A0A087YQ11_POEFO Loading...

Single-pass membrane and coiled-coil domain-containing protein 4

AlphaFold DB , UniProt , Accession A0A087YQ11, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 59 aa.

						>A0A087YQ11_POEFO|A0A087YQ11
MRQLKGKPKKETSKDKKERKQAMQEARQQVATVVVPTLTVVVLLIVVFVYVATRPGAME
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.7	Low	50.4	Low	242 Å²	242	172.1 Å²	172.1	100%	1.192	83%	0.826	S	S	*	*				0	130.9	0	-59.4	-174.4	-176.8	0	0	106.8
2	R	53.7	Low	51	Low	238 Å²	238	163.2 Å²	163.2	90%	0.898	79%	0.79	S	S	*	*			cis	-136.4	118.3	21.4	-79.5	146.5	68	165.3	-2	108.5	L4	R2-L4 PolarHBondContact O-N 3.17Å
3	Q	59	Low	51.2	Low	171 Å²	171	158.1 Å²	158.1	80%	0.799	78%	0.781	S	S	*	*			trans	-61.5	126.2	158	-69.3	-100.1	49.9	0	0	106.6	K5	Q3-K5 PolarHBondContact O-N 3.36Å; Q3-K5 VanDerWaalsContact O-N 3.17Å
4	L	52.8	Low	51.5	Low	160 Å²	160	157.4 Å²	157.4	84%	0.838	77%	0.772	S	S	*	*			trans	-53.3	119.5	-179	-79.2	145.9	0	0	0	110.3	R2 G6	R2-L4 PolarHBondContact O-N 3.17Å; L4-G6 PolarHBondContact O-N 2.78Å
5	K	52.7	Low	51.7	Low	221 Å²	221	152.3 Å²	152.3	96%	0.961	75%	0.749	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.2	74.9	171	-170.8	169.2	-179.4	179	0	107.8	Q3	Q3-K5 PolarHBondContact O-N 3.36Å; Q3-K5 VanDerWaalsContact O-N 3.17Å
6	G	50	Low	52	Low	59 Å²	59	153.5 Å²	153.5	61%	0.608	75%	0.749	S	S	*	*	T	Hydrogen-bonded Turn	trans	-176.4	2.1	-169.2	0	0	0	0	0	114.9	L4 P8	L4-G6 PolarHBondContact O-N 2.78Å; G6-P8 WeakPolarHBondContact O-CD 3.09Å; G6-P8 VanDerWaalsContact O-N 3.15Å
7	K	46.3	Very low	52.4	Low	164 Å²	164	152.4 Å²	152.4	71%	0.713	74%	0.739	S	S	*	*	S	Bend	trans	-61.5	115.9	153.2	-68	-173	-178.5	-170.5	0	105	K9	K7-K9 PolarHBondContact O-N 2.81Å
8	P	51.9	Low	52.7	Low	113 Å²	113	150.3 Å²	150.3	73%	0.734	73%	0.728	S	S	*	*			trans	-54.6	108.2	158.4	24.2	-29.9	0	0	0	103.4	G6 K10	G6-P8 WeakPolarHBondContact O-CD 3.09Å; G6-P8 VanDerWaalsContact O-N 3.15Å; P8-K10 VanDerWaalsContact C-N 3.25Å; P8-K10 PolarHBondContact O-N 2.72Å
9	K	43.5	Very low	53.1	Low	186 Å²	186	152.9 Å²	152.9	81%	0.809	73%	0.73	S	S	*	*			trans	-46.7	102.7	174.8	170.7	-178.2	-179.2	-177.1	0	103.5	K7 E11	K7-K9 PolarHBondContact O-N 2.81Å; K9-E11 VanDerWaalsContact O-CA 3.28Å; K9-E11 WeakPolarHBondContact O-CA 3.28Å; K9-E11 PolarHBondContact O-N 2.6Å
10	K	44.5	Very low	53.5	Low	168 Å²	168	153 Å²	153	73%	0.73	73%	0.726	S	S	*	*			trans	-31.1	91	-173	-172.7	167.2	-176.4	172.8	0	106.9	P8 T12	P8-K10 VanDerWaalsContact C-N 3.25Å; P8-K10 PolarHBondContact O-N 2.72Å; K10-T12 VanDerWaalsContact C-N 3.26Å; K10-T12 WeakPolarHBondContact O-CA 3.08Å; K10-T12 PolarHBondContact O-N 2.91Å; K10-T12 PolarHBondContact O-OG1 2.81Å
11	E	45.1	Very low	53.8	Low	171 Å²	171	149.8 Å²	149.8	80%	0.799	71%	0.711	S	S	*	*			trans	-68.2	107.5	-174	-109.6	-170	94.1	0	0	101.3	K9 S13	K9-E11 VanDerWaalsContact O-CA 3.28Å; K9-E11 WeakPolarHBondContact O-CA 3.28Å; K9-E11 PolarHBondContact O-N 2.6Å; E11-S13 PolarHBondContact O-N 2.98Å
12	T	58.3	Low	54.1	Low	65 Å²	65	140.9 Å²	140.9	40%	0.399	68%	0.676	S	S	.	*			trans	-66.2	136.7	-138.6	-56.4	0	0	0	0	105.4	K10 K14 D15 K16	K10-T12 VanDerWaalsContact C-N 3.26Å; K10-T12 WeakPolarHBondContact O-CA 3.08Å; K10-T12 PolarHBondContact O-N 2.91Å; K10-T12 PolarHBondContact O-OG1 2.81Å; T12-K14 HydrophobicContact CG2-CB 3.48Å; T12-K14 VanDerWaalsContact CG2-CB 3.48Å; T12-K14 HydrophobicContact CG2-CD 3.76Å; T12-K14 HydrophobicContact CG2-CG 3.52Å; T12-K14 CarbonylContact O-C 3.57Å; T12-K14 PolarHBondContact O-N 2.87Å; T12-D15 PolarHBondContact O-N 3.34Å; T12-K16 PolarHBondContact O-N 3.41Å
13	S	53.7	Low	54.5	Low	97 Å²	97	136.1 Å²	136.1	68%	0.678	67%	0.666	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.3	-12.7	170.8	-50	0	0	0	0	112	E11 K17	E11-S13 PolarHBondContact O-N 2.98Å; S13-K17 WeakPolarHBondContact O-CB 3.37Å
14	K	54.8	Low	54.6	Low	149 Å²	149	134 Å²	134	65%	0.648	66%	0.656	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.1	-50	165.1	-58.5	-177.5	-177.7	-168.5	0	113.9	T12 K16 K17 E18	T12-K14 HydrophobicContact CG2-CB 3.48Å; T12-K14 VanDerWaalsContact CG2-CB 3.48Å; T12-K14 HydrophobicContact CG2-CD 3.76Å; T12-K14 HydrophobicContact CG2-CG 3.52Å; T12-K14 CarbonylContact O-C 3.57Å; T12-K14 PolarHBondContact O-N 2.87Å; K14-K16 VanDerWaalsContact C-N 3.34Å; K14-K16 PolarHBondContact O-N 3.29Å; K14-K17 CarbonylContact O-C 3.49Å; K14-K17 WeakPolarHBondContact O-CA 3.32Å; K14-K17 VanDerWaalsContact O-CB 3.27Å; K14-K17 WeakPolarHBondContact O-CB 3.27Å; K14-K17 PolarHBondContact O-N 2.79Å; K14-E18 WeakPolarHBondContact O-CG 3.34Å; K14-E18 PolarHBondContact O-N 2.9Å
15	D	54.8	Low	55.1	Low	81 Å²	81	132.1 Å²	132.1	43%	0.433	64%	0.643	S	S	.	*	H	α-helix	trans	-60.7	-41	179.3	-169.5	-82	0	0	0	112.4	T12 K17 E18 R19	T12-D15 PolarHBondContact O-N 3.34Å; D15-K17 PolarHBondContact O-N 3.28Å; D15-E18 PolarHBondContact O-N 3.35Å; D15-R19 PolarHBondContact O-N 3.27Å
16	K	55.7	Low	55.5	Low	171 Å²	171	123.9 Å²	123.9	74%	0.743	62%	0.616	S	S	*	*	H	α-helix	trans	-64.4	-26.9	173.1	-129.9	-179.6	-168.8	-173.1	0	113	T12 K14	T12-K16 PolarHBondContact O-N 3.41Å; K14-K16 VanDerWaalsContact C-N 3.34Å; K14-K16 PolarHBondContact O-N 3.29Å
17	K	59.6	Low	56.2	Low	135 Å²	135	130.1 Å²	130.1	59%	0.587	62%	0.621	S	S	*	*	H	α-helix	trans	-82.9	-39.2	177.4	-158.6	179.3	-177.4	-171.6	0	110.7	S13 K14 D15 K20 Q21	S13-K17 WeakPolarHBondContact O-CB 3.37Å; K14-K17 CarbonylContact O-C 3.49Å; K14-K17 WeakPolarHBondContact O-CA 3.32Å; K14-K17 VanDerWaalsContact O-CB 3.27Å; K14-K17 WeakPolarHBondContact O-CB 3.27Å; K14-K17 PolarHBondContact O-N 2.79Å; D15-K17 PolarHBondContact O-N 3.28Å; K17-K20 PolarHBondContact O-N 2.97Å; K17-Q21 WeakPolarHBondContact O-CB 3.39Å; K17-Q21 WeakPolarHBondContact O-CG 3.25Å; K17-Q21 PolarHBondContact O-N 3.48Å
18	E	58	Low	57.1	Low	115 Å²	115	128.6 Å²	128.6	54%	0.537	62%	0.616	S	S	.	*	H	α-helix	trans	-64.4	-40.9	176.4	-71.9	177.9	94.7	0	0	111.6	K14 D15 K20 Q21 A22	K14-E18 WeakPolarHBondContact O-CG 3.34Å; K14-E18 PolarHBondContact O-N 2.9Å; D15-E18 PolarHBondContact O-N 3.35Å; E18-K20 VanDerWaalsContact C-N 3.34Å; E18-K20 PolarHBondContact O-N 3.41Å; E18-Q21 PolarHBondContact O-N 2.77Å; E18-A22 WeakPolarHBondContact O-CB 3.31Å; E18-A22 PolarHBondContact O-N 2.78Å
19	R	59.7	Low	57.7	Low	200 Å²	200	129.7 Å²	129.7	76%	0.755	61%	0.612	S	S	*	*	H	α-helix	trans	-62.8	-37.1	172.6	-82.8	-175.1	118.3	-156	2.2	113.5	D15 M23	D15-R19 PolarHBondContact O-N 3.27Å; R19-M23 PolarHBondContact O-N 3.12Å
20	K	60.8	Low	58.8	Low	153 Å²	153	125.2 Å²	125.2	67%	0.665	60%	0.6	S	S	*	*	H	α-helix	trans	-73.5	-38.8	176.7	-82.6	-171.4	174.7	-170.4	0	112	K17 E18 M23 Q24	K17-K20 PolarHBondContact O-N 2.97Å; E18-K20 VanDerWaalsContact C-N 3.34Å; E18-K20 PolarHBondContact O-N 3.41Å; K20-M23 PolarHBondContact O-N 3.19Å; K20-Q24 WeakPolarHBondContact O-CG 3.44Å; K20-Q24 PolarHBondContact O-N 3.37Å; K20-Q24 VanDerWaalsContact O-N 3.12Å
21	Q	60.4	Low	60.2	Low	86 Å²	86	119.5 Å²	119.5	40%	0.402	58%	0.584	S	S	.	*	H	α-helix	trans	-67.2	-45	177.8	-78.1	176.4	-41.6	0	0	111.4	K17 E18 M23 Q24 E25	K17-Q21 WeakPolarHBondContact O-CB 3.39Å; K17-Q21 WeakPolarHBondContact O-CG 3.25Å; K17-Q21 PolarHBondContact O-N 3.48Å; E18-Q21 PolarHBondContact O-N 2.77Å; Q21-M23 VanDerWaalsContact C-N 3.28Å; Q21-M23 PolarHBondContact O-N 3.28Å; Q21-Q24 CarbonylContact O-C 3.45Å; Q21-Q24 WeakPolarHBondContact O-CA 3.43Å; Q21-Q24 PolarHBondContact O-N 2.78Å; Q21-E25 PolarHBondContact O-N 2.98Å
22	A	61.1	Low	61.7	Low	56 Å²	56	115.9 Å²	115.9	46%	0.463	57%	0.573	S	S	.	*	H	α-helix	trans	-60	-37.1	176.4	0	0	0	0	0	112.8	E18 A26	E18-A22 WeakPolarHBondContact O-CB 3.31Å; E18-A22 PolarHBondContact O-N 2.78Å; A22-A26 VanDerWaalsContact O-CB 3.25Å; A22-A26 WeakPolarHBondContact O-CB 3.41Å; A22-A26 PolarHBondContact O-N 2.9Å
23	M	61.2	Low	62.9	Low	137 Å²	137	117.2 Å²	117.2	68%	0.675	58%	0.581	S	S	*	*	H	α-helix	trans	-68.2	-34.4	173.8	-111.2	-177.2	-177	0	0	112.9	R19 K20 Q21 R27	R19-M23 PolarHBondContact O-N 3.12Å; K20-M23 PolarHBondContact O-N 3.19Å; Q21-M23 VanDerWaalsContact C-N 3.28Å; Q21-M23 PolarHBondContact O-N 3.28Å; M23-R27 VanDerWaalsContact O-CG 3.31Å; M23-R27 WeakPolarHBondContact O-CG 3.48Å; M23-R27 PolarHBondContact O-N 3.48Å
24	Q	61.8	Low	64.6	Low	126 Å²	126	115.9 Å²	115.9	59%	0.589	57%	0.569	S	S	*	*	H	α-helix	trans	-74.7	-43.9	177.2	-75	-176.5	-14.9	0	0	111.5	K20 Q21 A26 R27 Q28	K20-Q24 WeakPolarHBondContact O-CG 3.44Å; K20-Q24 PolarHBondContact O-N 3.37Å; K20-Q24 VanDerWaalsContact O-N 3.12Å; Q21-Q24 CarbonylContact O-C 3.45Å; Q21-Q24 WeakPolarHBondContact O-CA 3.43Å; Q21-Q24 PolarHBondContact O-N 2.78Å; Q24-A26 VanDerWaalsContact C-N 3.35Å; Q24-A26 PolarHBondContact O-N 3.28Å; Q24-R27 WeakPolarHBondContact O-CB 3.39Å; Q24-R27 PolarHBondContact O-N 3.45Å; Q24-Q28 WeakPolarHBondContact O-CB 3.35Å; Q24-Q28 PolarHBondContact O-N 3.18Å
25	E	62.3	Low	66.1	Low	121 Å²	121	113.1 Å²	113.1	57%	0.565	57%	0.565	S	S	*	*	H	α-helix	trans	-61.2	-43.1	175	-74.6	-177.2	92.4	0	0	111.4	Q21 R27 Q28 Q29	Q21-E25 PolarHBondContact O-N 2.98Å; E25-R27 VanDerWaalsContact C-N 3.34Å; E25-R27 PolarHBondContact O-N 2.86Å; E25-Q28 PolarHBondContact O-N 3.21Å; E25-Q28 VanDerWaalsContact O-N 3.15Å; E25-Q29 WeakPolarHBondContact O-CB 3.46Å; E25-Q29 PolarHBondContact O-N 2.95Å
26	A	62.6	Low	67.8	Low	48 Å²	48	112.3 Å²	112.3	40%	0.397	56%	0.563	S	S	.	*	H	α-helix	trans	-60.4	-43	174	0	0	0	0	0	111.8	A22 Q24 Q28 V30	A22-A26 VanDerWaalsContact O-CB 3.25Å; A22-A26 WeakPolarHBondContact O-CB 3.41Å; A22-A26 PolarHBondContact O-N 2.9Å; Q24-A26 VanDerWaalsContact C-N 3.35Å; Q24-A26 PolarHBondContact O-N 3.28Å; A26-Q28 VanDerWaalsContact C-N 3.31Å; A26-Q28 PolarHBondContact O-N 3.44Å; A26-V30 WeakPolarHBondContact O-CB 3.4Å; A26-V30 WeakPolarHBondContact O-CG2 3.43Å; A26-V30 PolarHBondContact O-N 3.15Å
27	R	63.6	Low	69.6	Low	191 Å²	191	107.8 Å²	107.8	72%	0.721	55%	0.551	S	S	*	*	H	α-helix	trans	-64.6	-36	175	-76.9	175.1	-179.6	-141.9	-0.6	112.5	M23 Q24 E25 A31	M23-R27 VanDerWaalsContact O-CG 3.31Å; M23-R27 WeakPolarHBondContact O-CG 3.48Å; M23-R27 PolarHBondContact O-N 3.48Å; Q24-R27 WeakPolarHBondContact O-CB 3.39Å; Q24-R27 PolarHBondContact O-N 3.45Å; E25-R27 VanDerWaalsContact C-N 3.34Å; E25-R27 PolarHBondContact O-N 2.86Å; R27-A31 VanDerWaalsContact O-CB 3.31Å; R27-A31 WeakPolarHBondContact O-CB 3.16Å; R27-A31 PolarHBondContact O-N 2.85Å
28	Q	64.9	Low	71.3	Confident	132 Å²	132	106.4 Å²	106.4	62%	0.617	55%	0.549	S	S	*	.	H	α-helix	trans	-74.2	-39.7	-178.4	-146.4	154.8	19.7	0	0	111.2	Q24 E25 A26 A31 T32	Q24-Q28 WeakPolarHBondContact O-CB 3.35Å; Q24-Q28 PolarHBondContact O-N 3.18Å; E25-Q28 PolarHBondContact O-N 3.21Å; E25-Q28 VanDerWaalsContact O-N 3.15Å; A26-Q28 VanDerWaalsContact C-N 3.31Å; A26-Q28 PolarHBondContact O-N 3.44Å; Q28-A31 PolarHBondContact O-N 2.98Å; Q28-T32 WeakPolarHBondContact O-CG2 3.36Å; Q28-T32 PolarHBondContact O-N 3.04Å; Q28-T32 PolarHBondContact O-OG1 3.18Å; Q28-T32 VanDerWaalsContact O-OG1 3.04Å
29	Q	65.4	Low	73	Confident	136 Å²	136	104.8 Å²	104.8	64%	0.636	55%	0.547	S	S	*	.	H	α-helix	trans	-63.7	-42.1	170.6	-78.2	-175.9	-20.2	0	0	112.3	E25 T32 V33	E25-Q29 WeakPolarHBondContact O-CB 3.46Å; E25-Q29 PolarHBondContact O-N 2.95Å; Q29-T32 WeakPolarHBondContact CA-OG1 3.05Å; Q29-T32 PolarHBondContact O-N 2.83Å; Q29-T32 PolarHBondContact O-OG1 2.91Å; Q29-V33 WeakPolarHBondContact O-CG2 3.32Å; Q29-V33 PolarHBondContact O-N 3.37Å
30	V	67.3	Low	74.8	Confident	91 Å²	91	99.1 Å²	99.1	55%	0.552	54%	0.535	S	S	*	.	H	α-helix	trans	-63.9	-44.5	175.2	171.6	0	0	0	0	110.2	A26 T32 V33 V34	A26-V30 WeakPolarHBondContact O-CB 3.4Å; A26-V30 WeakPolarHBondContact O-CG2 3.43Å; A26-V30 PolarHBondContact O-N 3.15Å; V30-T32 PolarHBondContact O-N 3.43Å; V30-V33 PolarHBondContact O-N 2.91Å; V30-V34 HydrophobicContact CG1-CG2 4Å; V30-V34 WeakPolarHBondContact O-CB 3.38Å; V30-V34 WeakPolarHBondContact O-CG2 3.18Å; V30-V34 PolarHBondContact O-N 3.45Å
31	A	73.3	Confident	76.5	Confident	49 Å²	49	95.1 Å²	95.1	41%	0.405	52%	0.523	S	S	.	.	H	α-helix	trans	-62.4	-41.4	177.8	0	0	0	0	0	112.6	R27 Q28 V33 V34 V35	R27-A31 VanDerWaalsContact O-CB 3.31Å; R27-A31 WeakPolarHBondContact O-CB 3.16Å; R27-A31 PolarHBondContact O-N 2.85Å; Q28-A31 PolarHBondContact O-N 2.98Å; A31-V33 VanDerWaalsContact C-N 3.28Å; A31-V33 PolarHBondContact O-N 2.98Å; A31-V34 PolarHBondContact O-N 3.28Å; A31-V35 WeakPolarHBondContact O-CB 3.31Å; A31-V35 VanDerWaalsContact O-CG2 3.25Å; A31-V35 WeakPolarHBondContact O-CG2 3.49Å; A31-V35 PolarHBondContact O-N 3.44Å
32	T	77.2	Confident	78.2	Confident	94 Å²	94	95.2 Å²	95.2	58%	0.577	53%	0.529	S	S	*	.	H	α-helix	trans	-69.9	-21.2	179.1	49.2	0	0	0	0	113.8	Q28 Q29 V30 P36	Q28-T32 WeakPolarHBondContact O-CG2 3.36Å; Q28-T32 PolarHBondContact O-N 3.04Å; Q28-T32 PolarHBondContact O-OG1 3.18Å; Q28-T32 VanDerWaalsContact O-OG1 3.04Å; Q29-T32 WeakPolarHBondContact CA-OG1 3.05Å; Q29-T32 PolarHBondContact O-N 2.83Å; Q29-T32 PolarHBondContact O-OG1 2.91Å; V30-T32 PolarHBondContact O-N 3.43Å; T32-P36 WeakPolarHBondContact O-CD 2.88Å; T32-P36 WeakPolarHBondContact O-CG 3.5Å
33	V	83.1	Confident	79.9	Confident	93 Å²	93	97.5 Å²	97.5	56%	0.564	53%	0.533	S	S	*	.	H	α-helix	trans	-88.3	-37.9	172.3	177	0	0	0	0	111.3	Q29 V30 A31 P36 T37	Q29-V33 WeakPolarHBondContact O-CG2 3.32Å; Q29-V33 PolarHBondContact O-N 3.37Å; V30-V33 PolarHBondContact O-N 2.91Å; A31-V33 VanDerWaalsContact C-N 3.28Å; A31-V33 PolarHBondContact O-N 2.98Å; V33-P36 VanDerWaalsContact O-CD 3.32Å; V33-P36 WeakPolarHBondContact O-CD 3.32Å; V33-P36 VanDerWaalsContact O-CG 3.32Å; V33-P36 WeakPolarHBondContact O-CG 3.32Å; V33-T37 WeakPolarHBondContact O-CB 3.25Å; V33-T37 PolarHBondContact O-N 2.89Å; V33-T37 PolarHBondContact O-OG1 3.01Å
34	V	88.2	Confident	81.6	Confident	69 Å²	69	96.4 Å²	96.4	42%	0.418	53%	0.529	S	S	.	.	H	α-helix	trans	-68.7	-42.5	-177.8	170.9	0	0	0	0	111.5	V30 A31 T37 L38	V30-V34 HydrophobicContact CG1-CG2 4Å; V30-V34 WeakPolarHBondContact O-CB 3.38Å; V30-V34 WeakPolarHBondContact O-CG2 3.18Å; V30-V34 PolarHBondContact O-N 3.45Å; A31-V34 PolarHBondContact O-N 3.28Å; V34-T37 PolarHBondContact O-N 3.31Å; V34-L38 HydrophobicContact CG1-CD1 3.77Å; V34-L38 HydrophobicContact CG1-CG 4.12Å; V34-L38 WeakPolarHBondContact O-CB 3.4Å; V34-L38 WeakPolarHBondContact O-CG 3.38Å; V34-L38 PolarHBondContact O-N 3.38Å
35	V	87.6	Confident	83.2	Confident	92 Å²	92	95.1 Å²	95.1	56%	0.558	53%	0.525	S	S	*	.	H	α-helix	trans	-56.3	-55.3	178.9	171.7	0	0	0	0	112.7	A31 T37 L38 T39	A31-V35 WeakPolarHBondContact O-CB 3.31Å; A31-V35 VanDerWaalsContact O-CG2 3.25Å; A31-V35 WeakPolarHBondContact O-CG2 3.49Å; A31-V35 PolarHBondContact O-N 3.44Å; V35-T37 VanDerWaalsContact C-N 3.3Å; V35-T37 PolarHBondContact O-N 2.69Å; V35-L38 PolarHBondContact O-N 3.37Å; V35-T39 PolarHBondContact O-N 3.29Å; V35-T39 PolarHBondContact O-OG1 2.98Å
36	P	90.9	Very high	84.7	Confident	63 Å²	63	93.5 Å²	93.5	41%	0.409	52%	0.524	S	S	.	.	H	α-helix	trans	-65.8	-33.5	179.1	25.1	-33.7	0	0	0	112.3	T32 V33 T39 V40	T32-P36 WeakPolarHBondContact O-CD 2.88Å; T32-P36 WeakPolarHBondContact O-CG 3.5Å; V33-P36 VanDerWaalsContact O-CD 3.32Å; V33-P36 WeakPolarHBondContact O-CD 3.32Å; V33-P36 VanDerWaalsContact O-CG 3.32Å; V33-P36 WeakPolarHBondContact O-CG 3.32Å; P36-T39 WeakPolarHBondContact O-CB 3.37Å; P36-T39 PolarHBondContact O-N 3.47Å; P36-V40 WeakPolarHBondContact O-CG2 3.33Å; P36-V40 PolarHBondContact O-N 3.47Å
37	T	93.3	Very high	86.2	Confident	77 Å²	77	95 Å²	95	47%	0.472	53%	0.527	S	S	.	.	H	α-helix	trans	-63.3	-46.2	176.2	-54.9	0	0	0	0	111	V33 V34 V35 T39 V40 V41	V33-T37 WeakPolarHBondContact O-CB 3.25Å; V33-T37 PolarHBondContact O-N 2.89Å; V33-T37 PolarHBondContact O-OG1 3.01Å; V34-T37 PolarHBondContact O-N 3.31Å; V35-T37 VanDerWaalsContact C-N 3.3Å; V35-T37 PolarHBondContact O-N 2.69Å; T37-T39 VanDerWaalsContact C-N 3.31Å; T37-T39 PolarHBondContact O-N 3.29Å; T37-V40 PolarHBondContact O-N 3.25Å; T37-V41 WeakPolarHBondContact O-CG2 3.3Å; T37-V41 PolarHBondContact O-N 3.39Å
38	L	94.2	Very high	87.5	Confident	105 Å²	105	92.9 Å²	92.9	55%	0.55	52%	0.524	S	S	.	.	H	α-helix	trans	-62	-39.9	175.5	-72.7	175.3	0	0	0	111.6	V34 V35 V40 V41 V42	V34-L38 HydrophobicContact CG1-CD1 3.77Å; V34-L38 HydrophobicContact CG1-CG 4.12Å; V34-L38 WeakPolarHBondContact O-CB 3.4Å; V34-L38 WeakPolarHBondContact O-CG 3.38Å; V34-L38 PolarHBondContact O-N 3.38Å; V35-L38 PolarHBondContact O-N 3.37Å; L38-V40 PolarHBondContact O-N 3.47Å; L38-V41 PolarHBondContact O-N 2.97Å; L38-V42 VanDerWaalsContact O-CG2 3.3Å; L38-V42 WeakPolarHBondContact O-CG2 3.49Å; L38-V42 PolarHBondContact O-N 3.49Å
39	T	95	Very high	88.8	Confident	81 Å²	81	90 Å²	90	50%	0.497	52%	0.515	S	S	.	.	H	α-helix	trans	-59.6	-46.6	175.4	-54.4	0	0	0	0	111.8	V35 P36 T37 V42 L43	V35-T39 PolarHBondContact O-N 3.29Å; V35-T39 PolarHBondContact O-OG1 2.98Å; P36-T39 WeakPolarHBondContact O-CB 3.37Å; P36-T39 PolarHBondContact O-N 3.47Å; T37-T39 VanDerWaalsContact C-N 3.31Å; T37-T39 PolarHBondContact O-N 3.29Å; T39-V42 PolarHBondContact O-N 2.98Å; T39-L43 WeakPolarHBondContact O-CB 3.32Å; T39-L43 PolarHBondContact O-N 2.89Å
40	V	96.6	Very high	89.9	Confident	82 Å²	82	90.4 Å²	90.4	50%	0.497	51%	0.512	S	S	.	.	H	α-helix	trans	-63.3	-44.5	178.1	173.4	0	0	0	0	111.1	P36 T37 L38 V42 L43 L44	P36-V40 WeakPolarHBondContact O-CG2 3.33Å; P36-V40 PolarHBondContact O-N 3.47Å; T37-V40 PolarHBondContact O-N 3.25Å; L38-V40 PolarHBondContact O-N 3.47Å; V40-V42 PolarHBondContact O-N 3Å; V40-L43 WeakPolarHBondContact O-CB 3.31Å; V40-L43 PolarHBondContact O-N 3.45Å; V40-L44 HydrophobicContact CG1-CD1 4.03Å; V40-L44 HydrophobicContact CG1-CG 4.33Å; V40-L44 WeakPolarHBondContact O-CG 3.48Å; V40-L44 PolarHBondContact O-N 3.02Å
41	V	96.8	Very high	90.8	Very high	69 Å²	69	89.9 Å²	89.9	42%	0.418	51%	0.509	S	S	.	.	H	α-helix	trans	-60.8	-46	178.9	171.1	0	0	0	0	111.2	T37 L38 L43 L44 I45	T37-V41 WeakPolarHBondContact O-CG2 3.3Å; T37-V41 PolarHBondContact O-N 3.39Å; L38-V41 PolarHBondContact O-N 2.97Å; V41-L43 VanDerWaalsContact C-N 3.34Å; V41-L43 PolarHBondContact O-N 3.36Å; V41-L44 PolarHBondContact O-N 3.29Å; V41-I45 HydrophobicContact CG1-CD1 3.91Å; V41-I45 VanDerWaalsContact O-CG1 3.3Å; V41-I45 WeakPolarHBondContact O-CG1 3.3Å; V41-I45 PolarHBondContact O-N 3.26Å
42	V	96.4	Very high	91.2	Very high	88 Å²	88	89.6 Å²	89.6	53%	0.533	51%	0.506	S	S	.	.	H	α-helix	trans	-62.1	-43.3	177.2	172.4	0	0	0	0	111	L38 T39 V40 L44 I45 V46	L38-V42 VanDerWaalsContact O-CG2 3.3Å; L38-V42 WeakPolarHBondContact O-CG2 3.49Å; L38-V42 PolarHBondContact O-N 3.49Å; T39-V42 PolarHBondContact O-N 2.98Å; V40-V42 PolarHBondContact O-N 3Å; V42-L44 PolarHBondContact O-N 3.02Å; V42-I45 PolarHBondContact O-N 2.82Å; V42-V46 HydrophobicContact CG1-CG2 4.46Å; V42-V46 WeakPolarHBondContact O-CG2 3.49Å; V42-V46 PolarHBondContact O-N 2.86Å
43	L	96.7	Very high	91.2	Very high	104 Å²	104	89.8 Å²	89.8	55%	0.545	51%	0.507	S	S	.	.	H	α-helix	trans	-59.1	-45.6	175.5	-111.2	162	0	0	0	112	T39 V40 V41 I45 V46 V47	T39-L43 WeakPolarHBondContact O-CB 3.32Å; T39-L43 PolarHBondContact O-N 2.89Å; V40-L43 WeakPolarHBondContact O-CB 3.31Å; V40-L43 PolarHBondContact O-N 3.45Å; V41-L43 VanDerWaalsContact C-N 3.34Å; V41-L43 PolarHBondContact O-N 3.36Å; L43-I45 VanDerWaalsContact C-N 3.34Å; L43-I45 PolarHBondContact O-N 3.37Å; L43-V46 PolarHBondContact O-N 3.27Å; L43-V47 VanDerWaalsContact O-CG2 3.31Å; L43-V47 WeakPolarHBondContact O-CG2 3.24Å; L43-V47 PolarHBondContact O-N 2.84Å
44	L	96.3	Very high	90.8	Very high	114 Å²	114	92.4 Å²	92.4	60%	0.597	51%	0.507	S	S	*	.	H	α-helix	trans	-61.6	-41.5	177.3	-72.3	173.9	0	0	0	111.9	V40 V41 V42 V47 F48	V40-L44 HydrophobicContact CG1-CD1 4.03Å; V40-L44 HydrophobicContact CG1-CG 4.33Å; V40-L44 WeakPolarHBondContact O-CG 3.48Å; V40-L44 PolarHBondContact O-N 3.02Å; V41-L44 PolarHBondContact O-N 3.29Å; V42-L44 PolarHBondContact O-N 3.02Å; L44-V47 PolarHBondContact O-N 2.88Å; L44-F48 VanDerWaalsContact O-CB 3.23Å; L44-F48 WeakPolarHBondContact O-CB 3.23Å; L44-F48 PolarHBondContact O-N 2.93Å
45	I	95.1	Very high	89.6	Confident	98 Å²	98	95.6 Å²	95.6	50%	0.503	53%	0.529	S	S	.	.	H	α-helix	trans	-63.1	-46.2	176.1	-66.7	164.5	0	0	0	110.4	V41 V42 L43 V47 F48 V49	V41-I45 HydrophobicContact CG1-CD1 3.91Å; V41-I45 VanDerWaalsContact O-CG1 3.3Å; V41-I45 WeakPolarHBondContact O-CG1 3.3Å; V41-I45 PolarHBondContact O-N 3.26Å; V42-I45 PolarHBondContact O-N 2.82Å; L43-I45 VanDerWaalsContact C-N 3.34Å; L43-I45 PolarHBondContact O-N 3.37Å; I45-V47 VanDerWaalsContact C-N 3.35Å; I45-V47 PolarHBondContact O-N 3.3Å; I45-F48 PolarHBondContact O-N 3.28Å; I45-V49 HydrophobicContact CG2-CG2 4.22Å; I45-V49 WeakPolarHBondContact O-CB 3.46Å; I45-V49 VanDerWaalsContact O-CG2 3.29Å; I45-V49 WeakPolarHBondContact O-CG2 3.5Å; I45-V49 PolarHBondContact O-N 3.28Å
46	V	94.3	Very high	88.2	Confident	88 Å²	88	93.9 Å²	93.9	53%	0.533	53%	0.53	S	S	.	.	H	α-helix	trans	-61.1	-45.1	179.2	170.1	0	0	0	0	111	V42 L43 Y50	V42-V46 HydrophobicContact CG1-CG2 4.46Å; V42-V46 WeakPolarHBondContact O-CG2 3.49Å; V42-V46 PolarHBondContact O-N 2.86Å; L43-V46 PolarHBondContact O-N 3.27Å; V46-Y50 VanDerWaalsContact O-CB 3.23Å; V46-Y50 WeakPolarHBondContact O-CB 3.33Å; V46-Y50 PolarHBondContact O-N 2.73Å
47	V	93.3	Very high	86.7	Confident	78 Å²	78	93.7 Å²	93.7	47%	0.473	53%	0.534	S	S	.	.	H	α-helix	trans	-62.8	-46.3	176.1	171.8	0	0	0	0	110.8	L43 L44 I45 Y50 V51	L43-V47 VanDerWaalsContact O-CG2 3.31Å; L43-V47 WeakPolarHBondContact O-CG2 3.24Å; L43-V47 PolarHBondContact O-N 2.84Å; L44-V47 PolarHBondContact O-N 2.88Å; I45-V47 VanDerWaalsContact C-N 3.35Å; I45-V47 PolarHBondContact O-N 3.3Å; V47-Y50 PolarHBondContact O-N 3.46Å; V47-V51 HydrophobicContact CG1-CG2 4.4Å; V47-V51 WeakPolarHBondContact O-CB 3.15Å; V47-V51 WeakPolarHBondContact O-CG2 3.36Å; V47-V51 PolarHBondContact O-N 3.46Å
48	F	91.3	Very high	85	Confident	148 Å²	148	98 Å²	98	65%	0.649	55%	0.55	S	S	*	*	H	α-helix	trans	-59.6	-49.8	178.7	177.7	-94.9	0	0	0	111.5	L44 I45 V51 A52	L44-F48 VanDerWaalsContact O-CB 3.23Å; L44-F48 WeakPolarHBondContact O-CB 3.23Å; L44-F48 PolarHBondContact O-N 2.93Å; I45-F48 PolarHBondContact O-N 3.28Å; F48-V51 PolarHBondContact O-N 2.95Å; F48-A52 HydrophobicContact CE1-CB 4.5Å; F48-A52 VanDerWaalsContact O-CB 3.24Å; F48-A52 WeakPolarHBondContact O-CB 3.43Å; F48-A52 PolarHBondContact O-N 3.46Å
49	V	91.8	Very high	83.1	Confident	71 Å²	71	105 Å²	105	43%	0.43	58%	0.58	S	S	.	*	H	α-helix	trans	-60.6	-48	176.8	171.7	0	0	0	0	109.8	I45 V51 A52 T53	I45-V49 HydrophobicContact CG2-CG2 4.22Å; I45-V49 WeakPolarHBondContact O-CB 3.46Å; I45-V49 VanDerWaalsContact O-CG2 3.29Å; I45-V49 WeakPolarHBondContact O-CG2 3.5Å; I45-V49 PolarHBondContact O-N 3.28Å; V49-V51 VanDerWaalsContact C-N 3.33Å; V49-V51 PolarHBondContact O-N 3.22Å; V49-A52 PolarHBondContact O-N 2.98Å; V49-T53 HydrophobicContact CG1-CG2 4.15Å; V49-T53 WeakPolarHBondContact O-CB 3.29Å; V49-T53 PolarHBondContact O-N 3.45Å; V49-T53 PolarHBondContact O-OG1 3.1Å
50	Y	89.3	Confident	82.5	Confident	145 Å²	145	106.2 Å²	106.2	57%	0.569	58%	0.584	S	S	*	*	H	α-helix	trans	-58.8	-42.9	179.8	179.7	-96.9	0	0	0	112.4	V46 V47 R54	V46-Y50 VanDerWaalsContact O-CB 3.23Å; V46-Y50 WeakPolarHBondContact O-CB 3.33Å; V46-Y50 PolarHBondContact O-N 2.73Å; V47-Y50 PolarHBondContact O-N 3.46Å; Y50-R54 WeakPolarHBondContact O-CB 3.34Å; Y50-R54 PolarHBondContact O-N 3.28Å
51	V	87.1	Confident	81.8	Confident	80 Å²	80	107.5 Å²	107.5	49%	0.485	59%	0.589	S	S	.	*	H	α-helix	trans	-66.8	-49.2	176.2	172.2	0	0	0	0	110.8	V47 F48 V49 T53 R54 A57	V47-V51 HydrophobicContact CG1-CG2 4.4Å; V47-V51 WeakPolarHBondContact O-CB 3.15Å; V47-V51 WeakPolarHBondContact O-CG2 3.36Å; V47-V51 PolarHBondContact O-N 3.46Å; F48-V51 PolarHBondContact O-N 2.95Å; V49-V51 VanDerWaalsContact C-N 3.33Å; V49-V51 PolarHBondContact O-N 3.22Å; V51-T53 PolarHBondContact O-N 2.76Å; V51-R54 WeakPolarHBondContact O-CB 3.23Å; V51-R54 PolarHBondContact O-N 3.38Å; V51-A57 WeakPolarHBondContact O-CB 3.33Å
52	A	80.5	Confident	81	Confident	42 Å²	42	109.6 Å²	109.6	35%	0.347	60%	0.599	S	S	.	*	H	α-helix	trans	-68.2	-31.3	-177.5	0	0	0	0	0	113.6	F48 V49	F48-A52 HydrophobicContact CE1-CB 4.5Å; F48-A52 VanDerWaalsContact O-CB 3.24Å; F48-A52 WeakPolarHBondContact O-CB 3.43Å; F48-A52 PolarHBondContact O-N 3.46Å; V49-A52 PolarHBondContact O-N 2.98Å
53	T	78.4	Confident	80	Confident	98 Å²	98	110.9 Å²	110.9	60%	0.601	60%	0.602	S	S	*	*	H	α-helix	trans	-92.2	-3.3	175.5	54.9	0	0	0	0	113	V49 V51	V49-T53 HydrophobicContact CG1-CG2 4.15Å; V49-T53 WeakPolarHBondContact O-CB 3.29Å; V49-T53 PolarHBondContact O-N 3.45Å; V49-T53 PolarHBondContact O-OG1 3.1Å; V51-T53 PolarHBondContact O-N 2.76Å
54	R	73.4	Confident	79	Confident	148 Å²	148	111.3 Å²	111.3	56%	0.558	61%	0.606	S	S	*	*	S	Bend	trans	-64.7	128	171.4	-152.3	175.1	-161.4	-111	2.9	107.7	Y50 V51 G56 A57	Y50-R54 WeakPolarHBondContact O-CB 3.34Å; Y50-R54 PolarHBondContact O-N 3.28Å; V51-R54 WeakPolarHBondContact O-CB 3.23Å; V51-R54 PolarHBondContact O-N 3.38Å; R54-G56 PolarHBondContact O-N 2.85Å; R54-A57 PolarHBondContact O-N 2.56Å; R54-A57 VanDerWaalsContact O-N 3.1Å
55	P	62.9	Low	77.9	Confident	137 Å²	137	111.1 Å²	111.1	89%	0.89	61%	0.607	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.7	30.7	-175.9	29.2	-36.3	0	0	0	114.5
56	G	59.7	Low	76.6	Confident	56 Å²	56	112.1 Å²	112.1	58%	0.577	61%	0.614	S	S	*	*	T	Hydrogen-bonded Turn	trans	-145.3	11.7	172.5	0	0	0	0	0	113.4	R54	R54-G56 PolarHBondContact O-N 2.85Å
57	A	58.8	Low	75.3	Confident	58 Å²	58	113.9 Å²	113.9	48%	0.479	62%	0.62	S	S	.	*	S	Bend	trans	-97.2	-9	168.6	0	0	0	0	0	112.6	V51 R54	V51-A57 WeakPolarHBondContact O-CB 3.33Å; R54-A57 PolarHBondContact O-N 2.56Å; R54-A57 VanDerWaalsContact O-N 3.1Å
58	M	57.7	Low	73.8	Confident	168 Å²	168	116.9 Å²	116.9	83%	0.828	63%	0.633	S	S	*	*			trans	-112.5	58.2	171.7	-67	-163.2	-80.2	0	0	109.6
59	E	54.2	Low	72.2	Confident	252 Å²	252	114.1 Å²	114.1	100%	1.178	63%	0.631	S	S	*	*			trans	-115.5	0	161	-133.9	-174.5	115.4	0	0	108.9

Retrieved 59 of 59 residues in 100 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).