53.9	Low	65.8	Low	129 Å²	129	120.7 Å²	120.7	69%	0.69	65%	0.646	S	S	*	*	G	3₁₀ helix	trans	-58.8	-7.8	167.3	-63.9	-29.8	0	0	0	110.4	I17 D21 E22	I17-D19 PolarHBondContact O-N 3.32Å; D19-D21 PolarHBondContact O-N 2.83Å; D19-E22 WeakPolarHBondContact O-CB 3.31Å; D19-E22 PolarHBondContact O-N 3.44Å; D19-E22 VanDerWaalsContact O-N 3.11Å
20	D	53.6	Low	67.6	Low	149 Å²	149	116 Å²	116	80%	0.797	63%	0.627	S	S	*	*	G	3₁₀ helix	trans	-68.8	-10.3	166.9	-66.9	-25.6	0	0	0	114.3	N18 E22	N18-D20 HydrophobicContact CB-CB 4.13Å; N18-D20 PolarHBondContact O-N 2.89Å; D20-E22 VanDerWaalsContact C-N 3.35Å
21	D	57.6	Low	69.4	Low	131 Å²	131	113 Å²	113	70%	0.701	61%	0.612	S	S	*	*	G	3₁₀ helix	trans	-93.4	7.7	168.6	-63.7	-30.6	0	0	0	111.9	N18 D19 Y23	N18-D21 PolarHBondContact O-N 3.23Å; D19-D21 PolarHBondContact O-N 2.83Å; D21-Y23 PolarHBondContact O-N 3.37Å
22	E	66.5	Low	71.5	Confident	150 Å²	150	114.2 Å²	114.2	70%	0.701	61%	0.613	S	S	*	*	S	Bend	trans	-67.7	116.1	170.3	-168.8	166.9	-158.2	0	0	108.3	D19 D20 G24	D19-E22 WeakPolarHBondContact O-CB 3.31Å; D19-E22 PolarHBondContact O-N 3.44Å; D19-E22 VanDerWaalsContact O-N 3.11Å; D20-E22 VanDerWaalsContact C-N 3.35Å; E22-G24 PolarHBondContact O-N 3.16Å
23	Y	66.8	Low	73.5	Confident	157 Å²	157	113 Å²	113	62%	0.616	60%	0.597	S	S	*	*	P	Polyproline II helix	trans	-48.7	127.8	174.9	-72.3	-85	0	0	0	109.1	D21 E27 Y28	D21-Y23 PolarHBondContact O-N 3.37Å; Y23-E27 HydrophobicContact CD1-CB 4.03Å; Y23-E27 HydrophobicContact CD1-CG 4.15Å; Y23-Y28 VanDerWaalsContact O-CE2 3.24Å; Y23-Y28 WeakPolarHBondContact O-CE2 3.46Å
24	G	81.1	Confident	75.6	Confident	30 Å²	30	109.6 Å²	109.6	31%	0.309	58%	0.583	S	S	.	*	P	Polyproline II helix	trans	-67.8	162.4	178.3	0	0	0	0	0	111.8	E22 E26 E27 Y28	E22-G24 PolarHBondContact O-N 3.16Å; G24-E26 PolarHBondContact O-N 3.42Å; G24-E27 VanDerWaalsContact C-OE2 3.29Å; G24-E27 WeakPolarHBondContact CA-OE2 3.44Å; G24-E27 PolarHBondContact N-OE2 2.93Å; G24-E27 PolarHBondContact O-N 3.05Å; G24-E27 VanDerWaalsContact O-N 3.08Å; G24-E27 VanDerWaalsContact O-OE2 3.1Å; G24-Y28 VanDerWaalsContact O-CD2 3.3Å; G24-Y28 WeakPolarHBondContact O-CD2 3.38Å; G24-Y28 PolarHBondContact O-N 2.82Å
25	D	85.8	Confident	77.7	Confident	150 Å²	150	106.3 Å²	106.3	80%	0.802	56%	0.564	S	S	*	*	H	α-helix	trans	-54	-27.4	172.4	-72.3	-28.6	0	0	0	112	A29	D25-A29 VanDerWaalsContact O-CB 3.25Å; D25-A29 WeakPolarHBondContact O-CB 3.49Å; D25-A29 PolarHBondContact O-N 2.95Å
26	E	88.6	Confident	79.9	Confident	163 Å²	163	108.2 Å²	108.2	76%	0.762	56%	0.561	S	S	*	*	H	α-helix	trans	-68.3	-43.2	177.5	-66.9	-175.6	-176.9	0	0	112.4	G24 A29 A30	G24-E26 PolarHBondContact O-N 3.42Å; E26-A29 PolarHBondContact O-N 3.19Å; E26-A30 WeakPolarHBondContact O-CB 3.28Å; E26-A30 PolarHBondContact O-N 3.49Å
27	E	90.3	Very high	82	Confident	89 Å²	89	106.6 Å²	106.6	42%	0.416	55%	0.55	S	S	.	*	H	α-helix	trans	-65.9	-41.5	176.1	-69.9	83.9	173.5	0	0	111.2	Y23 G24 A30 I31	Y23-E27 HydrophobicContact CD1-CB 4.03Å; Y23-E27 HydrophobicContact CD1-CG 4.15Å; G24-E27 VanDerWaalsContact C-OE2 3.29Å; G24-E27 WeakPolarHBondContact CA-OE2 3.44Å; G24-E27 PolarHBondContact N-OE2 2.93Å; G24-E27 PolarHBondContact O-N 3.05Å; G24-E27 VanDerWaalsContact O-N 3.08Å; G24-E27 VanDerWaalsContact O-OE2 3.1Å; E27-A30 PolarHBondContact O-N 3.34Å; E27-I31 VanDerWaalsContact O-CG1 3.28Å; E27-I31 WeakPolarHBondContact O-CG1 3.28Å; E27-I31 PolarHBondContact O-N 3.02Å
28	Y	92.8	Very high	84	Confident	120 Å²	120	103.8 Å²	103.8	47%	0.471	54%	0.536	S	S	.	.	H	α-helix	trans	-64.3	-40.1	173.7	-72.1	-66.4	0	0	0	112	Y23 G24 A30 I31 N32	Y23-Y28 VanDerWaalsContact O-CE2 3.24Å; Y23-Y28 WeakPolarHBondContact O-CE2 3.46Å; G24-Y28 VanDerWaalsContact O-CD2 3.3Å; G24-Y28 WeakPolarHBondContact O-CD2 3.38Å; G24-Y28 PolarHBondContact O-N 2.82Å; Y28-A30 VanDerWaalsContact C-N 3.34Å; Y28-I31 PolarHBondContact O-N 3.36Å; Y28-N32 WeakPolarHBondContact O-CB 3.39Å; Y28-N32 VanDerWaalsContact O-CG 3.29Å; Y28-N32 PolarHBondContact O-N 3.16Å; Y28-N32 PolarHBondContact O-ND2 2.9Å
29	A	95.1	Very high	86.1	Confident	44 Å²	44	104 Å²	104	36%	0.364	54%	0.537	S	S	.	.	H	α-helix	trans	-64.5	-38.3	173.8	0	0	0	0	0	112.1	D25 E26 N32 N33	D25-A29 VanDerWaalsContact O-CB 3.25Å; D25-A29 WeakPolarHBondContact O-CB 3.49Å; D25-A29 PolarHBondContact O-N 2.95Å; E26-A29 PolarHBondContact O-N 3.19Å; A29-N32 PolarHBondContact O-N 2.88Å; A29-N33 WeakPolarHBondContact O-CB 3.38Å; A29-N33 PolarHBondContact O-N 2.86Å; A29-N33 PolarHBondContact O-ND2 2.99Å
30	A	96	Very high	88.2	Confident	47 Å²	47	100.8 Å²	100.8	39%	0.388	52%	0.524	S	S	.	.	H	α-helix	trans	-65.2	-43	174.7	0	0	0	0	0	111.5	E26 E27 Y28 N33 M34	E26-A30 WeakPolarHBondContact O-CB 3.28Å; E26-A30 PolarHBondContact O-N 3.49Å; E27-A30 PolarHBondContact O-N 3.34Å; Y28-A30 VanDerWaalsContact C-N 3.34Å; A30-N33 PolarHBondContact O-N 3.37Å; A30-M34 WeakPolarHBondContact O-CG 3.28Å; A30-M34 PolarHBondContact O-N 3.14Å
31	I	95.6	Very high	90.4	Very high	74 Å²	74	101.5 Å²	101.5	38%	0.379	52%	0.517	S	S	.	.	H	α-helix	trans	-60.8	-47	174.9	-69.9	166	0	0	0	110.8	E27 Y28 N33 M34 L35	E27-I31 VanDerWaalsContact O-CG1 3.28Å; E27-I31 WeakPolarHBondContact O-CG1 3.28Å; E27-I31 PolarHBondContact O-N 3.02Å; Y28-I31 PolarHBondContact O-N 3.36Å; I31-N33 VanDerWaalsContact C-N 3.34Å; I31-N33 PolarHBondContact O-N 3.38Å; I31-M34 HydrophobicContact CG1-CE 4.18Å; I31-M34 WeakPolarHBondContact O-CB 3.41Å; I31-M34 PolarHBondContact O-N 3.15Å; I31-M34 VanDerWaalsContact O-N 3.09Å; I31-L35 HydrophobicContact CG2-CD1 4.04Å; I31-L35 HydrophobicContact CG2-CG 4.39Å; I31-L35 WeakPolarHBondContact O-CG 3.43Å; I31-L35 PolarHBondContact O-N 2.84Å
32	N	96.6	Very high	92.3	Very high	92 Å²	92	99.7 Å²	99.7	49%	0.492	51%	0.507	S	S	.	.	H	α-helix	trans	-60.3	-43.7	177.5	-72.3	-27.9	0	0	0	111.6	Y28 A29 M34 L35 D36	Y28-N32 WeakPolarHBondContact O-CB 3.39Å; Y28-N32 VanDerWaalsContact O-CG 3.29Å; Y28-N32 PolarHBondContact O-N 3.16Å; Y28-N32 PolarHBondContact O-ND2 2.9Å; A29-N32 PolarHBondContact O-N 2.88Å; N32-M34 VanDerWaalsContact C-N 3.29Å; N32-M34 PolarHBondContact O-N 2.94Å; N32-L35 PolarHBondContact O-N 3.38Å; N32-L35 VanDerWaalsContact O-N 3.15Å; N32-D36 PolarHBondContact O-N 2.96Å
33	N	97.9	Very high	93.8	Very high	96 Å²	96	97.4 Å²	97.4	51%	0.513	50%	0.499	S	S	.	.	H	α-helix	trans	-61.4	-36.7	174.4	-84.4	-67.7	0	0	0	112.7	A29 A30 I31 Q37	A29-N33 WeakPolarHBondContact O-CB 3.38Å; A29-N33 PolarHBondContact O-N 2.86Å; A29-N33 PolarHBondContact O-ND2 2.99Å; A30-N33 PolarHBondContact O-N 3.37Å; I31-N33 VanDerWaalsContact C-N 3.34Å; I31-N33 PolarHBondContact O-N 3.38Å; N33-Q37 VanDerWaalsContact O-CG 3.29Å; N33-Q37 WeakPolarHBondContact O-CG 3.48Å; N33-Q37 PolarHBondContact O-N 3.37Å; N33-Q37 VanDerWaalsContact O-N 3.1Å; N33-Q37 PolarHBondContact O-NE2 2.97Å; N33-Q37 VanDerWaalsContact O-NE2 3.08Å
34	M	98.3	Very high	95.4	Very high	105 Å²	105	93.6 Å²	93.6	52%	0.517	49%	0.489	S	S	.	.	H	α-helix	trans	-68.8	-38.6	175.1	-73.6	-173.5	-76.8	0	0	111.7	A30 I31 N32 Q37 I38	A30-M34 WeakPolarHBondContact O-CG 3.28Å; A30-M34 PolarHBondContact O-N 3.14Å; I31-M34 HydrophobicContact CG1-CE 4.18Å; I31-M34 WeakPolarHBondContact O-CB 3.41Å; I31-M34 PolarHBondContact O-N 3.15Å; I31-M34 VanDerWaalsContact O-N 3.09Å; N32-M34 VanDerWaalsContact C-N 3.29Å; N32-M34 PolarHBondContact O-N 2.94Å; M34-Q37 PolarHBondContact O-N 2.97Å; M34-I38 VanDerWaalsContact O-CG1 3.31Å; M34-I38 WeakPolarHBondContact O-CG1 3.47Å; M34-I38 PolarHBondContact O-N 3.26Å
35	L	98.6	Very high	96.2	Very high	85 Å²	85	97.7 Å²	97.7	45%	0.445	50%	0.504	S	S	.	.	H	α-helix	trans	-64.9	-42.8	175.3	-70.4	172	0	0	0	111.8	I31 N32 Q37 I38 N39	I31-L35 HydrophobicContact CG2-CD1 4.04Å; I31-L35 HydrophobicContact CG2-CG 4.39Å; I31-L35 WeakPolarHBondContact O-CG 3.43Å; I31-L35 PolarHBondContact O-N 2.84Å; N32-L35 PolarHBondContact O-N 3.38Å; N32-L35 VanDerWaalsContact O-N 3.15Å; L35-Q37 VanDerWaalsContact C-N 3.32Å; L35-Q37 PolarHBondContact O-N 3.21Å; L35-I38 PolarHBondContact O-N 3.21Å; L35-N39 VanDerWaalsContact O-CG 3.31Å; L35-N39 PolarHBondContact O-N 3.38Å; L35-N39 PolarHBondContact O-ND2 3.46Å
36	D	98.4	Very high	96.8	Very high	101 Å²	101	96.4 Å²	96.4	54%	0.54	49%	0.493	S	S	.	.	H	α-helix	trans	-63	-39.6	175.9	-71.6	-22.7	0	0	0	111.8	N32 N39 S40	N32-D36 PolarHBondContact O-N 2.96Å; D36-N39 PolarHBondContact O-N 2.85Å; D36-S40 PolarHBondContact O-N 3.23Å
37	Q	98.5	Very high	97.3	Very high	102 Å²	102	95.1 Å²	95.1	48%	0.477	49%	0.487	S	S	.	.	H	α-helix	trans	-63	-44.1	173.2	-76.8	171.5	69.1	0	0	111.9	N33 M34 L35 N39 S40 Y41	N33-Q37 VanDerWaalsContact O-CG 3.29Å; N33-Q37 WeakPolarHBondContact O-CG 3.48Å; N33-Q37 PolarHBondContact O-N 3.37Å; N33-Q37 VanDerWaalsContact O-N 3.1Å; N33-Q37 PolarHBondContact O-NE2 2.97Å; N33-Q37 VanDerWaalsContact O-NE2 3.08Å; M34-Q37 PolarHBondContact O-N 2.97Å; L35-Q37 VanDerWaalsContact C-N 3.32Å; L35-Q37 PolarHBondContact O-N 3.21Å; Q37-N39 VanDerWaalsContact C-N 3.35Å; Q37-S40 PolarHBondContact O-N 2.9Å; Q37-Y41 HydrophobicContact CB-CE2 4.34Å; Q37-Y41 WeakPolarHBondContact O-CD2 3.32Å; Q37-Y41 PolarHBondContact O-N 2.98Å
38	I	98.5	Very high	97.6	Very high	88 Å²	88	100.1 Å²	100.1	45%	0.451	50%	0.502	S	S	.	.	H	α-helix	trans	-60.7	-46	176.3	-71	165.8	0	0	0	110.3	M34 L35 S40 Y41 L42	M34-I38 VanDerWaalsContact O-CG1 3.31Å; M34-I38 WeakPolarHBondContact O-CG1 3.47Å; M34-I38 PolarHBondContact O-N 3.26Å; L35-I38 PolarHBondContact O-N 3.21Å; I38-S40 VanDerWaalsContact C-N 3.34Å; I38-S40 PolarHBondContact O-N 2.99Å; I38-Y41 PolarHBondContact O-N 3.19Å; I38-Y41 VanDerWaalsContact O-N 3.16Å; I38-L42 HydrophobicContact CG2-CD1 3.96Å; I38-L42 HydrophobicContact CG2-CG 4.34Å; I38-L42 WeakPolarHBondContact O-CG 3.28Å; I38-L42 PolarHBondContact O-N 3.29Å
39	N	98.3	Very high	97.9	Very high	83 Å²	83	98.5 Å²	98.5	44%	0.444	50%	0.501	S	S	.	.	H	α-helix	trans	-58.5	-47.4	177.3	-71.2	-27.8	0	0	0	111	L35 D36 Q37 Y41 L42 D43	L35-N39 VanDerWaalsContact O-CG 3.31Å; L35-N39 PolarHBondContact O-N 3.38Å; L35-N39 PolarHBondContact O-ND2 3.46Å; D36-N39 PolarHBondContact O-N 2.85Å; Q37-N39 VanDerWaalsContact C-N 3.35Å; N39-Y41 VanDerWaalsContact C-N 3.31Å; N39-Y41 PolarHBondContact O-N 3.11Å; N39-L42 PolarHBondContact O-N 2.99Å; N39-L42 VanDerWaalsContact O-N 3.09Å; N39-D43 VanDerWaalsContact O-CG 3.29Å; N39-D43 PolarHBondContact O-N 3.49Å
40	S	98.3	Very high	98.1	Very high	60 Å²	60	100.9 Å²	100.9	42%	0.42	51%	0.508	S	S	.	.	H	α-helix	trans	-58.9	-42.1	176	-174	0	0	0	0	112.2	D36 Q37 I38 L42 D43 N44	D36-S40 PolarHBondContact O-N 3.23Å; Q37-S40 PolarHBondContact O-N 2.9Å; I38-S40 VanDerWaalsContact C-N 3.34Å; I38-S40 PolarHBondContact O-N 2.99Å; S40-L42 VanDerWaalsContact C-N 3.33Å; S40-L42 PolarHBondContact O-N 3.15Å; S40-D43 PolarHBondContact O-N 3.16Å; S40-N44 PolarHBondContact O-N 3.07Å; S40-N44 VanDerWaalsContact O-N 3.07Å; S40-N44 PolarHBondContact O-ND2 2.92Å
41	Y	98.6	Very high	98.2	Very high	164 Å²	164	100.6 Å²	100.6	64%	0.643	51%	0.505	S	S	*	.	H	α-helix	trans	-65.1	-36.2	176.1	-71.2	-50	0	0	0	113	Q37 I38 N39 L45	Q37-Y41 HydrophobicContact CB-CE2 4.34Å; Q37-Y41 WeakPolarHBondContact O-CD2 3.32Å; Q37-Y41 PolarHBondContact O-N 2.98Å; I38-Y41 PolarHBondContact O-N 3.19Å; I38-Y41 VanDerWaalsContact O-N 3.16Å; N39-Y41 VanDerWaalsContact C-N 3.31Å; N39-Y41 PolarHBondContact O-N 3.11Å; Y41-L45 WeakPolarHBondContact O-CB 3.3Å; Y41-L45 PolarHBondContact O-N 3.18Å
42	L	98.7	Very high	98.3	Very high	94 Å²	94	102.5 Å²	102.5	49%	0.492	52%	0.516	S	S	.	.	H	α-helix	trans	-67.6	-45.1	176.4	-70.5	173.5	0	0	0	111.5	I38 N39 S40 N44 L45 E46	I38-L42 HydrophobicContact CG2-CD1 3.96Å; I38-L42 HydrophobicContact CG2-CG 4.34Å; I38-L42 WeakPolarHBondContact O-CG 3.28Å; I38-L42 PolarHBondContact O-N 3.29Å; N39-L42 PolarHBondContact O-N 2.99Å; N39-L42 VanDerWaalsContact O-N 3.09Å; S40-L42 VanDerWaalsContact C-N 3.33Å; S40-L42 PolarHBondContact O-N 3.15Å; L42-N44 VanDerWaalsContact C-N 3.33Å; L42-N44 PolarHBondContact O-N 3.47Å; L42-L45 WeakPolarHBondContact O-CB 3.33Å; L42-L45 PolarHBondContact O-N 3.25Å; L42-E46 PolarHBondContact O-N 2.75Å
43	D	98.4	Very high	98.4	Very high	101 Å²	101	101.2 Å²	101.2	54%	0.54	51%	0.509	S	S	.	.	H	α-helix	trans	-58.5	-46.3	176.8	-64.8	-18.6	0	0	0	111	N39 S40 L45 E46 E47	N39-D43 VanDerWaalsContact O-CG 3.29Å; N39-D43 PolarHBondContact O-N 3.49Å; S40-D43 PolarHBondContact O-N 3.16Å; D43-L45 VanDerWaalsContact C-N 3.29Å; D43-L45 PolarHBondContact O-N 3.38Å; D43-E46 PolarHBondContact O-N 3.32Å; D43-E47 PolarHBondContact O-N 3.01Å
44	N	98.4	Very high	98.5	Very high	77 Å²	77	102.6 Å²	102.6	41%	0.412	51%	0.512	S	S	.	.	H	α-helix	trans	-63.9	-33.9	176.4	-81.1	-85.9	0	0	0	112.5	S40 L42 R48	S40-N44 PolarHBondContact O-N 3.07Å; S40-N44 VanDerWaalsContact O-N 3.07Å; S40-N44 PolarHBondContact O-ND2 2.92Å; L42-N44 VanDerWaalsContact C-N 3.33Å; L42-N44 PolarHBondContact O-N 3.47Å; N44-R48 WeakPolarHBondContact O-CB 3.43Å; N44-R48 WeakPolarHBondContact O-CG 3.4Å; N44-R48 PolarHBondContact O-N 2.97Å
45	L	98.5	Very high	98.5	Very high	117 Å²	117	104.2 Å²	104.2	61%	0.613	52%	0.517	S	S	*	.	H	α-helix	trans	-69.9	-42.8	177.8	-169.5	98.8	0	0	0	110.8	Y41 L42 D43 R48 N49	Y41-L45 WeakPolarHBondContact O-CB 3.3Å; Y41-L45 PolarHBondContact O-N 3.18Å; L42-L45 WeakPolarHBondContact O-CB 3.33Å; L42-L45 PolarHBondContact O-N 3.25Å; D43-L45 VanDerWaalsContact C-N 3.29Å; D43-L45 PolarHBondContact O-N 3.38Å; L45-R48 PolarHBondContact O-N 2.91Å; L45-N49 WeakPolarHBondContact O-CB 3.47Å; L45-N49 PolarHBondContact O-N 2.93Å
46	E	98.4	Very high	98.5	Very high	123 Å²	123	104.5 Å²	104.5	58%	0.575	52%	0.518	S	S	*	.	H	α-helix	trans	-61.4	-50.7	177.3	-172.8	168.9	-158.3	0	0	110.7	L42 D43 R48 N49 D50	L42-E46 PolarHBondContact O-N 2.75Å; D43-E46 PolarHBondContact O-N 3.32Å; E46-R48 VanDerWaalsContact C-N 3.28Å; E46-R48 PolarHBondContact O-N 3.21Å; E46-N49 WeakPolarHBondContact O-CA 3.32Å; E46-N49 WeakPolarHBondContact O-CB 3.42Å; E46-N49 PolarHBondContact O-N 3.01Å; E46-D50 PolarHBondContact O-N 3.4Å
47	E	98.5	Very high	98.5	Very high	135 Å²	135	106 Å²	106	63%	0.631	52%	0.521	S	S	*	.	H	α-helix	trans	-56.1	-43.6	177	-175.8	-176.2	-174.4	0	0	111.9	D43 N49 D50 A51	D43-E47 PolarHBondContact O-N 3.01Å; E47-N49 VanDerWaalsContact C-N 3.32Å; E47-N49 PolarHBondContact O-N 3.34Å; E47-D50 PolarHBondContact O-N 3.43Å; E47-A51 WeakPolarHBondContact O-CB 3.21Å; E47-A51 PolarHBondContact O-N 2.94Å
48	R	98.5	Very high	98.4	Very high	195 Å²	195	106.6 Å²	106.6	74%	0.736	52%	0.524	S	S	*	.	H	α-helix	trans	-67.9	-33	177.5	-73.4	177.3	66.4	179.2	0.7	112.6	N44 L45 E46 L52	N44-R48 WeakPolarHBondContact O-CB 3.43Å; N44-R48 WeakPolarHBondContact O-CG 3.4Å; N44-R48 PolarHBondContact O-N 2.97Å; L45-R48 PolarHBondContact O-N 2.91Å; E46-R48 VanDerWaalsContact C-N 3.28Å; E46-R48 PolarHBondContact O-N 3.21Å; R48-L52 WeakPolarHBondContact O-CB 3.45Å; R48-L52 PolarHBondContact O-N 2.89Å; R48-L52 VanDerWaalsContact O-N 3.11Å
49	N	98.5	Very high	98.4	Very high	85 Å²	85	107.7 Å²	107.7	46%	0.455	53%	0.531	S	S	.	.	H	α-helix	trans	-67.7	-45.7	176.1	-164.2	-88.4	0	0	0	110.6	L45 E46 E47 L52 N53	L45-N49 WeakPolarHBondContact O-CB 3.47Å; L45-N49 PolarHBondContact O-N 2.93Å; E46-N49 WeakPolarHBondContact O-CA 3.32Å; E46-N49 WeakPolarHBondContact O-CB 3.42Å; E46-N49 PolarHBondContact O-N 3.01Å; E47-N49 VanDerWaalsContact C-N 3.32Å; E47-N49 PolarHBondContact O-N 3.34Å; N49-L52 WeakPolarHBondContact O-CB 3.42Å; N49-L52 PolarHBondContact O-N 3.46Å; N49-N53 PolarHBondContact O-N 3.33Å; N49-N53 PolarHBondContact O-ND2 2.94Å; N49-N53 PolarHBondContact OD1-ND2 2.91Å
50	D	98.6	Very high	98.4	Very high	95 Å²	95	108.8 Å²	108.8	51%	0.508	54%	0.536	S	S	.	.	H	α-helix	trans	-60.9	-48.2	177.6	-73.7	-15.3	0	0	0	111.5	E46 E47 L52 N53 E54	E46-D50 PolarHBondContact O-N 3.4Å; E47-D50 PolarHBondContact O-N 3.43Å; D50-L52 VanDerWaalsContact C-N 3.26Å; D50-L52 PolarHBondContact O-N 3.47Å; D50-N53 PolarHBondContact O-N 3.16Å; D50-N53 VanDerWaalsContact O-N 3.15Å; D50-E54 PolarHBondContact O-N 3.09Å
51	A	98.5	Very high	98.4	Very high	40 Å²	40	112.9 Å²	112.9	33%	0.331	55%	0.548	S	S	.	.	H	α-helix	trans	-62.1	-32.6	176.7	0	0	0	0	0	113	E47 K55	E47-A51 WeakPolarHBondContact O-CB 3.21Å; E47-A51 PolarHBondContact O-N 2.94Å; A51-K55 WeakPolarHBondContact O-CG 3.36Å; A51-K55 PolarHBondContact O-N 3.07Å
52	L	98.5	Very high	98.4	Very high	115 Å²	115	108.7 Å²	108.7	60%	0.602	54%	0.543	S	S	*	.	H	α-helix	trans	-69.8	-44.4	175	-173.9	79.5	0	0	0	111	R48 N49 D50 K55 L56	R48-L52 WeakPolarHBondContact O-CB 3.45Å; R48-L52 PolarHBondContact O-N 2.89Å; R48-L52 VanDerWaalsContact O-N 3.11Å; N49-L52 WeakPolarHBondContact O-CB 3.42Å; N49-L52 PolarHBondContact O-N 3.46Å; D50-L52 VanDerWaalsContact C-N 3.26Å; D50-L52 PolarHBondContact O-N 3.47Å; L52-K55 PolarHBondContact O-N 3.45Å; L52-L56 PolarHBondContact O-N 3.06Å
53	N	98.4	Very high	98.3	Very high	65 Å²	65	107.9 Å²	107.9	35%	0.348	54%	0.539	S	S	.	.	H	α-helix	trans	-63.3	-42.7	178.6	-71.4	-33.5	0	0	0	111.2	N49 D50 L56 H57	N49-N53 PolarHBondContact O-N 3.33Å; N49-N53 PolarHBondContact O-ND2 2.94Å; N49-N53 PolarHBondContact OD1-ND2 2.91Å; D50-N53 PolarHBondContact O-N 3.16Å; D50-N53 VanDerWaalsContact O-N 3.15Å; N53-L56 WeakPolarHBondContact O-CB 3.43Å; N53-L56 PolarHBondContact O-N 3.41Å; N53-H57 PolarHBondContact O-CD2 2.87Å; N53-H57 PolarHBondContact O-N 2.91Å
54	E	98.5	Very high	98.3	Very high	124 Å²	124	111.9 Å²	111.9	58%	0.579	55%	0.547	S	S	*	.	H	α-helix	trans	-57.3	-51.6	174.6	-175	176.2	-159.3	0	0	111.2	D50 L56 H57 E58	D50-E54 PolarHBondContact O-N 3.09Å; E54-L56 VanDerWaalsContact C-N 3.26Å; E54-L56 PolarHBondContact O-N 2.91Å; E54-H57 WeakPolarHBondContact O-CB 3.35Å; E54-H57 PolarHBondContact O-N 3.08Å; E54-H57 VanDerWaalsContact O-N 3.07Å; E54-E58 PolarHBondContact O-N 3.1Å
55	K	98.4	Very high	98.2	Very high	140 Å²	140	112.8 Å²	112.8	61%	0.609	55%	0.549	S	S	*	.	H	α-helix	trans	-59.6	-35.6	177	-75.5	176.5	-179.2	176.4	0	113.2	A51 L52 L59	A51-K55 WeakPolarHBondContact O-CG 3.36Å; A51-K55 PolarHBondContact O-N 3.07Å; L52-K55 PolarHBondContact O-N 3.45Å; K55-L59 VanDerWaalsContact O-CB 3.3Å; K55-L59 WeakPolarHBondContact O-CB 3.46Å; K55-L59 PolarHBondContact O-N 3.39Å
56	L	98.4	Very high	98.1	Very high	91 Å²	91	109.8 Å²	109.8	48%	0.476	54%	0.541	S	S	.	.	H	α-helix	trans	-66.4	-43.2	176	178.8	61.4	0	0	0	111.1	L52 N53 E54 L59 L60	L52-L56 PolarHBondContact O-N 3.06Å; N53-L56 WeakPolarHBondContact O-CB 3.43Å; N53-L56 PolarHBondContact O-N 3.41Å; E54-L56 VanDerWaalsContact C-N 3.26Å; E54-L56 PolarHBondContact O-N 2.91Å; L56-L59 PolarHBondContact O-N 3.45Å; L56-L60 HydrophobicContact CD1-CD1 4.35Å; L56-L60 HydrophobicContact CD1-CG 4.34Å; L56-L60 HydrophobicContact CG-CD1 4.25Å; L56-L60 VanDerWaalsContact O-CG 3.32Å; L56-L60 WeakPolarHBondContact O-CG 3.39Å; L56-L60 PolarHBondContact O-N 2.88Å
57	H	98.3	Very high	98	Very high	132 Å²	132	111.7 Å²	111.7	61%	0.611	54%	0.543	S	S	*	.	H	α-helix	trans	-61.1	-48.6	175.9	-80.1	-63.8	0	0	0	111.8	N53 E54 L59 L60 E61	N53-H57 PolarHBondContact O-CD2 2.87Å; N53-H57 PolarHBondContact O-N 2.91Å; E54-H57 WeakPolarHBondContact O-CB 3.35Å; E54-H57 PolarHBondContact O-N 3.08Å; E54-H57 VanDerWaalsContact O-N 3.07Å; H57-L59 VanDerWaalsContact C-N 3.31Å; H57-L59 PolarHBondContact O-N 3.4Å; H57-L60 PolarHBondContact O-N 3.2Å; H57-E61 PolarHBondContact O-N 3.31Å
58	E	98.3	Very high	97.9	Very high	115 Å²	115	109.5 Å²	109.5	54%	0.537	53%	0.534	S	S	.	.	H	α-helix	trans	-57.4	-44.1	176	-69.8	-177.1	161.1	0	0	111.9	E54 L60 E61 S62	E54-E58 PolarHBondContact O-N 3.1Å; E58-L60 PolarHBondContact O-N 2.96Å; E58-E61 PolarHBondContact O-N 3.34Å; E58-S62 VanDerWaalsContact O-CB 3.28Å; E58-S62 WeakPolarHBondContact O-CB 3.43Å; E58-S62 PolarHBondContact O-N 2.99Å
59	L	98.4	Very high	97.7	Very high	111 Å²	111	103.7 Å²	103.7	58%	0.581	52%	0.518	S	S	*	.	H	α-helix	trans	-63.5	-42.7	179.1	179.8	62.4	0	0	0	111.9	K55 L56 H57 N63	K55-L59 VanDerWaalsContact O-CB 3.3Å; K55-L59 WeakPolarHBondContact O-CB 3.46Å; K55-L59 PolarHBondContact O-N 3.39Å; L56-L59 PolarHBondContact O-N 3.45Å; H57-L59 VanDerWaalsContact C-N 3.31Å; H57-L59 PolarHBondContact O-N 3.4Å; L59-N63 VanDerWaalsContact O-CB 3.28Å; L59-N63 WeakPolarHBondContact O-CB 3.38Å; L59-N63 PolarHBondContact O-N 2.89Å
60	L	98.2	Very high	97.5	Very high	106 Å²	106	105.6 Å²	105.6	56%	0.555	52%	0.523	S	S	*	.	H	α-helix	trans	-66	-40.1	178.3	-72.4	174.1	0	0	0	111.7	L56 H57 E58 N63 R64	L56-L60 HydrophobicContact CD1-CD1 4.35Å; L56-L60 HydrophobicContact CD1-CG 4.34Å; L56-L60 HydrophobicContact CG-CD1 4.25Å; L56-L60 VanDerWaalsContact O-CG 3.32Å; L56-L60 WeakPolarHBondContact O-CG 3.39Å; L56-L60 PolarHBondContact O-N 2.88Å; H57-L60 PolarHBondContact O-N 3.2Å; E58-L60 PolarHBondContact O-N 2.96Å; L60-N63 PolarHBondContact O-N 2.92Å; L60-R64 WeakPolarHBondContact O-CB 3.06Å; L60-R64 PolarHBondContact O-N 2.83Å
61	E	97.9	Very high	97.2	Very high	145 Å²	145	109.4 Å²	109.4	68%	0.678	53%	0.53	S	S	*	.	H	α-helix	trans	-66.5	-47.2	176.2	-174.4	166.5	-162	0	0	111.5	H57 E58 N63 R64 Q65	H57-E61 PolarHBondContact O-N 3.31Å; E58-E61 PolarHBondContact O-N 3.34Å; E61-N63 VanDerWaalsContact C-N 3.31Å; E61-N63 PolarHBondContact O-N 2.94Å; E61-R64 WeakPolarHBondContact O-CB 3.49Å; E61-R64 PolarHBondContact O-N 3.15Å; E61-R64 VanDerWaalsContact O-N 3.15Å; E61-Q65 PolarHBondContact O-N 2.88Å
62	S	97.5	Very high	96.8	Very high	77 Å²	77	110.1 Å²	110.1	54%	0.538	54%	0.536	S	S	.	.	H	α-helix	trans	-59.2	-41.4	174.3	178.9	0	0	0	0	111.9	E58 R64 Q65 A66	E58-S62 VanDerWaalsContact O-CB 3.28Å; E58-S62 WeakPolarHBondContact O-CB 3.43Å; E58-S62 PolarHBondContact O-N 2.99Å; S62-R64 PolarHBondContact O-N 3.42Å; S62-Q65 PolarHBondContact O-N 3.47Å; S62-A66 WeakPolarHBondContact O-CB 3.39Å; S62-A66 PolarHBondContact O-N 2.89Å
63	N	97.4	Very high	96.4	Very high	76 Å²	76	110.7 Å²	110.7	41%	0.406	54%	0.535	S	S	.	.	H	α-helix	trans	-64.5	-41.2	176.1	-165.3	-94.5	0	0	0	111.9	L59 L60 E61 R67	L59-N63 VanDerWaalsContact O-CB 3.28Å; L59-N63 WeakPolarHBondContact O-CB 3.38Å; L59-N63 PolarHBondContact O-N 2.89Å; L60-N63 PolarHBondContact O-N 2.92Å; E61-N63 VanDerWaalsContact C-N 3.31Å; E61-N63 PolarHBondContact O-N 2.94Å; N63-R67 WeakPolarHBondContact O-CG 3.29Å; N63-R67 PolarHBondContact O-N 3.25Å; N63-R67 VanDerWaalsContact O-N 3.16Å; N63-R67 PolarHBondContact OD1-NE 3.26Å
64	R	97.2	Very high	95.8	Very high	185 Å²	185	112.9 Å²	112.9	70%	0.698	55%	0.547	S	S	*	.	H	α-helix	trans	-62	-46.3	175.9	-176.8	-179.4	179.9	173.1	-0.3	110.7	L60 E61 S62 R67 L68	L60-R64 WeakPolarHBondContact O-CB 3.06Å; L60-R64 PolarHBondContact O-N 2.83Å; E61-R64 WeakPolarHBondContact O-CB 3.49Å; E61-R64 PolarHBondContact O-N 3.15Å; E61-R64 VanDerWaalsContact O-N 3.15Å; S62-R64 PolarHBondContact O-N 3.42Å; R64-R67 PolarHBondContact O-N 3.08Å; R64-L68 WeakPolarHBondContact O-CG 3.31Å; R64-L68 PolarHBondContact O-N 3.35Å; R64-L68 VanDerWaalsContact O-N 3.14Å
65	Q	96.8	Very high	94.9	Very high	97 Å²	97	112.8 Å²	112.8	45%	0.453	55%	0.554	S	S	.	*	H	α-helix	trans	-62.8	-48.7	179	-172.2	58.5	44.1	0	0	111.5	E61 S62 R67 L68 D69	E61-Q65 PolarHBondContact O-N 2.88Å; S62-Q65 PolarHBondContact O-N 3.47Å; Q65-R67 PolarHBondContact O-N 3.35Å; Q65-L68 WeakPolarHBondContact O-CA 3.36Å; Q65-L68 WeakPolarHBondContact O-CB 3.4Å; Q65-L68 PolarHBondContact O-N 3.09Å; Q65-D69 PolarHBondContact NE2-OD1 3.31Å; Q65-D69 PolarHBondContact O-N 2.87Å
66	A	96.8	Very high	93.2	Very high	54 Å²	54	108.9 Å²	108.9	45%	0.446	55%	0.554	S	S	.	*	H	α-helix	trans	-57.1	-36.6	178.5	0	0	0	0	0	112.6	S62 F70	S62-A66 WeakPolarHBondContact O-CB 3.39Å; S62-A66 PolarHBondContact O-N 2.89Å; A66-F70 VanDerWaalsContact O-CB 3.28Å; A66-F70 WeakPolarHBondContact O-CB 3.3Å; A66-F70 PolarHBondContact O-N 3.11Å
67	R	96.2	Very high	90.9	Very high	163 Å²	163	108.3 Å²	108.3	62%	0.615	56%	0.558	S	S	*	*	H	α-helix	trans	-69.2	-36.6	174.7	-71.8	172.9	-175.2	-97.8	2.7	112.8	N63 R64 Q65 R71	N63-R67 WeakPolarHBondContact O-CG 3.29Å; N63-R67 PolarHBondContact O-N 3.25Å; N63-R67 VanDerWaalsContact O-N 3.16Å; N63-R67 PolarHBondContact OD1-NE 3.26Å; R64-R67 PolarHBondContact O-N 3.08Å; Q65-R67 PolarHBondContact O-N 3.35Å; R67-R71 WeakPolarHBondContact O-CB 3.48Å; R67-R71 VanDerWaalsContact O-CG 3.28Å; R67-R71 WeakPolarHBondContact O-CG 3.25Å; R67-R71 PolarHBondContact O-N 3.07Å
68	L	95.6	Very high	88.6	Confident	88 Å²	88	107.2 Å²	107.2	46%	0.461	56%	0.562	S	S	.	*	H	α-helix	trans	-66.7	-46.1	174.8	-70	173.8	0	0	0	110.5	R64 Q65 F70 R71 A72	R64-L68 WeakPolarHBondContact O-CG 3.31Å; R64-L68 PolarHBondContact O-N 3.35Å; R64-L68 VanDerWaalsContact O-N 3.14Å; Q65-L68 WeakPolarHBondContact O-CA 3.36Å; Q65-L68 WeakPolarHBondContact O-CB 3.4Å; Q65-L68 PolarHBondContact O-N 3.09Å; L68-F70 VanDerWaalsContact C-N 3.33Å; L68-F70 PolarHBondContact O-N 2.98Å; L68-R71 PolarHBondContact O-N 2.88Å; L68-A72 WeakPolarHBondContact O-CB 3.4Å; L68-A72 PolarHBondContact O-N 3.26Å
69	D	94.7	Very high	86.3	Confident	74 Å²	74	107.3 Å²	107.3	40%	0.396	57%	0.571	S	S	.	*	H	α-helix	trans	-61.7	-42.7	178	-63.4	-18.6	0	0	0	111.2	Q65 A72 Q73	Q65-D69 PolarHBondContact NE2-OD1 3.31Å; Q65-D69 PolarHBondContact O-N 2.87Å; D69-A72 PolarHBondContact O-N 3.19Å; D69-Q73 VanDerWaalsContact O-CG 3.31Å; D69-Q73 WeakPolarHBondContact O-CG 3.05Å; D69-Q73 PolarHBondContact O-N 3.28Å
70	F	93.9	Very high	83.8	Confident	124 Å²	124	111.5 Å²	111.5	54%	0.544	59%	0.587	S	S	.	*	H	α-helix	trans	-63.1	-43.6	176	-175.2	-104.9	0	0	0	112.2	A66 L68 Q73 L74	A66-F70 VanDerWaalsContact O-CB 3.28Å; A66-F70 WeakPolarHBondContact O-CB 3.3Å; A66-F70 PolarHBondContact O-N 3.11Å; L68-F70 VanDerWaalsContact C-N 3.33Å; L68-F70 PolarHBondContact O-N 2.98Å; F70-Q73 PolarHBondContact O-N 2.99Å; F70-L74 HydrophobicContact CD1-CD1 3.9Å; F70-L74 HydrophobicContact CE1-CD1 3.46Å; F70-L74 VanDerWaalsContact CE1-CD1 3.46Å; F70-L74 HydrophobicContact CE1-CG 4.2Å; F70-L74 HydrophobicContact CZ-CD1 3.99Å; F70-L74 HydrophobicContact CZ-CG 4.35Å; F70-L74 WeakPolarHBondContact O-CG 3.24Å; F70-L74 PolarHBondContact O-N 2.74Å
71	R	93	Very high	81.3	Confident	175 Å²	175	114.8 Å²	114.8	66%	0.66	60%	0.6	S	S	*	*	H	α-helix	trans	-62.8	-43.9	174.8	-77.5	175.5	173.2	-170.1	-1.9	111.6	R67 L68 Q73 L74 T75	R67-R71 WeakPolarHBondContact O-CB 3.48Å; R67-R71 VanDerWaalsContact O-CG 3.28Å; R67-R71 WeakPolarHBondContact O-CG 3.25Å; R67-R71 PolarHBondContact O-N 3.07Å; L68-R71 PolarHBondContact O-N 2.88Å; R71-Q73 VanDerWaalsContact C-N 3.31Å; R71-Q73 PolarHBondContact O-N 3.49Å; R71-L74 PolarHBondContact O-N 2.94Å; R71-T75 WeakPolarHBondContact O-CG2 3.28Å; R71-T75 PolarHBondContact O-N 2.91Å; R71-T75 PolarHBondContact O-OG1 3.37Å; R71-T75 VanDerWaalsContact O-OG1 3.05Å
72	A	90.5	Very high	78.3	Confident	55 Å²	55	120.7 Å²	120.7	46%	0.455	63%	0.627	S	S	.	*	H	α-helix	trans	-60.9	-40.3	177.9	0	0	0	0	0	111.7	L68 D69 T75 G76	L68-A72 WeakPolarHBondContact O-CB 3.4Å; L68-A72 PolarHBondContact O-N 3.26Å; D69-A72 PolarHBondContact O-N 3.19Å; A72-T75 WeakPolarHBondContact CA-OG1 3.5Å; A72-T75 PolarHBondContact O-N 3.05Å; A72-T75 PolarHBondContact O-OG1 2.76Å; A72-G76 WeakPolarHBondContact O-CA 3.1Å; A72-G76 PolarHBondContact O-N 2.73Å
73	Q	89	Confident	77.4	Confident	128 Å²	128	122.9 Å²	122.9	60%	0.598	63%	0.632	S	S	*	*	H	α-helix	trans	-63.4	-42.5	174.2	-73.1	171.6	48.7	0	0	112.3	D69 F70 R71 S77	D69-Q73 VanDerWaalsContact O-CG 3.31Å; D69-Q73 WeakPolarHBondContact O-CG 3.05Å; D69-Q73 PolarHBondContact O-N 3.28Å; F70-Q73 PolarHBondContact O-N 2.99Å; R71-Q73 VanDerWaalsContact C-N 3.31Å; R71-Q73 PolarHBondContact O-N 3.49Å; Q73-S77 PolarHBondContact O-N 2.83Å; Q73-S77 VanDerWaalsContact O-N 3.11Å; Q73-S77 PolarHBondContact O-OG 3.39Å
74	L	86.8	Confident	76.3	Confident	111 Å²	111	125.3 Å²	125.3	58%	0.581	64%	0.644	S	S	*	*	H	α-helix	trans	-65.2	-40	176.3	-71.1	174.9	0	0	0	112.6	F70 R71	F70-L74 HydrophobicContact CD1-CD1 3.9Å; F70-L74 HydrophobicContact CE1-CD1 3.46Å; F70-L74 VanDerWaalsContact CE1-CD1 3.46Å; F70-L74 HydrophobicContact CE1-CG 4.2Å; F70-L74 HydrophobicContact CZ-CD1 3.99Å; F70-L74 HydrophobicContact CZ-CG 4.35Å; F70-L74 WeakPolarHBondContact O-CG 3.24Å; F70-L74 PolarHBondContact O-N 2.74Å; R71-L74 PolarHBondContact O-N 2.94Å
75	T	79.6	Confident	75.2	Confident	121 Å²	121	122 Å²	122	74%	0.742	64%	0.641	S	S	*	*	H	α-helix	trans	-81.5	-24.4	179.5	54.9	0	0	0	0	113.5	R71 A72	R71-T75 WeakPolarHBondContact O-CG2 3.28Å; R71-T75 PolarHBondContact O-N 2.91Å; R71-T75 PolarHBondContact O-OG1 3.37Å; R71-T75 VanDerWaalsContact O-OG1 3.05Å; A72-T75 WeakPolarHBondContact CA-OG1 3.5Å; A72-T75 PolarHBondContact O-N 3.05Å; A72-T75 PolarHBondContact O-OG1 2.76Å
76	G	62.2	Low	73.9	Confident	58 Å²	58	123.5 Å²	123.5	60%	0.598	65%	0.652	S	S	*	*	H	α-helix	trans	-93.1	-1.5	-179.6	0	0	0	0	0	113.9	A72 P78	A72-G76 WeakPolarHBondContact O-CA 3.1Å; A72-G76 PolarHBondContact O-N 2.73Å; G76-P78 WeakPolarHBondContact O-CD 3.45Å
77	S	50.7	Low	72.5	Confident	80 Å²	80	127.8 Å²	127.8	56%	0.559	67%	0.665	S	S	*	*	S	Bend	trans	-77.8	103.5	166.1	-61.1	0	0	0	0	107.6	Q73 T79	Q73-S77 PolarHBondContact O-N 2.83Å; Q73-S77 VanDerWaalsContact O-N 3.11Å; Q73-S77 PolarHBondContact O-OG 3.39Å; S77-T79 PolarHBondContact O-N 2.94Å
78	P	49.6	Very low	70.9	Confident	108 Å²	108	125.5 Å²	125.5	70%	0.701	67%	0.668	S	S	*	*			trans	-59.5	133.8	164.3	28.3	-31.5	0	0	0	106.1	G76 Q80	G76-P78 WeakPolarHBondContact O-CD 3.45Å; P78-Q80 PolarHBondContact O-N 3.45Å
79	T	51.4	Low	69.1	Low	118 Å²	118	128.1 Å²	128.1	72%	0.724	68%	0.683	S	S	*	*			trans	-32.6	108.1	154.2	31.1	0	0	0	0	109	S77 E81	S77-T79 PolarHBondContact O-N 2.94Å; T79-E81 PolarHBondContact O-N 3.23Å
80	Q	45.3	Very low	67.1	Low	198 Å²	198	132.3 Å²	132.3	93%	0.925	71%	0.705	S	S	*	*			trans	-64.9	86.6	153.7	-95.7	178.1	-18.8	0	0	104.9	P78 E82	P78-Q80 PolarHBondContact O-N 3.45Å; Q80-E82 PolarHBondContact O-N 3Å
81	E	44.8	Very low	64.9	Low	175 Å²	175	133 Å²	133	82%	0.818	72%	0.718	S	S	*	*			trans	-69.7	104.4	152.4	-68.4	-175.6	167.7	0	0	106.3	T79	T79-E81 PolarHBondContact O-N 3.23Å
82	E	36.1	Very low	62.4	Low	269 Å²	269	129.2 Å²	129.2	100%	1.257	72%	0.724	S	S	*	*			trans	-143.2	0	146.1	-110.1	-173.4	178.3	0	0	108.9	Q80	Q80-E82 PolarHBondContact O-N 3Å

Retrieved 82 of 82 residues in 18.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).