A0A087YQK9_POEFO Loading...

Phospholamban

Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN.

AlphaFold DB , UniProt , Accession A0A087YQK9, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 52 aa.

						>A0A087YQK9_POEFO|A0A087YQK9
MERVQHMTKSAIRRASQIEVNPQAKRNLQELFVNFTLILICLLLIYIIVLLS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57	Low	68.2	Low	209 Å²	209	127.5 Å²	127.5	100%	1.03	63%	0.629	S	S	*	*				0	-40.4	0	-87.3	170	142.5	0	0	113.1	R3 V4 Q5	M1-R3 PolarHBondContact O-N 3.41Å; M1-V4 PolarHBondContact O-N 3.21Å; M1-Q5 PolarHBondContact O-N 3.35Å
2	E	62.5	Low	68.6	Low	164 Å²	164	126.1 Å²	126.1	77%	0.766	62%	0.623	S	S	*	*	H	α-helix	trans	-58.9	-39.9	-176.2	-66.1	178.5	157.3	0	0	115.3	V4 Q5 H6	E2-V4 VanDerWaalsContact C-N 3.29Å; E2-V4 PolarHBondContact O-N 3.33Å; E2-Q5 PolarHBondContact O-N 2.95Å; E2-H6 PolarHBondContact O-N 2.95Å
3	R	62.7	Low	68.6	Low	217 Å²	217	129.8 Å²	129.8	82%	0.819	63%	0.626	S	S	*	*	H	α-helix	trans	-60.4	-36.8	177.8	-76	-173.8	-174.9	168.5	2.4	113	M1 H6 M7	M1-R3 PolarHBondContact O-N 3.41Å; R3-H6 PolarHBondContact O-N 2.86Å; R3-M7 WeakPolarHBondContact O-CB 3.49Å; R3-M7 VanDerWaalsContact O-CG 3.3Å; R3-M7 WeakPolarHBondContact O-CG 3.34Å; R3-M7 PolarHBondContact O-N 3.32Å
4	V	67.6	Low	68.3	Low	97 Å²	97	132.2 Å²	132.2	59%	0.588	63%	0.625	S	S	*	*	H	α-helix	trans	-69.9	-45.2	-179.9	-175.2	0	0	0	0	110	M1 E2 H6 M7 T8	M1-V4 PolarHBondContact O-N 3.21Å; E2-V4 VanDerWaalsContact C-N 3.29Å; E2-V4 PolarHBondContact O-N 3.33Å; V4-H6 VanDerWaalsContact C-N 3.3Å; V4-H6 PolarHBondContact O-N 3.23Å; V4-M7 WeakPolarHBondContact O-CB 3.3Å; V4-M7 PolarHBondContact O-N 3.44Å; V4-T8 PolarHBondContact O-N 2.99Å; V4-T8 PolarHBondContact O-OG1 3.37Å
5	Q	66	Low	67.9	Low	127 Å²	127	127.6 Å²	127.6	59%	0.593	62%	0.618	S	S	*	*	H	α-helix	trans	-61.5	-37.7	175.1	-83.4	-175.3	-58.4	0	0	112.7	M1 E2 T8 K9	M1-Q5 PolarHBondContact O-N 3.35Å; E2-Q5 PolarHBondContact O-N 2.95Å; Q5-T8 PolarHBondContact O-N 3.16Å; Q5-K9 WeakPolarHBondContact O-CB 3.43Å; Q5-K9 WeakPolarHBondContact O-CG 3.47Å; Q5-K9 PolarHBondContact O-N 2.96Å
6	H	70.8	Confident	67.6	Low	145 Å²	145	125.2 Å²	125.2	67%	0.671	62%	0.619	S	S	*	*	H	α-helix	trans	-68.2	-40.1	176.9	-138.8	-77.4	0	0	0	111.8	E2 R3 V4 S10	E2-H6 PolarHBondContact O-N 2.95Å; R3-H6 PolarHBondContact O-N 2.86Å; V4-H6 VanDerWaalsContact C-N 3.3Å; V4-H6 PolarHBondContact O-N 3.23Å; H6-S10 WeakPolarHBondContact O-CB 3.49Å; H6-S10 PolarHBondContact O-N 3.41Å; H6-S10 PolarHBondContact O-OG 2.91Å
7	M	71.4	Confident	67.2	Low	129 Å²	129	126.2 Å²	126.2	64%	0.635	62%	0.621	S	S	*	*	H	α-helix	trans	-60.8	-49.5	171.8	-75.8	177.6	67.7	0	0	111	R3 V4 K9 S10 A11	R3-M7 WeakPolarHBondContact O-CB 3.49Å; R3-M7 VanDerWaalsContact O-CG 3.3Å; R3-M7 WeakPolarHBondContact O-CG 3.34Å; R3-M7 PolarHBondContact O-N 3.32Å; V4-M7 WeakPolarHBondContact O-CB 3.3Å; V4-M7 PolarHBondContact O-N 3.44Å; M7-K9 PolarHBondContact O-N 2.77Å; M7-S10 PolarHBondContact O-N 3.45Å; M7-S10 VanDerWaalsContact O-N 3.16Å; M7-S10 PolarHBondContact O-OG 3.32Å; M7-A11 WeakPolarHBondContact O-CB 3.44Å; M7-A11 PolarHBondContact O-N 3.38Å
8	T	73.4	Confident	66.8	Low	73 Å²	73	125.7 Å²	125.7	45%	0.448	62%	0.62	S	S	.	*	H	α-helix	trans	-59.2	-46.9	178.5	-55.1	0	0	0	0	111.8	V4 Q5 S10 A11 I12	V4-T8 PolarHBondContact O-N 2.99Å; V4-T8 PolarHBondContact O-OG1 3.37Å; Q5-T8 PolarHBondContact O-N 3.16Å; T8-S10 VanDerWaalsContact C-N 3.33Å; T8-S10 PolarHBondContact O-N 2.87Å; T8-A11 PolarHBondContact O-N 3.19Å; T8-I12 HydrophobicContact CG2-CD1 3.84Å; T8-I12 HydrophobicContact CG2-CG1 4.48Å; T8-I12 WeakPolarHBondContact O-CB 3.5Å; T8-I12 VanDerWaalsContact O-CG1 3.24Å; T8-I12 WeakPolarHBondContact O-CG1 3.44Å; T8-I12 PolarHBondContact O-N 3.23Å
9	K	76.1	Confident	66.3	Low	150 Å²	150	128.5 Å²	128.5	65%	0.652	63%	0.632	S	S	*	*	H	α-helix	trans	-61	-40.1	175.4	-78.5	-179.5	175.6	179.7	0	112.3	Q5 M7 R13	Q5-K9 WeakPolarHBondContact O-CB 3.43Å; Q5-K9 WeakPolarHBondContact O-CG 3.47Å; Q5-K9 PolarHBondContact O-N 2.96Å; M7-K9 PolarHBondContact O-N 2.77Å; K9-R13 WeakPolarHBondContact O-CB 3.43Å; K9-R13 PolarHBondContact O-N 2.99Å
10	S	73.2	Confident	66.1	Low	38 Å²	38	127.6 Å²	127.6	27%	0.266	63%	0.633	S	S	.	*	H	α-helix	trans	-71.1	-29.4	177.8	78.8	0	0	0	0	113.5	H6 M7 T8 R14	H6-S10 WeakPolarHBondContact O-CB 3.49Å; H6-S10 PolarHBondContact O-N 3.41Å; H6-S10 PolarHBondContact O-OG 2.91Å; M7-S10 PolarHBondContact O-N 3.45Å; M7-S10 VanDerWaalsContact O-N 3.16Å; M7-S10 PolarHBondContact O-OG 3.32Å; T8-S10 VanDerWaalsContact C-N 3.33Å; T8-S10 PolarHBondContact O-N 2.87Å; S10-R14 WeakPolarHBondContact O-CB 3.5Å; S10-R14 WeakPolarHBondContact O-CG 3.36Å; S10-R14 PolarHBondContact O-N 3.46Å; S10-R14 PolarHBondContact O-NE 3.39Å; S10-R14 PolarHBondContact OG-NH2 3.41Å
11	A	69.3	Low	66.1	Low	54 Å²	54	125.9 Å²	125.9	45%	0.446	63%	0.627	S	S	.	*	H	α-helix	trans	-75.1	-43	175.1	0	0	0	0	0	110.9	M7 T8 R13 R14 A15	M7-A11 WeakPolarHBondContact O-CB 3.44Å; M7-A11 PolarHBondContact O-N 3.38Å; T8-A11 PolarHBondContact O-N 3.19Å; A11-R13 PolarHBondContact O-N 2.85Å; A11-R14 PolarHBondContact O-N 3.48Å; A11-A15 WeakPolarHBondContact O-CB 3.24Å; A11-A15 PolarHBondContact O-N 3.23Å
12	I	72.8	Confident	66.8	Low	110 Å²	110	120.5 Å²	120.5	56%	0.564	61%	0.607	S	S	*	*	H	α-helix	trans	-60.4	-44.8	174.3	-68.4	166.4	0	0	0	110.6	T8 R14 A15 S16	T8-I12 HydrophobicContact CG2-CD1 3.84Å; T8-I12 HydrophobicContact CG2-CG1 4.48Å; T8-I12 WeakPolarHBondContact O-CB 3.5Å; T8-I12 VanDerWaalsContact O-CG1 3.24Å; T8-I12 WeakPolarHBondContact O-CG1 3.44Å; T8-I12 PolarHBondContact O-N 3.23Å; I12-R14 VanDerWaalsContact C-N 3.31Å; I12-R14 PolarHBondContact O-N 2.9Å; I12-A15 PolarHBondContact O-N 2.86Å; I12-S16 PolarHBondContact O-N 3.46Å; I12-S16 PolarHBondContact O-OG 3.19Å
13	R	69.1	Low	67.5	Low	175 Å²	175	118.8 Å²	118.8	66%	0.66	60%	0.599	S	S	*	*	H	α-helix	trans	-65.3	-34.1	178	-159.1	179.3	86.4	-169.4	7.3	112.8	K9 A11 S16 Q17	K9-R13 WeakPolarHBondContact O-CB 3.43Å; K9-R13 PolarHBondContact O-N 2.99Å; A11-R13 PolarHBondContact O-N 2.85Å; R13-S16 WeakPolarHBondContact CA-OG 3.45Å; R13-S16 PolarHBondContact O-OG 3.19Å; R13-Q17 WeakPolarHBondContact O-CG 3.42Å; R13-Q17 PolarHBondContact O-N 3.49Å
14	R	64	Low	68.3	Low	163 Å²	163	110.5 Å²	110.5	62%	0.615	58%	0.577	S	S	*	*	H	α-helix	trans	-68.3	-45.1	172.6	-81.1	-178.3	-100.4	-168.6	-6.1	110.9	S10 A11 I12 S16 Q17 I18	S10-R14 WeakPolarHBondContact O-CB 3.5Å; S10-R14 WeakPolarHBondContact O-CG 3.36Å; S10-R14 PolarHBondContact O-N 3.46Å; S10-R14 PolarHBondContact O-NE 3.39Å; S10-R14 PolarHBondContact OG-NH2 3.41Å; A11-R14 PolarHBondContact O-N 3.48Å; I12-R14 VanDerWaalsContact C-N 3.31Å; I12-R14 PolarHBondContact O-N 2.9Å; R14-S16 VanDerWaalsContact C-N 3.31Å; R14-S16 PolarHBondContact O-N 3.23Å; R14-Q17 PolarHBondContact O-N 3.04Å; R14-Q17 VanDerWaalsContact O-N 3.16Å; R14-I18 WeakPolarHBondContact O-CG1 3.33Å; R14-I18 PolarHBondContact O-N 3.16Å
15	A	62.9	Low	69	Low	63 Å²	63	112.5 Å²	112.5	52%	0.521	58%	0.578	S	S	.	*	H	α-helix	trans	-61.2	-37.2	175.5	0	0	0	0	0	112.8	A11 I12 Q17 I18	A11-A15 WeakPolarHBondContact O-CB 3.24Å; A11-A15 PolarHBondContact O-N 3.23Å; I12-A15 PolarHBondContact O-N 2.86Å; A15-Q17 VanDerWaalsContact C-N 3.32Å; A15-Q17 PolarHBondContact O-N 2.93Å; A15-I18 PolarHBondContact O-N 2.9Å
16	S	62.6	Low	69.9	Low	89 Å²	89	114.7 Å²	114.7	62%	0.622	58%	0.581	S	S	*	*	H	α-helix	trans	-73	-22.6	176.8	70	0	0	0	0	113.8	I12 R13 R14	I12-S16 PolarHBondContact O-N 3.46Å; I12-S16 PolarHBondContact O-OG 3.19Å; R13-S16 WeakPolarHBondContact CA-OG 3.45Å; R13-S16 PolarHBondContact O-OG 3.19Å; R14-S16 VanDerWaalsContact C-N 3.31Å; R14-S16 PolarHBondContact O-N 3.23Å
17	Q	60.2	Low	70.7	Confident	142 Å²	142	112 Å²	112	66%	0.664	57%	0.571	S	S	*	*	H	α-helix	trans	-92.6	-7.4	175	-74.9	-171.2	-43.6	0	0	113.2	R13 R14 A15 E19	R13-Q17 WeakPolarHBondContact O-CG 3.42Å; R13-Q17 PolarHBondContact O-N 3.49Å; R14-Q17 PolarHBondContact O-N 3.04Å; R14-Q17 VanDerWaalsContact O-N 3.16Å; A15-Q17 VanDerWaalsContact C-N 3.32Å; A15-Q17 PolarHBondContact O-N 2.93Å; Q17-E19 PolarHBondContact O-N 3.38Å
18	I	60.7	Low	71.6	Confident	118 Å²	118	111.4 Å²	111.4	61%	0.605	57%	0.57	S	S	*	*			trans	-73.1	85.7	164.6	-64.7	165.8	0	0	0	105.4	R14 A15 V20	R14-I18 WeakPolarHBondContact O-CG1 3.33Å; R14-I18 PolarHBondContact O-N 3.16Å; A15-I18 PolarHBondContact O-N 2.9Å; I18-V20 PolarHBondContact O-N 3.01Å
19	E	57.6	Low	72.5	Confident	179 Å²	179	113.6 Å²	113.6	84%	0.836	58%	0.575	S	S	*	*			trans	-47.8	116.3	155.4	-84	-178.8	147	0	0	106	Q17 N21	Q17-E19 PolarHBondContact O-N 3.38Å; E19-N21 VanDerWaalsContact C-N 3.31Å; E19-N21 PolarHBondContact O-N 2.75Å
20	V	62.1	Low	73.4	Confident	109 Å²	109	111.9 Å²	111.9	66%	0.661	57%	0.57	S	S	*	*			trans	-56.8	101.4	-178.5	178.7	0	0	0	0	106.4	I18 P22 K25	I18-V20 PolarHBondContact O-N 3.01Å; V20-P22 VanDerWaalsContact O-CD 3.23Å; V20-P22 WeakPolarHBondContact O-CD 3.28Å; V20-K25 HydrophobicContact CG1-CB 4.35Å
21	N	66.4	Low	74.4	Confident	93 Å²	93	115.7 Å²	115.7	50%	0.497	59%	0.586	S	S	.	*			trans	-53.9	114.9	-176.3	179.4	-3.2	0	0	0	106.7	E19 Q23 A24 K25	E19-N21 VanDerWaalsContact C-N 3.31Å; E19-N21 PolarHBondContact O-N 2.75Å; N21-Q23 PolarHBondContact O-N 3.37Å; N21-Q23 VanDerWaalsContact OD1-CB 3.27Å; N21-Q23 WeakPolarHBondContact OD1-CB 3.39Å; N21-Q23 PolarHBondContact OD1-N 3.48Å; N21-A24 HydrophobicContact CB-CB 4.08Å; N21-A24 WeakPolarHBondContact O-CA 3.47Å; N21-A24 WeakPolarHBondContact O-CB 3.45Å; N21-A24 PolarHBondContact O-N 2.82Å; N21-K25 PolarHBondContact O-N 2.86Å; N21-K25 VanDerWaalsContact O-N 3.13Å
22	P	72.2	Confident	75.7	Confident	96 Å²	96	120 Å²	120	62%	0.623	60%	0.595	S	S	*	*	H	α-helix	trans	-58.9	-25.7	-174.2	19.6	-30.6	0	0	0	111.5	V20 R26	V20-P22 VanDerWaalsContact O-CD 3.23Å; V20-P22 WeakPolarHBondContact O-CD 3.28Å; P22-R26 PolarHBondContact O-N 2.96Å
23	Q	75.7	Confident	76.8	Confident	128 Å²	128	118 Å²	118	60%	0.598	59%	0.588	S	S	*	*	H	α-helix	trans	-62.8	-47.3	170.1	-161.1	100.8	-2.6	0	0	112.2	N21 K25 R26 N27	N21-Q23 PolarHBondContact O-N 3.37Å; N21-Q23 VanDerWaalsContact OD1-CB 3.27Å; N21-Q23 WeakPolarHBondContact OD1-CB 3.39Å; N21-Q23 PolarHBondContact OD1-N 3.48Å; Q23-K25 VanDerWaalsContact C-N 3.29Å; Q23-K25 PolarHBondContact O-N 3.19Å; Q23-R26 PolarHBondContact O-N 3.4Å; Q23-N27 WeakPolarHBondContact O-CB 3.35Å; Q23-N27 PolarHBondContact O-N 3.13Å; Q23-N27 PolarHBondContact O-OD1 3.49Å
24	A	79.9	Confident	78.1	Confident	43 Å²	43	114 Å²	114	36%	0.355	58%	0.58	S	S	.	*	H	α-helix	trans	-63.7	-37.7	179.2	0	0	0	0	0	111.3	N21 N27 L28	N21-A24 HydrophobicContact CB-CB 4.08Å; N21-A24 WeakPolarHBondContact O-CA 3.47Å; N21-A24 WeakPolarHBondContact O-CB 3.45Å; N21-A24 PolarHBondContact O-N 2.82Å; A24-N27 PolarHBondContact O-N 3.18Å; A24-L28 WeakPolarHBondContact O-CB 3.36Å; A24-L28 VanDerWaalsContact O-CG 3.28Å; A24-L28 WeakPolarHBondContact O-CG 3.21Å; A24-L28 PolarHBondContact O-N 2.97Å
25	K	82.4	Confident	79.7	Confident	138 Å²	138	111.8 Å²	111.8	60%	0.6	58%	0.575	S	S	*	*	H	α-helix	trans	-62.5	-45.2	173.3	-175.3	178.9	177	-178.3	0	111.8	V20 N21 Q23 L28 Q29	V20-K25 HydrophobicContact CG1-CB 4.35Å; N21-K25 PolarHBondContact O-N 2.86Å; N21-K25 VanDerWaalsContact O-N 3.13Å; Q23-K25 VanDerWaalsContact C-N 3.29Å; Q23-K25 PolarHBondContact O-N 3.19Å; K25-L28 PolarHBondContact O-N 3.05Å; K25-Q29 WeakPolarHBondContact O-CB 3.39Å; K25-Q29 PolarHBondContact O-N 3.18Å
26	R	84.8	Confident	81.4	Confident	173 Å²	173	111.2 Å²	111.2	65%	0.653	57%	0.565	S	S	*	*	H	α-helix	trans	-63.6	-46.5	176.4	-76.4	-172.2	-179.2	-170.4	1.8	112	P22 Q23 L28 Q29 E30	P22-R26 PolarHBondContact O-N 2.96Å; Q23-R26 PolarHBondContact O-N 3.4Å; R26-L28 VanDerWaalsContact C-N 3.32Å; R26-L28 PolarHBondContact O-N 2.9Å; R26-Q29 WeakPolarHBondContact O-CB 3.27Å; R26-Q29 PolarHBondContact O-N 3.04Å; R26-Q29 VanDerWaalsContact O-N 3.12Å; R26-E30 WeakPolarHBondContact O-CG 3.23Å; R26-E30 PolarHBondContact O-N 2.94Å
27	N	87.6	Confident	83.1	Confident	89 Å²	89	111.4 Å²	111.4	48%	0.476	56%	0.558	S	S	.	*	H	α-helix	trans	-60.4	-41.7	178.6	-67.3	3.3	0	0	0	111.8	Q23 A24 L31	Q23-N27 WeakPolarHBondContact O-CB 3.35Å; Q23-N27 PolarHBondContact O-N 3.13Å; Q23-N27 PolarHBondContact O-OD1 3.49Å; A24-N27 PolarHBondContact O-N 3.18Å; N27-L31 VanDerWaalsContact O-CB 3.31Å; N27-L31 WeakPolarHBondContact O-CB 3.48Å; N27-L31 PolarHBondContact O-N 2.89Å
28	L	91	Very high	84.9	Confident	117 Å²	117	109.3 Å²	109.3	61%	0.613	55%	0.551	S	S	*	*	H	α-helix	trans	-66.8	-38.5	175.6	-74.8	172	0	0	0	112.1	A24 K25 R26 L31 F32	A24-L28 WeakPolarHBondContact O-CB 3.36Å; A24-L28 VanDerWaalsContact O-CG 3.28Å; A24-L28 WeakPolarHBondContact O-CG 3.21Å; A24-L28 PolarHBondContact O-N 2.97Å; K25-L28 PolarHBondContact O-N 3.05Å; R26-L28 VanDerWaalsContact C-N 3.32Å; R26-L28 PolarHBondContact O-N 2.9Å; L28-L31 PolarHBondContact O-N 3.38Å; L28-F32 WeakPolarHBondContact O-CB 3.46Å; L28-F32 PolarHBondContact O-N 3.45Å
29	Q	91.3	Very high	86.6	Confident	119 Å²	119	107.8 Å²	107.8	56%	0.556	54%	0.543	S	S	*	.	H	α-helix	trans	-64.8	-46.5	176.2	-173.7	176.4	-6.1	0	0	111.2	K25 R26 L31 F32 V33	K25-Q29 WeakPolarHBondContact O-CB 3.39Å; K25-Q29 PolarHBondContact O-N 3.18Å; R26-Q29 WeakPolarHBondContact O-CB 3.27Å; R26-Q29 PolarHBondContact O-N 3.04Å; R26-Q29 VanDerWaalsContact O-N 3.12Å; Q29-L31 PolarHBondContact O-N 3.42Å; Q29-F32 PolarHBondContact O-N 2.84Å; Q29-V33 WeakPolarHBondContact O-CB 3.31Å; Q29-V33 VanDerWaalsContact O-CG2 3.24Å; Q29-V33 WeakPolarHBondContact O-CG2 3.49Å; Q29-V33 PolarHBondContact O-N 3.12Å
30	E	94.8	Very high	88.6	Confident	114 Å²	114	103.4 Å²	103.4	53%	0.533	53%	0.525	S	S	.	.	H	α-helix	trans	-60.6	-44.9	175.5	-74.3	175.7	-169.5	0	0	111.6	R26 F32 V33 N34	R26-E30 WeakPolarHBondContact O-CG 3.23Å; R26-E30 PolarHBondContact O-N 2.94Å; E30-F32 VanDerWaalsContact C-N 3.32Å; E30-F32 PolarHBondContact O-N 2.94Å; E30-V33 PolarHBondContact O-N 3.5Å; E30-N34 VanDerWaalsContact O-CB 3.29Å; E30-N34 WeakPolarHBondContact O-CB 3.29Å; E30-N34 PolarHBondContact O-N 3.48Å; E30-N34 PolarHBondContact O-ND2 3.31Å
31	L	94.9	Very high	90.3	Very high	117 Å²	117	101.6 Å²	101.6	61%	0.613	52%	0.516	S	S	*	.	H	α-helix	trans	-59.3	-44.8	176.6	-175.7	64.7	0	0	0	111.5	N27 L28 Q29 F35	N27-L31 VanDerWaalsContact O-CB 3.31Å; N27-L31 WeakPolarHBondContact O-CB 3.48Å; N27-L31 PolarHBondContact O-N 2.89Å; L28-L31 PolarHBondContact O-N 3.38Å; Q29-L31 PolarHBondContact O-N 3.42Å; L31-F35 WeakPolarHBondContact O-CB 3.47Å; L31-F35 PolarHBondContact O-N 2.94Å
32	F	95.9	Very high	91.8	Very high	144 Å²	144	102.1 Å²	102.1	63%	0.632	52%	0.518	S	S	*	.	H	α-helix	trans	-67.2	-41.7	-179.4	-164.7	-92.6	0	0	0	112.3	L28 Q29 E30 T36	L28-F32 WeakPolarHBondContact O-CB 3.46Å; L28-F32 PolarHBondContact O-N 3.45Å; Q29-F32 PolarHBondContact O-N 2.84Å; E30-F32 VanDerWaalsContact C-N 3.32Å; E30-F32 PolarHBondContact O-N 2.94Å; F32-T36 WeakPolarHBondContact O-CB 3.41Å; F32-T36 PolarHBondContact O-N 3.46Å; F32-T36 PolarHBondContact O-OG1 2.93Å
33	V	96.8	Very high	93	Very high	70 Å²	70	102.5 Å²	102.5	42%	0.424	52%	0.515	S	S	.	.	H	α-helix	trans	-63.3	-49.1	176.4	171.1	0	0	0	0	110.3	Q29 E30 F35 T36 L37	Q29-V33 WeakPolarHBondContact O-CB 3.31Å; Q29-V33 VanDerWaalsContact O-CG2 3.24Å; Q29-V33 WeakPolarHBondContact O-CG2 3.49Å; Q29-V33 PolarHBondContact O-N 3.12Å; E30-V33 PolarHBondContact O-N 3.5Å; V33-F35 PolarHBondContact O-N 3.26Å; V33-T36 PolarHBondContact O-N 2.97Å; V33-L37 HydrophobicContact CG1-CD1 3.93Å; V33-L37 WeakPolarHBondContact O-CB 3.34Å; V33-L37 WeakPolarHBondContact O-CG 3.24Å; V33-L37 PolarHBondContact O-N 3.5Å
34	N	96.8	Very high	94	Very high	90 Å²	90	101 Å²	101	48%	0.481	51%	0.51	S	S	.	.	H	α-helix	trans	-61.7	-44.3	179.3	-71.4	-17.8	0	0	0	111.4	E30 L37 I38	E30-N34 VanDerWaalsContact O-CB 3.29Å; E30-N34 WeakPolarHBondContact O-CB 3.29Å; E30-N34 PolarHBondContact O-N 3.48Å; E30-N34 PolarHBondContact O-ND2 3.31Å; N34-L37 PolarHBondContact O-N 3.35Å; N34-I38 VanDerWaalsContact O-CG1 3.29Å; N34-I38 WeakPolarHBondContact O-CG1 3.48Å; N34-I38 PolarHBondContact O-N 2.93Å
35	F	97.4	Very high	94.9	Very high	116 Å²	116	103.7 Å²	103.7	51%	0.509	52%	0.518	S	S	.	.	H	α-helix	trans	-62.7	-43.5	177.2	-177.8	-106	0	0	0	112.2	L31 V33 L37 I38 L39	L31-F35 WeakPolarHBondContact O-CB 3.47Å; L31-F35 PolarHBondContact O-N 2.94Å; V33-F35 PolarHBondContact O-N 3.26Å; F35-L37 PolarHBondContact O-N 3.01Å; F35-I38 PolarHBondContact O-N 3.29Å; F35-L39 HydrophobicContact CD1-CD1 3.88Å; F35-L39 HydrophobicContact CD1-CG 4.44Å; F35-L39 HydrophobicContact CE1-CD1 3.38Å; F35-L39 HydrophobicContact CE1-CG 4.09Å; F35-L39 HydrophobicContact CZ-CD1 3.85Å; F35-L39 HydrophobicContact CZ-CD2 4.31Å; F35-L39 HydrophobicContact CZ-CG 4.16Å; F35-L39 WeakPolarHBondContact O-CG 3.49Å; F35-L39 PolarHBondContact O-N 3.29Å
36	T	97.8	Very high	95.6	Very high	51 Å²	51	104.1 Å²	104.1	31%	0.313	52%	0.517	S	S	.	.	H	α-helix	trans	-63.9	-42	177.8	-57.1	0	0	0	0	111.6	F32 V33 I38 L39 I40	F32-T36 WeakPolarHBondContact O-CB 3.41Å; F32-T36 PolarHBondContact O-N 3.46Å; F32-T36 PolarHBondContact O-OG1 2.93Å; V33-T36 PolarHBondContact O-N 2.97Å; T36-I38 VanDerWaalsContact C-N 3.34Å; T36-I38 PolarHBondContact O-N 2.96Å; T36-L39 PolarHBondContact O-N 3.03Å; T36-I40 HydrophobicContact CG2-CD1 4.06Å; T36-I40 WeakPolarHBondContact O-CG1 3.34Å; T36-I40 PolarHBondContact O-N 3.29Å
37	L	97.9	Very high	96.2	Very high	93 Å²	93	99.7 Å²	99.7	49%	0.487	51%	0.505	S	S	.	.	H	α-helix	trans	-59.9	-44.3	175.1	-80.4	163.8	0	0	0	111.7	V33 N34 F35 L39 I40 C41	V33-L37 HydrophobicContact CG1-CD1 3.93Å; V33-L37 WeakPolarHBondContact O-CB 3.34Å; V33-L37 WeakPolarHBondContact O-CG 3.24Å; V33-L37 PolarHBondContact O-N 3.5Å; N34-L37 PolarHBondContact O-N 3.35Å; F35-L37 PolarHBondContact O-N 3.01Å; L37-L39 VanDerWaalsContact C-N 3.34Å; L37-L39 PolarHBondContact O-N 3.38Å; L37-I40 PolarHBondContact O-N 3.41Å; L37-C41 PolarHBondContact O-N 3.25Å; L37-C41 PolarHBondContact O-SG 2.76Å; L37-C41 VanDerWaalsContact O-SG 3.32Å
38	I	98.1	Very high	96.7	Very high	98 Å²	98	100.5 Å²	100.5	50%	0.503	51%	0.509	S	S	.	.	H	α-helix	trans	-60	-45.6	176.4	-68.7	164.5	0	0	0	110.7	N34 F35 T36 I40 C41 L42	N34-I38 VanDerWaalsContact O-CG1 3.29Å; N34-I38 WeakPolarHBondContact O-CG1 3.48Å; N34-I38 PolarHBondContact O-N 2.93Å; F35-I38 PolarHBondContact O-N 3.29Å; T36-I38 VanDerWaalsContact C-N 3.34Å; T36-I38 PolarHBondContact O-N 2.96Å; I38-I40 PolarHBondContact O-N 3.25Å; I38-C41 WeakPolarHBondContact O-CB 3.34Å; I38-C41 PolarHBondContact O-N 3.46Å; I38-L42 HydrophobicContact CG2-CD1 4.07Å; I38-L42 HydrophobicContact CG2-CG 4.46Å; I38-L42 WeakPolarHBondContact O-CG 3.47Å; I38-L42 PolarHBondContact O-N 3.47Å
39	L	98.2	Very high	96.9	Very high	86 Å²	86	99.6 Å²	99.6	45%	0.45	51%	0.508	S	S	.	.	H	α-helix	trans	-61.3	-42.3	178	-73.7	177.8	0	0	0	112.5	F35 T36 L37 L42 L43	F35-L39 HydrophobicContact CD1-CD1 3.88Å; F35-L39 HydrophobicContact CD1-CG 4.44Å; F35-L39 HydrophobicContact CE1-CD1 3.38Å; F35-L39 HydrophobicContact CE1-CG 4.09Å; F35-L39 HydrophobicContact CZ-CD1 3.85Å; F35-L39 HydrophobicContact CZ-CD2 4.31Å; F35-L39 HydrophobicContact CZ-CG 4.16Å; F35-L39 WeakPolarHBondContact O-CG 3.49Å; F35-L39 PolarHBondContact O-N 3.29Å; T36-L39 PolarHBondContact O-N 3.03Å; L37-L39 VanDerWaalsContact C-N 3.34Å; L37-L39 PolarHBondContact O-N 3.38Å; L39-L42 PolarHBondContact O-N 3.16Å; L39-L43 WeakPolarHBondContact O-CB 3.38Å; L39-L43 PolarHBondContact O-N 2.92Å
40	I	98.2	Very high	97.2	Very high	88 Å²	88	99.4 Å²	99.4	45%	0.451	51%	0.51	S	S	.	.	H	α-helix	trans	-61.7	-45.5	176.1	-68.5	167.8	0	0	0	110.2	T36 L37 I38 L42 L43 L44	T36-I40 HydrophobicContact CG2-CD1 4.06Å; T36-I40 WeakPolarHBondContact O-CG1 3.34Å; T36-I40 PolarHBondContact O-N 3.29Å; L37-I40 PolarHBondContact O-N 3.41Å; I38-I40 PolarHBondContact O-N 3.25Å; I40-L42 PolarHBondContact O-N 2.94Å; I40-L43 PolarHBondContact O-N 3.36Å; I40-L44 HydrophobicContact CG2-CD1 4.01Å; I40-L44 HydrophobicContact CG2-CG 4.36Å; I40-L44 WeakPolarHBondContact O-CG 3.29Å; I40-L44 PolarHBondContact O-N 3.22Å
41	C	97.9	Very high	97	Very high	71 Å²	71	101 Å²	101	48%	0.48	52%	0.521	S	S	.	.	H	α-helix	trans	-58.7	-46	176.9	-71.4	0	0	0	0	112.1	L37 I38 L43 L44 I45	L37-C41 PolarHBondContact O-N 3.25Å; L37-C41 PolarHBondContact O-SG 2.76Å; L37-C41 VanDerWaalsContact O-SG 3.32Å; I38-C41 WeakPolarHBondContact O-CB 3.34Å; I38-C41 PolarHBondContact O-N 3.46Å; C41-L43 VanDerWaalsContact C-N 3.32Å; C41-L43 PolarHBondContact O-N 2.93Å; C41-L44 PolarHBondContact O-N 3.28Å; C41-I45 VanDerWaalsContact O-CG1 3.31Å; C41-I45 WeakPolarHBondContact O-CG1 3.33Å; C41-I45 PolarHBondContact O-N 2.97Å
42	L	97.9	Very high	96.2	Very high	103 Å²	103	102.6 Å²	102.6	54%	0.539	54%	0.542	S	S	.	.	H	α-helix	trans	-62.3	-40.5	177.3	-69.5	172.7	0	0	0	112	I38 L39 I40 I45 Y46	I38-L42 HydrophobicContact CG2-CD1 4.07Å; I38-L42 HydrophobicContact CG2-CG 4.46Å; I38-L42 WeakPolarHBondContact O-CG 3.47Å; I38-L42 PolarHBondContact O-N 3.47Å; L39-L42 PolarHBondContact O-N 3.16Å; I40-L42 PolarHBondContact O-N 2.94Å; L42-I45 PolarHBondContact O-N 3.45Å; L42-Y46 PolarHBondContact O-N 3.3Å
43	L	97.8	Very high	96.2	Very high	104 Å²	104	100.5 Å²	100.5	55%	0.545	54%	0.537	S	S	.	.	H	α-helix	trans	-64.2	-42.8	177.1	-170.9	70.1	0	0	0	111.5	L39 I40 C41 Y46 I47	L39-L43 WeakPolarHBondContact O-CB 3.38Å; L39-L43 PolarHBondContact O-N 2.92Å; I40-L43 PolarHBondContact O-N 3.36Å; C41-L43 VanDerWaalsContact C-N 3.32Å; C41-L43 PolarHBondContact O-N 2.93Å; L43-Y46 WeakPolarHBondContact O-CB 3.5Å; L43-Y46 PolarHBondContact O-N 2.9Å; L43-I47 HydrophobicContact CG-CD1 4.23Å; L43-I47 VanDerWaalsContact O-CG1 3.31Å; L43-I47 WeakPolarHBondContact O-CG1 3.31Å; L43-I47 PolarHBondContact O-N 3.44Å
44	L	97.6	Very high	96.2	Very high	97 Å²	97	102.1 Å²	102.1	51%	0.508	54%	0.543	S	S	.	.	H	α-helix	trans	-63.3	-43.3	176.4	-70.6	173.2	0	0	0	111.6	I40 C41 Y46 I47 I48	I40-L44 HydrophobicContact CG2-CD1 4.01Å; I40-L44 HydrophobicContact CG2-CG 4.36Å; I40-L44 WeakPolarHBondContact O-CG 3.29Å; I40-L44 PolarHBondContact O-N 3.22Å; C41-L44 PolarHBondContact O-N 3.28Å; L44-Y46 VanDerWaalsContact C-N 3.31Å; L44-Y46 PolarHBondContact O-N 3.45Å; L44-I47 PolarHBondContact O-N 2.97Å; L44-I48 VanDerWaalsContact O-CG1 3.28Å; L44-I48 WeakPolarHBondContact O-CG1 3.33Å; L44-I48 PolarHBondContact O-N 3.32Å
45	I	97.8	Very high	96.2	Very high	100 Å²	100	102.8 Å²	102.8	51%	0.513	55%	0.547	S	S	.	.	H	α-helix	trans	-58.7	-46.5	174.6	-67.5	165.6	0	0	0	110.2	C41 L42 I47 I48 V49	C41-I45 VanDerWaalsContact O-CG1 3.31Å; C41-I45 WeakPolarHBondContact O-CG1 3.33Å; C41-I45 PolarHBondContact O-N 2.97Å; L42-I45 PolarHBondContact O-N 3.45Å; I45-I47 VanDerWaalsContact C-N 3.33Å; I45-I47 PolarHBondContact O-N 3.3Å; I45-I48 PolarHBondContact O-N 3.39Å; I45-V49 HydrophobicContact CG2-CG2 4.37Å; I45-V49 WeakPolarHBondContact O-CG2 3.31Å; I45-V49 PolarHBondContact O-N 2.97Å
46	Y	97.6	Very high	96.1	Very high	146 Å²	146	102 Å²	102	57%	0.573	55%	0.549	S	S	*	.	H	α-helix	trans	-58.9	-43.8	177.6	177.1	-98.1	0	0	0	112.2	L42 L43 L44 V49 L50	L42-Y46 PolarHBondContact O-N 3.3Å; L43-Y46 WeakPolarHBondContact O-CB 3.5Å; L43-Y46 PolarHBondContact O-N 2.9Å; L44-Y46 VanDerWaalsContact C-N 3.31Å; L44-Y46 PolarHBondContact O-N 3.45Å; Y46-V49 PolarHBondContact O-N 3.23Å; Y46-L50 HydrophobicContact CE1-CD1 3.8Å; Y46-L50 WeakPolarHBondContact O-CB 3.48Å; Y46-L50 PolarHBondContact O-N 3.07Å; Y46-L50 WeakPolarHBondContact OH-CD1 3.46Å
47	I	97.5	Very high	96	Very high	81 Å²	81	105.2 Å²	105.2	42%	0.415	56%	0.564	S	S	.	*	H	α-helix	trans	-62.6	-45.1	176.5	-67.9	165.5	0	0	0	110.8	L43 L44 I45 V49 L50 L51	L43-I47 HydrophobicContact CG-CD1 4.23Å; L43-I47 VanDerWaalsContact O-CG1 3.31Å; L43-I47 WeakPolarHBondContact O-CG1 3.31Å; L43-I47 PolarHBondContact O-N 3.44Å; L44-I47 PolarHBondContact O-N 2.97Å; I45-I47 VanDerWaalsContact C-N 3.33Å; I45-I47 PolarHBondContact O-N 3.3Å; I47-V49 VanDerWaalsContact C-N 3.32Å; I47-V49 PolarHBondContact O-N 2.88Å; I47-L50 PolarHBondContact O-N 3.43Å; I47-L50 VanDerWaalsContact O-N 3.16Å; I47-L51 WeakPolarHBondContact O-CB 3.28Å; I47-L51 PolarHBondContact O-N 3.36Å
48	I	97.3	Very high	95.8	Very high	106 Å²	106	106 Å²	106	54%	0.544	57%	0.569	S	S	.	*	H	α-helix	trans	-59.7	-43.9	178	-69.1	165	0	0	0	110.9	L44 I45 L50 L51 S52	L44-I48 VanDerWaalsContact O-CG1 3.28Å; L44-I48 WeakPolarHBondContact O-CG1 3.33Å; L44-I48 PolarHBondContact O-N 3.32Å; I45-I48 PolarHBondContact O-N 3.39Å; I48-L50 VanDerWaalsContact C-N 3.32Å; I48-L51 PolarHBondContact O-N 2.92Å; I48-S52 WeakPolarHBondContact O-CB 3.4Å; I48-S52 PolarHBondContact O-N 2.91Å; I48-S52 PolarHBondContact O-OG 2.92Å
49	V	96.3	Very high	95.7	Very high	98 Å²	98	106.6 Å²	106.6	59%	0.594	57%	0.574	S	S	*	*	H	α-helix	trans	-64.3	-37.7	176.8	170.5	0	0	0	0	111.4	I45 Y46 I47 L51	I45-V49 HydrophobicContact CG2-CG2 4.37Å; I45-V49 WeakPolarHBondContact O-CG2 3.31Å; I45-V49 PolarHBondContact O-N 2.97Å; Y46-V49 PolarHBondContact O-N 3.23Å; I47-V49 VanDerWaalsContact C-N 3.32Å; I47-V49 PolarHBondContact O-N 2.88Å; V49-L51 VanDerWaalsContact C-N 3.35Å
50	L	96	Very high	95.5	Very high	114 Å²	114	108.2 Å²	108.2	60%	0.597	58%	0.583	S	S	*	*	H	α-helix	trans	-74.7	-26.5	179.9	-165.9	139.5	0	0	0	112.8	Y46 I47 I48	Y46-L50 HydrophobicContact CE1-CD1 3.8Å; Y46-L50 WeakPolarHBondContact O-CB 3.48Å; Y46-L50 PolarHBondContact O-N 3.07Å; Y46-L50 WeakPolarHBondContact OH-CD1 3.46Å; I47-L50 PolarHBondContact O-N 3.43Å; I47-L50 VanDerWaalsContact O-N 3.16Å; I48-L50 VanDerWaalsContact C-N 3.32Å
51	L	90.9	Very high	95.3	Very high	149 Å²	149	109.8 Å²	109.8	78%	0.78	59%	0.594	S	S	*	*	H	α-helix	trans	-88	-18.4	179.2	-138.7	87.7	0	0	0	113.8	I47 I48 V49	I47-L51 WeakPolarHBondContact O-CB 3.28Å; I47-L51 PolarHBondContact O-N 3.36Å; I48-L51 PolarHBondContact O-N 2.92Å; V49-L51 VanDerWaalsContact C-N 3.35Å
52	S	78.6	Confident	95	Very high	149 Å²	149	113.4 Å²	113.4	100%	1.042	60%	0.604	S	S	*	*			trans	-85.1	0	175.9	-60.6	0	0	0	0	111.1	I48	I48-S52 WeakPolarHBondContact O-CB 3.4Å; I48-S52 PolarHBondContact O-N 2.91Å; I48-S52 PolarHBondContact O-OG 2.92Å

Retrieved 52 of 52 residues in 15.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).