A0A087YRR5_POEFO Loading...

SOSS complex subunit C

Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs).

AlphaFold DB , UniProt , Accession A0A087YRR5, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 102 aa.

						>A0A087YRR5_POEFO|A0A087YRR5
MAANPPGQGFQNKTRVAILAELDKEKRRLLQSQSMNSPGANIPLSGRSSLKEARDSAEQQHIAAQQKAALQHAHVHSSGFFITQDSSFGNLILPVLPRLEPD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41	Very low	52.4	Low	250 Å²	250	125.3 Å²	125.3	100%	1.232	76%	0.757	S	S	*	*				0	101.1	0	-68.8	175	169.1	0	0	107.2
2	A	40	Very low	53.8	Low	108 Å²	108	122.6 Å²	122.6	89%	0.893	74%	0.736	S	S	*	*	P	Polyproline II helix	trans	-95	117.7	-176.9	0	0	0	0	0	109.5
3	A	52.1	Low	55.4	Low	104 Å²	104	125.1 Å²	125.1	86%	0.86	73%	0.731	S	S	*	*	P	Polyproline II helix	trans	-73	135.2	179.3	0	0	0	0	0	110.9
4	N	53.4	Low	57.1	Low	134 Å²	134	121.6 Å²	121.6	72%	0.717	71%	0.712	S	S	*	*	P	Polyproline II helix	trans	-83.9	131	-179.7	-143.6	10.2	0	0	0	109.7
5	P	55.2	Low	58.6	Low	94 Å²	94	125 Å²	125	61%	0.61	71%	0.708	S	S	*	*	P	Polyproline II helix	trans	-76.5	139.2	-176.5	28.6	-32.1	0	0	0	112.2	G7	P5-G7 PolarHBondContact O-N 3.49Å
6	P	56.6	Low	60.3	Low	142 Å²	142	122.4 Å²	122.4	92%	0.922	70%	0.695	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.4	88.5	-179.4	32.7	-32.2	0	0	0	110.1
7	G	54.8	Low	61.8	Low	56 Å²	56	118.6 Å²	118.6	58%	0.577	68%	0.683	S	S	*	*	T	Hydrogen-bonded Turn	trans	-151.5	-3.4	176.6	0	0	0	0	0	115.6	P5 G9	P5-G7 PolarHBondContact O-N 3.49Å; G7-G9 PolarHBondContact O-N 3.24Å
8	Q	55.3	Low	63.4	Low	128 Å²	128	117.3 Å²	117.3	60%	0.598	67%	0.672	S	S	*	*	H	α-helix	trans	-91	3.5	-168.3	-76.3	171.4	-25.7	0	0	114.9	N12	Q8-N12 WeakPolarHBondContact O-CB 3.39Å; Q8-N12 PolarHBondContact O-N 3.4Å
9	G	54.4	Low	64.7	Low	50 Å²	50	115.8 Å²	115.8	52%	0.515	66%	0.661	S	S	.	*	H	α-helix	trans	-72.3	-41.8	-177.8	0	0	0	0	0	114.3	G7 K13	G7-G9 PolarHBondContact O-N 3.24Å; G9-K13 WeakPolarHBondContact O-CG 3.45Å; G9-K13 PolarHBondContact O-N 3.31Å
10	F	54	Low	66	Low	171 Å²	171	113.1 Å²	113.1	75%	0.75	65%	0.653	S	S	*	*	H	α-helix	trans	-77.8	-44.2	-176.5	-79.6	-87.4	0	0	0	112.6	N12 K13 T14	F10-N12 PolarHBondContact O-N 3.47Å; F10-K13 PolarHBondContact O-N 3.48Å; F10-T14 PolarHBondContact O-N 3.4Å; F10-T14 PolarHBondContact O-OG1 3.27Å
11	Q	59.9	Low	67.2	Low	141 Å²	141	114 Å²	114	66%	0.659	65%	0.652	S	S	*	*	H	α-helix	trans	-61.5	-33.6	175.9	-61.9	-64.4	-14.3	0	0	111.8	R15	Q11-R15 VanDerWaalsContact O-CB 3.26Å; Q11-R15 WeakPolarHBondContact O-CB 3.27Å; Q11-R15 PolarHBondContact O-N 3.24Å
12	N	68.8	Low	69.6	Low	93 Å²	93	107.2 Å²	107.2	50%	0.497	62%	0.62	S	S	.	*	H	α-helix	trans	-71	-41.5	177.8	-163.8	-28	0	0	0	111.4	Q8 F10 T14 R15 V16	Q8-N12 WeakPolarHBondContact O-CB 3.39Å; Q8-N12 PolarHBondContact O-N 3.4Å; F10-N12 PolarHBondContact O-N 3.47Å; N12-T14 PolarHBondContact O-N 3.28Å; N12-R15 PolarHBondContact O-N 3.25Å; N12-V16 WeakPolarHBondContact O-CB 3.25Å; N12-V16 VanDerWaalsContact O-CG2 3.23Å; N12-V16 WeakPolarHBondContact O-CG2 3.34Å; N12-V16 PolarHBondContact O-N 3.21Å
13	K	75	Confident	72	Confident	155 Å²	155	106.2 Å²	106.2	67%	0.674	60%	0.599	S	S	*	*	H	α-helix	trans	-60.2	-43.8	172.7	-73	178.2	172.8	-172.8	0	112.3	G9 F10 V16 A17	G9-K13 WeakPolarHBondContact O-CG 3.45Å; G9-K13 PolarHBondContact O-N 3.31Å; F10-K13 PolarHBondContact O-N 3.48Å; K13-V16 PolarHBondContact O-N 3.13Å; K13-A17 WeakPolarHBondContact O-CB 3.36Å; K13-A17 PolarHBondContact O-N 2.79Å
14	T	78.6	Confident	73.9	Confident	76 Å²	76	108.1 Å²	108.1	47%	0.466	59%	0.588	S	S	.	*	H	α-helix	trans	-63.6	-44	175.5	-55.8	0	0	0	0	111.5	F10 N12 V16 A17 I18	F10-T14 PolarHBondContact O-N 3.4Å; F10-T14 PolarHBondContact O-OG1 3.27Å; N12-T14 PolarHBondContact O-N 3.28Å; T14-V16 PolarHBondContact O-N 3.02Å; T14-A17 PolarHBondContact O-N 3.28Å; T14-I18 HydrophobicContact CG2-CD1 3.93Å; T14-I18 VanDerWaalsContact O-CG1 3.28Å; T14-I18 WeakPolarHBondContact O-CG1 3.44Å; T14-I18 PolarHBondContact O-N 2.9Å
15	R	80.1	Confident	75.4	Confident	173 Å²	173	105.3 Å²	105.3	65%	0.653	57%	0.571	S	S	*	*	H	α-helix	trans	-60.3	-43.4	175.7	-176.1	-177.2	179.9	115	-0.1	112	Q11 N12 I18 L19	Q11-R15 VanDerWaalsContact O-CB 3.26Å; Q11-R15 WeakPolarHBondContact O-CB 3.27Å; Q11-R15 PolarHBondContact O-N 3.24Å; N12-R15 PolarHBondContact O-N 3.25Å; R15-I18 PolarHBondContact O-N 3Å; R15-L19 HydrophobicContact CG-CD1 4.05Å; R15-L19 WeakPolarHBondContact O-CB 3.44Å; R15-L19 VanDerWaalsContact O-CG 3.27Å; R15-L19 WeakPolarHBondContact O-CG 3.43Å; R15-L19 PolarHBondContact O-N 3.44Å
16	V	86	Confident	76.9	Confident	83 Å²	83	107 Å²	107	50%	0.503	57%	0.569	S	S	.	*	H	α-helix	trans	-65.6	-41.2	178.3	171.1	0	0	0	0	111	N12 K13 T14 L19 A20	N12-V16 WeakPolarHBondContact O-CB 3.25Å; N12-V16 VanDerWaalsContact O-CG2 3.23Å; N12-V16 WeakPolarHBondContact O-CG2 3.34Å; N12-V16 PolarHBondContact O-N 3.21Å; K13-V16 PolarHBondContact O-N 3.13Å; T14-V16 PolarHBondContact O-N 3.02Å; V16-L19 PolarHBondContact O-N 3.36Å; V16-A20 WeakPolarHBondContact O-CB 3.29Å; V16-A20 PolarHBondContact O-N 2.98Å
17	A	86.1	Confident	78.4	Confident	59 Å²	59	108.6 Å²	108.6	49%	0.488	56%	0.556	S	S	.	*	H	α-helix	trans	-62.5	-45	175.8	0	0	0	0	0	111.8	K13 T14 L19 A20 E21	K13-A17 WeakPolarHBondContact O-CB 3.36Å; K13-A17 PolarHBondContact O-N 2.79Å; T14-A17 PolarHBondContact O-N 3.28Å; A17-L19 PolarHBondContact O-N 3.01Å; A17-A20 PolarHBondContact O-N 3.43Å; A17-E21 WeakPolarHBondContact O-CB 3.5Å; A17-E21 PolarHBondContact O-N 3.01Å
18	I	89.3	Confident	79.8	Confident	94 Å²	94	112.2 Å²	112.2	48%	0.482	55%	0.552	S	S	.	*	H	α-helix	trans	-62	-44.9	176.6	-67.3	165.3	0	0	0	111	T14 R15 A20 E21 L22	T14-I18 HydrophobicContact CG2-CD1 3.93Å; T14-I18 VanDerWaalsContact O-CG1 3.28Å; T14-I18 WeakPolarHBondContact O-CG1 3.44Å; T14-I18 PolarHBondContact O-N 2.9Å; R15-I18 PolarHBondContact O-N 3Å; I18-A20 VanDerWaalsContact C-N 3.34Å; I18-A20 PolarHBondContact O-N 2.99Å; I18-E21 PolarHBondContact O-N 3.43Å; I18-L22 HydrophobicContact CG2-CD1 4.02Å; I18-L22 HydrophobicContact CG2-CG 4.44Å; I18-L22 VanDerWaalsContact O-CG 3.3Å; I18-L22 WeakPolarHBondContact O-CG 3.49Å; I18-L22 PolarHBondContact O-N 2.91Å
19	L	89.2	Confident	81	Confident	90 Å²	90	110.4 Å²	110.4	47%	0.471	55%	0.547	S	S	.	.	H	α-helix	trans	-63.9	-40	178.5	-72.9	169.9	0	0	0	112	R15 V16 A17 L22 D23	R15-L19 HydrophobicContact CG-CD1 4.05Å; R15-L19 WeakPolarHBondContact O-CB 3.44Å; R15-L19 VanDerWaalsContact O-CG 3.27Å; R15-L19 WeakPolarHBondContact O-CG 3.43Å; R15-L19 PolarHBondContact O-N 3.44Å; V16-L19 PolarHBondContact O-N 3.36Å; A17-L19 PolarHBondContact O-N 3.01Å; L19-L22 PolarHBondContact O-N 3Å; L19-D23 PolarHBondContact O-N 3.42Å
20	A	90.7	Very high	82	Confident	60 Å²	60	114 Å²	114	50%	0.496	55%	0.553	S	S	.	*	H	α-helix	trans	-65.9	-40.1	176.6	0	0	0	0	0	112.3	V16 A17 I18 D23 K24	V16-A20 WeakPolarHBondContact O-CB 3.29Å; V16-A20 PolarHBondContact O-N 2.98Å; A17-A20 PolarHBondContact O-N 3.43Å; I18-A20 VanDerWaalsContact C-N 3.34Å; I18-A20 PolarHBondContact O-N 2.99Å; A20-D23 PolarHBondContact O-N 3.45Å; A20-K24 WeakPolarHBondContact O-CB 3.36Å; A20-K24 PolarHBondContact O-N 2.91Å
21	E	90.1	Very high	82.8	Confident	133 Å²	133	112.1 Å²	112.1	62%	0.621	55%	0.547	S	S	*	.	H	α-helix	trans	-61.7	-46.6	174.1	-171.7	110.3	-119.8	0	0	110.9	A17 I18 D23 K24 E25	A17-E21 WeakPolarHBondContact O-CB 3.5Å; A17-E21 PolarHBondContact O-N 3.01Å; I18-E21 PolarHBondContact O-N 3.43Å; E21-D23 PolarHBondContact O-N 3.08Å; E21-K24 WeakPolarHBondContact O-CB 3.44Å; E21-K24 PolarHBondContact O-N 3.4Å; E21-E25 WeakPolarHBondContact O-CB 3.37Å; E21-E25 PolarHBondContact O-N 3.27Å
22	L	92.3	Very high	82.8	Confident	107 Å²	107	107.9 Å²	107.9	56%	0.56	53%	0.532	S	S	*	.	H	α-helix	trans	-61.8	-40.6	177.7	-71.9	173	0	0	0	112.6	I18 L19 E25 K26	I18-L22 HydrophobicContact CG2-CD1 4.02Å; I18-L22 HydrophobicContact CG2-CG 4.44Å; I18-L22 VanDerWaalsContact O-CG 3.3Å; I18-L22 WeakPolarHBondContact O-CG 3.49Å; I18-L22 PolarHBondContact O-N 2.91Å; L19-L22 PolarHBondContact O-N 3Å; L22-E25 PolarHBondContact O-N 3.14Å; L22-K26 VanDerWaalsContact O-CB 3.3Å; L22-K26 WeakPolarHBondContact O-CB 3.47Å; L22-K26 PolarHBondContact O-N 2.98Å
23	D	89.3	Confident	82.1	Confident	87 Å²	87	109.2 Å²	109.2	47%	0.465	54%	0.536	S	S	.	.	H	α-helix	trans	-69.5	-32.1	176.9	-93.6	-16.5	0	0	0	113.1	L19 A20 E21 R27	L19-D23 PolarHBondContact O-N 3.42Å; A20-D23 PolarHBondContact O-N 3.45Å; E21-D23 PolarHBondContact O-N 3.08Å; D23-R27 PolarHBondContact O-N 3.4Å; D23-R27 VanDerWaalsContact O-N 3.14Å
24	K	91.9	Very high	81	Confident	144 Å²	144	106.4 Å²	106.4	63%	0.626	54%	0.536	S	S	*	.	H	α-helix	trans	-69	-45.5	173	-176.9	-175.9	175.1	-169.7	0	110.6	A20 E21 R27 R28	A20-K24 WeakPolarHBondContact O-CB 3.36Å; A20-K24 PolarHBondContact O-N 2.91Å; E21-K24 WeakPolarHBondContact O-CB 3.44Å; E21-K24 PolarHBondContact O-N 3.4Å; K24-R27 PolarHBondContact O-N 2.93Å; K24-R28 WeakPolarHBondContact O-CB 3.14Å; K24-R28 PolarHBondContact O-N 2.93Å
25	E	86.5	Confident	79.6	Confident	75 Å²	75	110.1 Å²	110.1	35%	0.35	55%	0.55	S	S	.	.	H	α-helix	trans	-64.2	-42.9	178.8	-168.1	55.6	-135.7	0	0	111.3	E21 L22 R27 R28 L29	E21-E25 WeakPolarHBondContact O-CB 3.37Å; E21-E25 PolarHBondContact O-N 3.27Å; L22-E25 PolarHBondContact O-N 3.14Å; E25-R27 PolarHBondContact O-N 3.37Å; E25-R28 WeakPolarHBondContact O-CB 3.26Å; E25-R28 PolarHBondContact O-N 2.82Å; E25-R28 IonicContact OE1-CZ 3.12Å; E25-R28 IonicContact OE1-NE 2.84Å; E25-R28 PolarHBondContact OE1-NE 3.5Å; E25-R28 IonicContact OE1-NH2 2.62Å; E25-R28 PolarHBondContact OE1-NH2 3.39Å; E25-R28 IonicContact OE2-NE 3.37Å; E25-R28 PolarHBondContact OE2-NE 2.99Å; E25-L29 HydrophobicContact CG-CD1 4.5Å; E25-L29 WeakPolarHBondContact O-CG 3.49Å; E25-L29 PolarHBondContact O-N 3.23Å
26	K	86.7	Confident	78	Confident	131 Å²	131	109 Å²	109	57%	0.57	56%	0.557	S	S	*	*	H	α-helix	trans	-57.5	-45.9	172.4	-179.3	-176.6	175.8	-177.2	0	112.1	L22 L29 L30	L22-K26 VanDerWaalsContact O-CB 3.3Å; L22-K26 WeakPolarHBondContact O-CB 3.47Å; L22-K26 PolarHBondContact O-N 2.98Å; K26-L29 PolarHBondContact O-N 3.27Å; K26-L30 PolarHBondContact O-N 3.01Å
27	R	86.5	Confident	75.9	Confident	175 Å²	175	107.4 Å²	107.4	66%	0.66	55%	0.549	S	S	*	.	H	α-helix	trans	-64.9	-40.8	176.1	-100.3	-178.7	-77.1	-170.5	-7.1	112.1	D23 K24 E25 L30 Q31	D23-R27 PolarHBondContact O-N 3.4Å; D23-R27 VanDerWaalsContact O-N 3.14Å; K24-R27 PolarHBondContact O-N 2.93Å; E25-R27 PolarHBondContact O-N 3.37Å; R27-L30 PolarHBondContact O-N 3.02Å; R27-Q31 VanDerWaalsContact O-CB 3.27Å; R27-Q31 WeakPolarHBondContact O-CB 3.39Å; R27-Q31 PolarHBondContact O-N 3.47Å
28	R	85.1	Confident	74	Confident	131 Å²	131	110.6 Å²	110.6	49%	0.494	57%	0.565	S	S	.	*	H	α-helix	trans	-60.4	-45.2	175.7	-168.3	-169	72.6	77.6	0.1	111.1	K24 E25 Q31 S32	K24-R28 WeakPolarHBondContact O-CB 3.14Å; K24-R28 PolarHBondContact O-N 2.93Å; E25-R28 WeakPolarHBondContact O-CB 3.26Å; E25-R28 PolarHBondContact O-N 2.82Å; E25-R28 IonicContact OE1-CZ 3.12Å; E25-R28 IonicContact OE1-NE 2.84Å; E25-R28 PolarHBondContact OE1-NE 3.5Å; E25-R28 IonicContact OE1-NH2 2.62Å; E25-R28 PolarHBondContact OE1-NH2 3.39Å; E25-R28 IonicContact OE2-NE 3.37Å; E25-R28 PolarHBondContact OE2-NE 2.99Å; R28-Q31 PolarHBondContact O-N 3.5Å; R28-S32 WeakPolarHBondContact O-CB 3.5Å; R28-S32 PolarHBondContact O-N 3.41Å; R28-S32 PolarHBondContact O-OG 3.41Å
29	L	79.5	Confident	71.8	Confident	91 Å²	91	108.9 Å²	108.9	48%	0.476	57%	0.57	S	S	.	*	H	α-helix	trans	-64.8	-41.7	177.2	-73.5	170.8	0	0	0	112.5	E25 K26 S32 Q33	E25-L29 HydrophobicContact CG-CD1 4.5Å; E25-L29 WeakPolarHBondContact O-CG 3.49Å; E25-L29 PolarHBondContact O-N 3.23Å; K26-L29 PolarHBondContact O-N 3.27Å; L29-S32 WeakPolarHBondContact CA-OG 3.39Å; L29-S32 PolarHBondContact O-OG 2.96Å; L29-Q33 PolarHBondContact O-N 2.96Å
30	L	77.5	Confident	70.3	Confident	124 Å²	124	109.6 Å²	109.6	65%	0.649	59%	0.589	S	S	*	*	H	α-helix	trans	-65	-41.7	174.9	-122.4	68.8	0	0	0	111.8	K26 R27 Q33 S34	K26-L30 PolarHBondContact O-N 3.01Å; R27-L30 PolarHBondContact O-N 3.02Å; L30-Q33 WeakPolarHBondContact O-CB 3.31Å; L30-Q33 PolarHBondContact O-N 3.3Å; L30-S34 PolarHBondContact O-N 3.3Å; L30-S34 VanDerWaalsContact O-N 3.14Å
31	Q	69.6	Low	68.4	Low	133 Å²	133	113.1 Å²	113.1	62%	0.621	60%	0.6	S	S	*	*	H	α-helix	trans	-72.4	-35.2	178.4	-168.7	173.8	61.8	0	0	112.1	R27 R28 Q33 S34 M35	R27-Q31 VanDerWaalsContact O-CB 3.27Å; R27-Q31 WeakPolarHBondContact O-CB 3.39Å; R27-Q31 PolarHBondContact O-N 3.47Å; R28-Q31 PolarHBondContact O-N 3.5Å; Q31-Q33 VanDerWaalsContact C-N 3.29Å; Q31-Q33 PolarHBondContact O-N 2.98Å; Q31-S34 WeakPolarHBondContact O-CA 3.49Å; Q31-S34 WeakPolarHBondContact O-CB 3.43Å; Q31-S34 PolarHBondContact O-N 3.23Å; Q31-M35 PolarHBondContact O-N 3.05Å
32	S	59.8	Low	66.7	Low	51 Å²	51	113.8 Å²	113.8	36%	0.357	61%	0.606	S	S	.	*	H	α-helix	trans	-67.4	-30.9	171.7	64.3	0	0	0	0	112	R28 L29 S34 M35 N36	R28-S32 WeakPolarHBondContact O-CB 3.5Å; R28-S32 PolarHBondContact O-N 3.41Å; R28-S32 PolarHBondContact O-OG 3.41Å; L29-S32 WeakPolarHBondContact CA-OG 3.39Å; L29-S32 PolarHBondContact O-OG 2.96Å; S32-S34 VanDerWaalsContact C-N 3.27Å; S32-S34 PolarHBondContact O-N 3.06Å; S32-M35 PolarHBondContact O-N 3.44Å; S32-N36 PolarHBondContact O-N 3.44Å; S32-N36 VanDerWaalsContact O-N 3.17Å
33	Q	55	Low	64.3	Low	121 Å²	121	114 Å²	114	57%	0.565	61%	0.614	S	S	*	*	H	α-helix	trans	-64.1	-33.4	167.3	-112.6	-109	84.7	0	0	111.5	L29 L30 Q31 M35 S37	L29-Q33 PolarHBondContact O-N 2.96Å; L30-Q33 WeakPolarHBondContact O-CB 3.31Å; L30-Q33 PolarHBondContact O-N 3.3Å; Q31-Q33 VanDerWaalsContact C-N 3.29Å; Q31-Q33 PolarHBondContact O-N 2.98Å; Q33-M35 VanDerWaalsContact C-N 3.35Å; Q33-M35 PolarHBondContact O-N 2.96Å; Q33-S37 WeakPolarHBondContact O-CB 3.48Å; Q33-S37 PolarHBondContact O-N 3.46Å; Q33-S37 PolarHBondContact OE1-OG 2.62Å
34	S	50.9	Low	62.6	Low	96 Å²	96	117 Å²	117	67%	0.671	63%	0.629	S	S	*	*	H	α-helix	trans	-74.3	-18	178.1	-167.1	0	0	0	0	114.8	L30 Q31 S32	L30-S34 PolarHBondContact O-N 3.3Å; L30-S34 VanDerWaalsContact O-N 3.14Å; Q31-S34 WeakPolarHBondContact O-CA 3.49Å; Q31-S34 WeakPolarHBondContact O-CB 3.43Å; Q31-S34 PolarHBondContact O-N 3.23Å; S32-S34 VanDerWaalsContact C-N 3.27Å; S32-S34 PolarHBondContact O-N 3.06Å
35	M	48.7	Very low	60.7	Low	154 Å²	154	115.7 Å²	115.7	76%	0.759	64%	0.638	S	S	*	*	H	α-helix	trans	-102.8	-9.7	174.2	-86.4	-165.3	-81.9	0	0	114.2	Q31 S32 Q33	Q31-M35 PolarHBondContact O-N 3.05Å; S32-M35 PolarHBondContact O-N 3.44Å; Q33-M35 VanDerWaalsContact C-N 3.35Å; Q33-M35 PolarHBondContact O-N 2.96Å
36	N	47	Very low	59.1	Low	150 Å²	150	115.1 Å²	115.1	80%	0.802	65%	0.652	S	S	*	*	H	α-helix	trans	-126.4	17.2	177.8	-80.8	51.8	0	0	0	114.3	S32	S32-N36 PolarHBondContact O-N 3.44Å; S32-N36 VanDerWaalsContact O-N 3.17Å
37	S	42.8	Very low	57.3	Low	49 Å²	49	119 Å²	119	34%	0.343	66%	0.663	S	S	.	*			trans	-133.7	116.6	176.5	-164.8	0	0	0	0	111.7	Q33 G39	Q33-S37 WeakPolarHBondContact O-CB 3.48Å; Q33-S37 PolarHBondContact O-N 3.46Å; Q33-S37 PolarHBondContact OE1-OG 2.62Å; S37-G39 PolarHBondContact O-N 3.37Å
38	P	45.1	Very low	55.8	Low	127 Å²	127	114.7 Å²	114.7	83%	0.825	66%	0.66	S	S	*	*			trans	-70	107.7	160.2	13.4	-1.1	0	0	0	108.3
39	G	43.3	Very low	54.4	Low	57 Å²	57	112.2 Å²	112.2	59%	0.588	66%	0.662	S	S	*	*			trans	63.3	98.9	146	0	0	0	0	0	117.7	S37 N41	S37-G39 PolarHBondContact O-N 3.37Å; G39-N41 PolarHBondContact O-N 2.84Å
40	A	57.8	Low	53.3	Low	106 Å²	106	113.9 Å²	113.9	88%	0.876	67%	0.671	S	S	*	*			trans	-88	87.9	152.7	0	0	0	0	0	109.8
41	N	51.3	Low	52.6	Low	133 Å²	133	114.4 Å²	114.4	71%	0.711	67%	0.668	S	S	*	*			trans	-156.7	105.9	156.4	40	-11	0	0	0	108.3	G39 P43	G39-N41 PolarHBondContact O-N 2.84Å; N41-P43 WeakPolarHBondContact O-CD 3.44Å
42	I	53.8	Low	52.3	Low	148 Å²	148	113.3 Å²	113.3	76%	0.759	66%	0.663	S	S	*	*			trans	-80	121.5	-178.3	-60.2	-173.9	0	0	0	109.5	L44	I42-L44 HydrophobicContact CG2-CD1 3.94Å
43	P	43	Very low	52.7	Low	111 Å²	111	113.8 Å²	113.8	72%	0.721	67%	0.67	S	S	*	*			trans	-95.3	132.9	136	30.4	-27.9	0	0	0	109.1	N41 S45	N41-P43 WeakPolarHBondContact O-CD 3.44Å; P43-S45 PolarHBondContact O-N 3.38Å
44	L	53.5	Low	53.4	Low	150 Å²	150	117.6 Å²	117.6	79%	0.785	68%	0.679	S	S	*	*	S	Bend	trans	-73	34.2	-169.7	-138.1	94.4	0	0	0	114.4	I42	I42-L44 HydrophobicContact CG2-CD1 3.94Å
45	S	51.8	Low	54.6	Low	116 Å²	116	116.4 Å²	116.4	81%	0.811	67%	0.666	S	S	*	*	S	Bend	trans	-140.1	81.7	-174	-57.4	0	0	0	0	110.7	P43	P43-S45 PolarHBondContact O-N 3.38Å
46	G	51.6	Low	56	Low	63 Å²	63	112.3 Å²	112.3	65%	0.649	65%	0.652	S	S	*	*			trans	154.2	30.6	173.4	0	0	0	0	0	117.4	S48	G46-S48 VanDerWaalsContact C-N 3.29Å; G46-S48 PolarHBondContact O-N 3.16Å
47	R	50.6	Low	57.7	Low	214 Å²	214	107.9 Å²	107.9	81%	0.808	64%	0.636	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.1	30.1	-170.7	-67.9	179.2	76.6	-174.3	4.9	116.1
48	S	54.8	Low	59.7	Low	83 Å²	83	111.3 Å²	111.3	58%	0.58	65%	0.647	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.2	-47.7	171.5	67.1	0	0	0	0	112	G46 L50 K51	G46-S48 VanDerWaalsContact C-N 3.29Å; G46-S48 PolarHBondContact O-N 3.16Å; S48-L50 PolarHBondContact O-N 2.77Å; S48-K51 PolarHBondContact O-N 2.92Å
49	S	54.8	Low	61.6	Low	79 Å²	79	111.1 Å²	111.1	55%	0.552	64%	0.635	S	S	*	*	H	α-helix	trans	-70.1	-26.5	-169.2	-170.7	0	0	0	0	115.7	E52 A53	S49-E52 WeakPolarHBondContact CA-OE2 3.49Å; S49-A53 PolarHBondContact O-N 3.49Å
50	L	57.6	Low	63.7	Low	127 Å²	127	115.2 Å²	115.2	67%	0.665	64%	0.638	S	S	*	*	H	α-helix	trans	-74.8	-24.8	179.8	-70.7	167.9	0	0	0	113.6	S48 R54	S48-L50 PolarHBondContact O-N 2.77Å; L50-R54 PolarHBondContact O-N 3.41Å
51	K	61.7	Low	65.2	Low	134 Å²	134	115.7 Å²	115.7	58%	0.583	62%	0.622	S	S	*	*	H	α-helix	trans	-72.1	-42.8	175.9	-177.3	171.1	179.5	-57.8	0	110.1	S48 A53 R54 D55	S48-K51 PolarHBondContact O-N 2.92Å; K51-A53 VanDerWaalsContact C-N 3.32Å; K51-A53 PolarHBondContact O-N 3.17Å; K51-R54 PolarHBondContact O-N 3.06Å; K51-D55 IonicContact NZ-OD2 2.77Å; K51-D55 PolarHBondContact NZ-OD2 3.46Å; K51-D55 WeakPolarHBondContact O-CB 3.44Å; K51-D55 PolarHBondContact O-N 3.24Å
52	E	63.4	Low	67.1	Low	110 Å²	110	111.6 Å²	111.6	51%	0.514	60%	0.6	S	S	.	*	H	α-helix	trans	-60	-39	176.8	-69.1	143.1	-157.4	0	0	112.6	S49 S56	S49-E52 WeakPolarHBondContact CA-OE2 3.49Å; E52-S56 VanDerWaalsContact O-CB 3.29Å; E52-S56 WeakPolarHBondContact O-CB 3.3Å; E52-S56 PolarHBondContact O-N 3.01Å; E52-S56 PolarHBondContact O-OG 3.13Å
53	A	67.6	Low	68.9	Low	61 Å²	61	107 Å²	107	50%	0.504	58%	0.584	S	S	.	*	H	α-helix	trans	-67.5	-37.9	177.7	0	0	0	0	0	113.2	S49 K51 A57	S49-A53 PolarHBondContact O-N 3.49Å; K51-A53 VanDerWaalsContact C-N 3.32Å; K51-A53 PolarHBondContact O-N 3.17Å; A53-A57 PolarHBondContact O-N 3.2Å
54	R	69.9	Low	71.4	Confident	202 Å²	202	104.4 Å²	104.4	76%	0.762	57%	0.572	S	S	*	*	H	α-helix	trans	-70.9	-45.9	175.6	-75.7	-166.8	177.5	-168.9	-0.4	111.9	L50 K51 S56 A57 E58	L50-R54 PolarHBondContact O-N 3.41Å; K51-R54 PolarHBondContact O-N 3.06Å; R54-S56 PolarHBondContact O-N 3Å; R54-A57 PolarHBondContact O-N 3.33Å; R54-A57 VanDerWaalsContact O-N 3.13Å; R54-E58 PolarHBondContact O-N 2.95Å
55	D	77.3	Confident	73.4	Confident	71 Å²	71	101 Å²	101	38%	0.38	55%	0.552	S	S	.	*	H	α-helix	trans	-60.1	-36.6	177.3	-65.4	0.3	0	0	0	109.9	K51 Q59	K51-D55 IonicContact NZ-OD2 2.77Å; K51-D55 PolarHBondContact NZ-OD2 3.46Å; K51-D55 WeakPolarHBondContact O-CB 3.44Å; K51-D55 PolarHBondContact O-N 3.24Å; D55-Q59 WeakPolarHBondContact O-CB 3.33Å; D55-Q59 PolarHBondContact O-N 2.7Å
56	S	77.9	Confident	75.6	Confident	68 Å²	68	96.6 Å²	96.6	48%	0.476	52%	0.519	S	S	.	.	H	α-helix	trans	-65.2	-41.7	174.8	-62.1	0	0	0	0	113.2	E52 R54 Q59 Q60	E52-S56 VanDerWaalsContact O-CB 3.29Å; E52-S56 WeakPolarHBondContact O-CB 3.3Å; E52-S56 PolarHBondContact O-N 3.01Å; E52-S56 PolarHBondContact O-OG 3.13Å; R54-S56 PolarHBondContact O-N 3Å; S56-Q59 PolarHBondContact O-N 3.36Å; S56-Q60 WeakPolarHBondContact O-CB 3.45Å; S56-Q60 VanDerWaalsContact O-CG 3.3Å; S56-Q60 WeakPolarHBondContact O-CG 3.47Å; S56-Q60 PolarHBondContact O-N 3.36Å
57	A	81.9	Confident	77.8	Confident	56 Å²	56	99.9 Å²	99.9	46%	0.463	52%	0.515	S	S	.	.	H	α-helix	trans	-67.5	-39.5	179.1	0	0	0	0	0	112	A53 R54 Q60 H61	A53-A57 PolarHBondContact O-N 3.2Å; R54-A57 PolarHBondContact O-N 3.33Å; R54-A57 VanDerWaalsContact O-N 3.13Å; A57-Q60 PolarHBondContact O-N 2.93Å; A57-H61 PolarHBondContact O-N 2.97Å
58	E	84.9	Confident	80	Confident	121 Å²	121	92.4 Å²	92.4	57%	0.565	50%	0.499	S	S	*	.	H	α-helix	trans	-63.6	-47.6	173.5	-178.9	177.1	-161.4	0	0	111.3	R54 Q60 H61 I62	R54-E58 PolarHBondContact O-N 2.95Å; E58-Q60 VanDerWaalsContact C-N 3.26Å; E58-Q60 PolarHBondContact O-N 3.22Å; E58-H61 WeakPolarHBondContact O-CB 3.35Å; E58-H61 PolarHBondContact O-N 2.94Å; E58-I62 HydrophobicContact CG-CD1 3.94Å; E58-I62 WeakPolarHBondContact O-CG1 3.29Å; E58-I62 PolarHBondContact O-N 3.49Å
59	Q	85	Confident	82.1	Confident	123 Å²	123	89.7 Å²	89.7	58%	0.575	48%	0.482	S	S	*	.	H	α-helix	trans	-57.6	-40.9	177	-170.1	68	57.4	0	0	111.8	D55 S56 A63	D55-Q59 WeakPolarHBondContact O-CB 3.33Å; D55-Q59 PolarHBondContact O-N 2.7Å; S56-Q59 PolarHBondContact O-N 3.36Å; Q59-A63 VanDerWaalsContact O-CB 3.31Å; Q59-A63 WeakPolarHBondContact O-CB 3.45Å; Q59-A63 PolarHBondContact O-N 3.4Å
60	Q	87.8	Confident	84.2	Confident	143 Å²	143	87.8 Å²	87.8	67%	0.668	47%	0.465	S	S	*	.	H	α-helix	trans	-64.5	-41.1	175.4	-77.3	-175.5	-19.3	0	0	112.5	S56 A57 E58 A63 A64	S56-Q60 WeakPolarHBondContact O-CB 3.45Å; S56-Q60 VanDerWaalsContact O-CG 3.3Å; S56-Q60 WeakPolarHBondContact O-CG 3.47Å; S56-Q60 PolarHBondContact O-N 3.36Å; A57-Q60 PolarHBondContact O-N 2.93Å; E58-Q60 VanDerWaalsContact C-N 3.26Å; E58-Q60 PolarHBondContact O-N 3.22Å; Q60-A63 PolarHBondContact O-N 3.43Å; Q60-A64 WeakPolarHBondContact O-CB 3.44Å; Q60-A64 PolarHBondContact O-N 3.04Å
61	H	88.6	Confident	86.1	Confident	116 Å²	116	86.9 Å²	86.9	54%	0.537	46%	0.457	S	S	.	.	H	α-helix	trans	-64.1	-46.5	177.9	-174.4	57.9	0	0	0	111.6	A57 E58 A63 A64 Q65	A57-H61 PolarHBondContact O-N 2.97Å; E58-H61 WeakPolarHBondContact O-CB 3.35Å; E58-H61 PolarHBondContact O-N 2.94Å; H61-A63 VanDerWaalsContact C-N 3.35Å; H61-A63 PolarHBondContact O-N 3.34Å; H61-A64 PolarHBondContact O-N 3.32Å; H61-Q65 PolarHBondContact CD2-NE2 3.42Å; H61-Q65 PolarHBondContact CE1-NE2 3.43Å; H61-Q65 PolarHBondContact NE2-NE2 3.22Å; H61-Q65 WeakPolarHBondContact O-CG 3.28Å; H61-Q65 PolarHBondContact O-N 3.21Å
62	I	90.9	Very high	87.9	Confident	47 Å²	47	86.3 Å²	86.3	24%	0.241	46%	0.457	C	S	.	.	H	α-helix	trans	-59.6	-46.6	176.6	-68.8	170.3	0	0	0	110.4	E58 A64 Q65 Q66 D85	E58-I62 HydrophobicContact CG-CD1 3.94Å; E58-I62 WeakPolarHBondContact O-CG1 3.29Å; E58-I62 PolarHBondContact O-N 3.49Å; I62-A64 VanDerWaalsContact C-N 3.32Å; I62-A64 PolarHBondContact O-N 2.95Å; I62-Q65 PolarHBondContact O-N 3.45Å; I62-Q66 WeakPolarHBondContact O-CB 3.34Å; I62-Q66 WeakPolarHBondContact O-CG 3.45Å; I62-Q66 PolarHBondContact O-N 2.87Å; I62-D85 HydrophobicContact CG2-CB 4.45Å
63	A	93.3	Very high	89.5	Confident	51 Å²	51	81.5 Å²	81.5	42%	0.421	44%	0.436	S	S	.	.	H	α-helix	trans	-61.5	-39.4	177.7	0	0	0	0	0	112.5	Q59 Q60 H61 K67	Q59-A63 VanDerWaalsContact O-CB 3.31Å; Q59-A63 WeakPolarHBondContact O-CB 3.45Å; Q59-A63 PolarHBondContact O-N 3.4Å; Q60-A63 PolarHBondContact O-N 3.43Å; H61-A63 VanDerWaalsContact C-N 3.35Å; H61-A63 PolarHBondContact O-N 3.34Å; A63-K67 WeakPolarHBondContact O-CB 3.46Å; A63-K67 PolarHBondContact O-N 3.44Å
64	A	95.1	Very high	91	Very high	57 Å²	57	84 Å²	84	47%	0.471	44%	0.436	S	S	.	.	H	α-helix	trans	-64.7	-43.1	176.6	0	0	0	0	0	112.1	Q60 H61 I62 K67 A68	Q60-A64 WeakPolarHBondContact O-CB 3.44Å; Q60-A64 PolarHBondContact O-N 3.04Å; H61-A64 PolarHBondContact O-N 3.32Å; I62-A64 VanDerWaalsContact C-N 3.32Å; I62-A64 PolarHBondContact O-N 2.95Å; A64-K67 PolarHBondContact O-N 3.26Å; A64-A68 PolarHBondContact O-N 3.14Å
65	Q	95.8	Very high	92.3	Very high	78 Å²	78	79.7 Å²	79.7	36%	0.364	43%	0.433	S	S	.	.	H	α-helix	trans	-63.1	-47.5	176.6	-69.9	-174.3	7.1	0	0	111.9	H61 I62 K67 A68 A69 L91	H61-Q65 PolarHBondContact CD2-NE2 3.42Å; H61-Q65 PolarHBondContact CE1-NE2 3.43Å; H61-Q65 PolarHBondContact NE2-NE2 3.22Å; H61-Q65 WeakPolarHBondContact O-CG 3.28Å; H61-Q65 PolarHBondContact O-N 3.21Å; I62-Q65 PolarHBondContact O-N 3.45Å; Q65-K67 VanDerWaalsContact C-N 3.31Å; Q65-K67 PolarHBondContact O-N 2.88Å; Q65-A68 PolarHBondContact O-N 2.88Å; Q65-A69 WeakPolarHBondContact O-CB 3.48Å; Q65-A69 PolarHBondContact O-N 2.99Å; Q65-L91 HydrophobicContact CB-CD1 4.06Å
66	Q	97	Very high	93.3	Very high	25 Å²	25	82.8 Å²	82.8	12%	0.117	44%	0.444	C	S	.	.	H	α-helix	trans	-55.8	-45.7	175.6	-78	-177.4	41.8	0	0	111.6	I62 A69 L70 T83 Q84 L91	I62-Q66 WeakPolarHBondContact O-CB 3.34Å; I62-Q66 WeakPolarHBondContact O-CG 3.45Å; I62-Q66 PolarHBondContact O-N 2.87Å; Q66-A69 PolarHBondContact O-N 3.44Å; Q66-L70 WeakPolarHBondContact O-CB 3.36Å; Q66-L70 PolarHBondContact O-N 2.87Å; Q66-T83 HydrophobicContact CB-CG2 3.8Å; Q66-T83 PolarHBondContact OE1-OG1 3.25Å; Q66-Q84 WeakPolarHBondContact CG-O 3.27Å; Q66-Q84 PolarHBondContact NE2-O 3.31Å; Q66-L91 HydrophobicContact CG-CD2 4.47Å
67	K	97.7	Very high	94.3	Very high	132 Å²	132	82 Å²	82	57%	0.574	44%	0.439	S	S	*	.	H	α-helix	trans	-62.1	-46.4	177.7	-178.1	175.3	-179.5	176.5	0	112.3	A63 A64 Q65 L70 Q71	A63-K67 WeakPolarHBondContact O-CB 3.46Å; A63-K67 PolarHBondContact O-N 3.44Å; A64-K67 PolarHBondContact O-N 3.26Å; Q65-K67 VanDerWaalsContact C-N 3.31Å; Q65-K67 PolarHBondContact O-N 2.88Å; K67-L70 PolarHBondContact O-N 2.85Å; K67-Q71 WeakPolarHBondContact O-CB 3.44Å; K67-Q71 VanDerWaalsContact O-CG 3.29Å; K67-Q71 WeakPolarHBondContact O-CG 3.48Å; K67-Q71 PolarHBondContact O-N 3.34Å
68	A	98.1	Very high	95	Very high	57 Å²	57	85.2 Å²	85.2	47%	0.471	46%	0.458	S	S	.	.	H	α-helix	trans	-62.4	-44.2	179.4	0	0	0	0	0	111.8	A64 Q65 Q71 H72	A64-A68 PolarHBondContact O-N 3.14Å; Q65-A68 PolarHBondContact O-N 2.88Å; A68-Q71 PolarHBondContact O-N 2.97Å; A68-H72 WeakPolarHBondContact O-CB 3.41Å; A68-H72 PolarHBondContact O-N 2.99Å
69	A	97.8	Very high	95.6	Very high	26 Å²	26	81 Å²	81	22%	0.215	45%	0.447	C	S	.	.	H	α-helix	trans	-61.8	-45.9	177.6	0	0	0	0	0	111.9	Q65 Q66 H72 A73 L91 I92	Q65-A69 WeakPolarHBondContact O-CB 3.48Å; Q65-A69 PolarHBondContact O-N 2.99Å; Q66-A69 PolarHBondContact O-N 3.44Å; A69-H72 PolarHBondContact O-N 3.45Å; A69-A73 PolarHBondContact O-N 3.18Å; A69-L91 HydrophobicContact CB-CB 4.05Å; A69-L91 HydrophobicContact CB-CD1 4.38Å; A69-I92 HydrophobicContact CB-CG2 3.92Å
70	L	98.3	Very high	96.3	Very high	38 Å²	38	81 Å²	81	20%	0.199	45%	0.445	C	S	.	.	H	α-helix	trans	-64.2	-42.4	178.7	-173.3	67.2	0	0	0	112.1	Q66 K67 A73 H74 F81 T83 I92	Q66-L70 WeakPolarHBondContact O-CB 3.36Å; Q66-L70 PolarHBondContact O-N 2.87Å; K67-L70 PolarHBondContact O-N 2.85Å; L70-A73 PolarHBondContact O-N 3.34Å; L70-H74 PolarHBondContact O-N 3.31Å; L70-H74 PolarHBondContact O-ND1 3.36Å; L70-F81 HydrophobicContact CD1-CB 3.51Å; L70-F81 WeakPolarHBondContact CD1-O 3.42Å; L70-T83 HydrophobicContact CB-CG2 3.96Å; L70-T83 HydrophobicContact CD2-CG2 3.93Å; L70-T83 HydrophobicContact CG-CG2 4.4Å; L70-I92 HydrophobicContact CB-CG2 3.99Å; L70-I92 HydrophobicContact CD1-CG2 4.21Å
71	Q	98.3	Very high	96.7	Very high	108 Å²	108	76.4 Å²	76.4	51%	0.505	42%	0.423	S	S	.	.	H	α-helix	trans	-61.3	-44.8	176	-75.6	-178.9	-9.8	0	0	112.1	K67 A68 A73 H74 V75	K67-Q71 WeakPolarHBondContact O-CB 3.44Å; K67-Q71 VanDerWaalsContact O-CG 3.29Å; K67-Q71 WeakPolarHBondContact O-CG 3.48Å; K67-Q71 PolarHBondContact O-N 3.34Å; A68-Q71 PolarHBondContact O-N 2.97Å; Q71-A73 VanDerWaalsContact C-N 3.31Å; Q71-A73 PolarHBondContact O-N 3.49Å; Q71-H74 PolarHBondContact O-N 3.14Å; Q71-V75 WeakPolarHBondContact O-CG2 3.4Å; Q71-V75 PolarHBondContact O-N 3.22Å
72	H	98.5	Very high	97.2	Very high	122 Å²	122	73.3 Å²	73.3	57%	0.565	41%	0.41	S	S	*	.	H	α-helix	trans	-60.4	-42.5	176.3	-175.8	-85.8	0	0	0	111.4	A68 A69 H74 V75 H76	A68-H72 WeakPolarHBondContact O-CB 3.41Å; A68-H72 PolarHBondContact O-N 2.99Å; A69-H72 PolarHBondContact O-N 3.45Å; H72-H74 PolarHBondContact O-N 3.23Å; H72-V75 PolarHBondContact O-N 3.27Å; H72-H76 AromaticContact CD2-CD2 3.64Å; H72-H76 AromaticContact CD2-NE2 3.93Å; H72-H76 AromaticContact CE1-CD2 3.47Å; H72-H76 PolarHBondContact CE1-CD2 3.44Å; H72-H76 VanDerWaalsContact CE1-CD2 3.47Å; H72-H76 AromaticContact CG-CD2 3.88Å; H72-H76 AromaticContact ND1-CD2 3.77Å; H72-H76 AromaticContact NE2-CD2 3.4Å; H72-H76 PolarHBondContact NE2-CD2 2.89Å; H72-H76 AromaticContact NE2-NE2 3.67Å; H72-H76 PolarHBondContact O-CD2 3.05Å; H72-H76 VanDerWaalsContact O-CD2 3.24Å; H72-H76 PolarHBondContact O-N 2.77Å; H72-H76 VanDerWaalsContact O-N 3.13Å
73	A	98.2	Very high	97.5	Very high	9 Å²	9	73.9 Å²	73.9	7%	0.074	42%	0.416	C	S	.	.	H	α-helix	trans	-61.4	-42.9	176.1	0	0	0	0	0	112.6	A69 L70 Q71 V75 H76 S77 F81 I92	A69-A73 PolarHBondContact O-N 3.18Å; L70-A73 PolarHBondContact O-N 3.34Å; Q71-A73 VanDerWaalsContact C-N 3.31Å; Q71-A73 PolarHBondContact O-N 3.49Å; A73-V75 VanDerWaalsContact C-N 3.27Å; A73-V75 PolarHBondContact O-N 3.31Å; A73-H76 PolarHBondContact O-N 3.35Å; A73-S77 WeakPolarHBondContact O-CA 3.34Å; A73-S77 VanDerWaalsContact O-CB 3.27Å; A73-S77 WeakPolarHBondContact O-CB 3.27Å; A73-S77 PolarHBondContact O-N 2.96Å; A73-F81 HydrophobicContact CB-CD2 3.84Å; A73-F81 HydrophobicContact CB-CE2 4.05Å; A73-F81 HydrophobicContact CB-CG 4.13Å; A73-I92 HydrophobicContact CB-CD1 3.5Å; A73-I92 VanDerWaalsContact CB-CD1 3.5Å
74	H	98.1	Very high	97.6	Very high	113 Å²	113	74.8 Å²	74.8	52%	0.523	41%	0.411	S	S	.	.	H	α-helix	trans	-62.4	-30.7	176.6	-67.4	152.1	0	0	0	113.9	L70 Q71 H72	L70-H74 PolarHBondContact O-N 3.31Å; L70-H74 PolarHBondContact O-ND1 3.36Å; Q71-H74 PolarHBondContact O-N 3.14Å; H72-H74 PolarHBondContact O-N 3.23Å
75	V	98.5	Very high	97.4	Very high	112 Å²	112	77.9 Å²	77.9	68%	0.679	42%	0.42	S	S	*	.	H	α-helix	trans	-78	-34.3	178.7	174.3	0	0	0	0	111.6	Q71 H72 A73	Q71-V75 WeakPolarHBondContact O-CG2 3.4Å; Q71-V75 PolarHBondContact O-N 3.22Å; H72-V75 PolarHBondContact O-N 3.27Å; A73-V75 VanDerWaalsContact C-N 3.27Å; A73-V75 PolarHBondContact O-N 3.31Å
76	H	98.6	Very high	97.3	Very high	136 Å²	136	75 Å²	75	63%	0.63	41%	0.409	S	S	*	.	H	α-helix	trans	-110.5	-5.6	-169.7	-65.8	-67.9	0	0	0	114.7	H72 A73	H72-H76 AromaticContact CD2-CD2 3.64Å; H72-H76 AromaticContact CD2-NE2 3.93Å; H72-H76 AromaticContact CE1-CD2 3.47Å; H72-H76 PolarHBondContact CE1-CD2 3.44Å; H72-H76 VanDerWaalsContact CE1-CD2 3.47Å; H72-H76 AromaticContact CG-CD2 3.88Å; H72-H76 AromaticContact ND1-CD2 3.77Å; H72-H76 AromaticContact NE2-CD2 3.4Å; H72-H76 PolarHBondContact NE2-CD2 2.89Å; H72-H76 AromaticContact NE2-NE2 3.67Å; H72-H76 PolarHBondContact O-CD2 3.05Å; H72-H76 VanDerWaalsContact O-CD2 3.24Å; H72-H76 PolarHBondContact O-N 2.77Å; H72-H76 VanDerWaalsContact O-N 3.13Å; A73-H76 PolarHBondContact O-N 3.35Å
77	S	97.9	Very high	97.1	Very high	53 Å²	53	79.3 Å²	79.3	37%	0.371	44%	0.441	S	S	.	.			trans	-141.2	144.9	-177.5	-171.3	0	0	0	0	111.1	A73 G79	A73-S77 WeakPolarHBondContact O-CA 3.34Å; A73-S77 VanDerWaalsContact O-CB 3.27Å; A73-S77 WeakPolarHBondContact O-CB 3.27Å; A73-S77 PolarHBondContact O-N 2.96Å; S77-G79 VanDerWaalsContact C-N 3.32Å; S77-G79 PolarHBondContact OG-N 3.37Å
78	S	97.4	Very high	97.1	Very high	123 Å²	123	81.9 Å²	81.9	86%	0.86	45%	0.453	S	S	*	.			trans	-90.7	5.9	171.5	61.2	0	0	0	0	113.1
79	G	97.8	Very high	96.9	Very high	31 Å²	31	82.2 Å²	82.2	32%	0.32	46%	0.462	S	S	.	.	S	Bend	trans	-74.4	161.9	178	0	0	0	0	0	112.9	S77 F81	S77-G79 VanDerWaalsContact C-N 3.32Å; S77-G79 PolarHBondContact OG-N 3.37Å; G79-F81 VanDerWaalsContact O-CD2 3.25Å; G79-F81 WeakPolarHBondContact O-CD2 3.26Å; G79-F81 WeakPolarHBondContact O-CE2 3.23Å
80	F	98	Very high	96.9	Very high	124 Å²	124	85 Å²	85	54%	0.544	47%	0.473	S	S	.	.			trans	-93.6	125.3	172.7	-68.5	-95.4	0	0	0	109.3	P94 V95 P97	F80-P94 WeakPolarHBondContact O-CA 3.37Å; F80-V95 WeakPolarHBondContact CB-O 3.11Å; F80-V95 PolarHBondContact O-N 2.84Å; F80-P97 HydrophobicContact CD1-CB 4.07Å; F80-P97 HydrophobicContact CD1-CG 4.06Å; F80-P97 HydrophobicContact CD2-CG 3.62Å; F80-P97 HydrophobicContact CE1-CB 3.99Å; F80-P97 HydrophobicContact CE1-CG 3.98Å; F80-P97 HydrophobicContact CE2-CB 4.44Å; F80-P97 HydrophobicContact CE2-CG 3.55Å; F80-P97 HydrophobicContact CG-CB 4.33Å; F80-P97 HydrophobicContact CG-CG 3.88Å; F80-P97 HydrophobicContact CZ-CB 4.18Å; F80-P97 HydrophobicContact CZ-CG 3.73Å
81	F	97.9	Very high	96.8	Very high	46 Å²	46	85.1 Å²	85.1	20%	0.202	47%	0.474	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127	146.9	-176	-63.3	-87.4	0	0	0	110.9	L70 A73 G79 I92 L93 P94	L70-F81 HydrophobicContact CD1-CB 3.51Å; L70-F81 WeakPolarHBondContact CD1-O 3.42Å; A73-F81 HydrophobicContact CB-CD2 3.84Å; A73-F81 HydrophobicContact CB-CE2 4.05Å; A73-F81 HydrophobicContact CB-CG 4.13Å; G79-F81 VanDerWaalsContact O-CD2 3.25Å; G79-F81 WeakPolarHBondContact O-CD2 3.26Å; G79-F81 WeakPolarHBondContact O-CE2 3.23Å; F81-I92 HydrophobicContact CD1-CD1 3.95Å; F81-I92 HydrophobicContact CD1-CG1 4.35Å; F81-I92 HydrophobicContact CE1-CD1 4.42Å; F81-I92 HydrophobicContact CG-CD1 4.33Å; F81-L93 WeakPolarHBondContact CA-O 2.97Å; F81-P94 HydrophobicContact CD1-CB 4.22Å; F81-P94 HydrophobicContact CE1-CB 3.94Å
82	I	97.3	Very high	96.8	Very high	52 Å²	52	81.9 Å²	81.9	27%	0.267	46%	0.459	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.4	157.2	167.8	57.6	169.6	0	0	0	109.3	I92 L93 V95	I82-I92 CarbonylContact O-C 3.51Å; I82-I92 WeakPolarHBondContact O-CA 3.3Å; I82-I92 WeakPolarHBondContact O-CB 3.07Å; I82-L93 HydrophobicContact CG1-CB 4.3Å; I82-L93 PolarHBondContact N-O 3.03Å; I82-L93 VanDerWaalsContact N-O 3.08Å; I82-L93 PolarHBondContact O-N 3.07Å; I82-V95 HydrophobicContact CD1-CG1 3.77Å; I82-V95 HydrophobicContact CG1-CG1 3.79Å; I82-V95 HydrophobicContact CG1-CG2 4.23Å; I82-V95 HydrophobicContact CG2-CG2 3.85Å
83	T	97.7	Very high	96.8	Very high	58 Å²	58	79 Å²	79	36%	0.356	45%	0.448	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.3	156.3	174.3	65.2	0	0	0	0	111.8	Q66 L70 L91 I92	Q66-T83 HydrophobicContact CB-CG2 3.8Å; Q66-T83 PolarHBondContact OE1-OG1 3.25Å; L70-T83 HydrophobicContact CB-CG2 3.96Å; L70-T83 HydrophobicContact CD2-CG2 3.93Å; L70-T83 HydrophobicContact CG-CG2 4.4Å; T83-L91 WeakPolarHBondContact CA-O 3.45Å; T83-I92 HydrophobicContact CG2-CG2 4.41Å
84	Q	95.7	Very high	96.8	Very high	70 Å²	70	83 Å²	83	33%	0.327	47%	0.474	S	S	.	.			trans	-142.7	145.5	174	-165.4	-170.3	0.3	0	0	109.7	Q66 S86 N90 L91	Q66-Q84 WeakPolarHBondContact CG-O 3.27Å; Q66-Q84 PolarHBondContact NE2-O 3.31Å; Q84-S86 PolarHBondContact O-N 3.45Å; Q84-N90 WeakPolarHBondContact CB-O 3.46Å; Q84-N90 PolarHBondContact OE1-O 3.47Å; Q84-L91 PolarHBondContact N-O 3.39Å
85	D	91.6	Very high	96.8	Very high	123 Å²	123	80.1 Å²	80.1	66%	0.658	46%	0.463	S	S	*	.			trans	-80.1	57.7	172.3	60.2	-21.6	0	0	0	111.9	I62	I62-D85 HydrophobicContact CG2-CB 4.45Å
86	S	94	Very high	96.7	Very high	18 Å²	18	82 Å²	82	13%	0.126	47%	0.469	C	S	.	.			trans	-92.8	125.3	179.8	-171.4	0	0	0	0	113	Q84 F88 N90	Q84-S86 PolarHBondContact O-N 3.45Å; S86-F88 PolarHBondContact O-N 2.95Å; S86-F88 PolarHBondContact OG-N 2.93Å; S86-N90 VanDerWaalsContact CB-O 3.26Å; S86-N90 WeakPolarHBondContact CB-O 3.3Å
87	S	92.8	Very high	96.6	Very high	114 Å²	114	78.6 Å²	78.6	80%	0.797	46%	0.459	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.7	-0.3	170.7	-52.2	0	0	0	0	114.2
88	F	96	Very high	96.2	Very high	186 Å²	186	84.6 Å²	84.6	82%	0.816	47%	0.473	S	S	*	.	T	Hydrogen-bonded Turn	trans	-114.1	22.5	-174.8	-58.2	-76.5	0	0	0	113	S86	S86-F88 PolarHBondContact O-N 2.95Å; S86-F88 PolarHBondContact OG-N 2.93Å
89	G	95.1	Very high	95.9	Very high	65 Å²	65	86.4 Å²	86.4	67%	0.67	47%	0.473	S	S	*	.	S	Bend	trans	85.8	2.4	175.6	0	0	0	0	0	115.3	L91	G89-L91 PolarHBondContact O-N 3Å; G89-L91 VanDerWaalsContact O-N 3.14Å
90	N	97.2	Very high	95.4	Very high	85 Å²	85	92.5 Å²	92.5	46%	0.455	49%	0.493	S	S	.	.			trans	-88.3	53.9	173.7	-58.2	-50.1	0	0	0	111.1	Q84 S86 I92 L93	Q84-N90 WeakPolarHBondContact CB-O 3.46Å; Q84-N90 PolarHBondContact OE1-O 3.47Å; S86-N90 VanDerWaalsContact CB-O 3.26Å; S86-N90 WeakPolarHBondContact CB-O 3.3Å; N90-I92 PolarHBondContact O-N 3.42Å; N90-L93 HydrophobicContact CB-CD2 4.25Å
91	L	97.3	Very high	94.6	Very high	39 Å²	39	92.1 Å²	92.1	20%	0.204	50%	0.503	C	S	.	.	S	Bend	trans	-64.6	-22.8	-177.3	-66	176.2	0	0	0	113	Q65 Q66 A69 T83 Q84 G89	Q65-L91 HydrophobicContact CB-CD1 4.06Å; Q66-L91 HydrophobicContact CG-CD2 4.47Å; A69-L91 HydrophobicContact CB-CB 4.05Å; A69-L91 HydrophobicContact CB-CD1 4.38Å; T83-L91 WeakPolarHBondContact CA-O 3.45Å; Q84-L91 PolarHBondContact N-O 3.39Å; G89-L91 PolarHBondContact O-N 3Å; G89-L91 VanDerWaalsContact O-N 3.14Å
92	I	98.3	Very high	93.2	Very high	40 Å²	40	101.3 Å²	101.3	21%	0.205	55%	0.554	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-134.9	149.2	172.5	59.7	174.6	0	0	0	110.4	A69 L70 A73 F81 I82 T83 N90	A69-I92 HydrophobicContact CB-CG2 3.92Å; L70-I92 HydrophobicContact CB-CG2 3.99Å; L70-I92 HydrophobicContact CD1-CG2 4.21Å; A73-I92 HydrophobicContact CB-CD1 3.5Å; A73-I92 VanDerWaalsContact CB-CD1 3.5Å; F81-I92 HydrophobicContact CD1-CD1 3.95Å; F81-I92 HydrophobicContact CD1-CG1 4.35Å; F81-I92 HydrophobicContact CE1-CD1 4.42Å; F81-I92 HydrophobicContact CG-CD1 4.33Å; I82-I92 CarbonylContact O-C 3.51Å; I82-I92 WeakPolarHBondContact O-CA 3.3Å; I82-I92 WeakPolarHBondContact O-CB 3.07Å; T83-I92 HydrophobicContact CG2-CG2 4.41Å; N90-I92 PolarHBondContact O-N 3.42Å
93	L	97.9	Very high	93	Very high	61 Å²	61	103.8 Å²	103.8	32%	0.319	57%	0.569	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-124.1	134.5	175.9	-68.3	179.6	0	0	0	110.9	F81 I82 N90	F81-L93 WeakPolarHBondContact CA-O 2.97Å; I82-L93 HydrophobicContact CG1-CB 4.3Å; I82-L93 PolarHBondContact N-O 3.03Å; I82-L93 VanDerWaalsContact N-O 3.08Å; I82-L93 PolarHBondContact O-N 3.07Å; N90-L93 HydrophobicContact CB-CD2 4.25Å
94	P	97.8	Very high	92.8	Very high	95 Å²	95	106.2 Å²	106.2	62%	0.617	58%	0.58	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-69.5	133.7	169.3	29.9	-32.8	0	0	0	109.8	F80 F81	F80-P94 WeakPolarHBondContact O-CA 3.37Å; F81-P94 HydrophobicContact CD1-CB 4.22Å; F81-P94 HydrophobicContact CE1-CB 3.94Å
95	V	97.8	Very high	92.6	Very high	51 Å²	51	108.2 Å²	108.2	31%	0.309	59%	0.594	S	S	.	*			trans	-139.2	169.4	-178.4	-65.7	0	0	0	0	111.1	F80 I82	F80-V95 WeakPolarHBondContact CB-O 3.11Å; F80-V95 PolarHBondContact O-N 2.84Å; I82-V95 HydrophobicContact CD1-CG1 3.77Å; I82-V95 HydrophobicContact CG1-CG1 3.79Å; I82-V95 HydrophobicContact CG1-CG2 4.23Å; I82-V95 HydrophobicContact CG2-CG2 3.85Å
96	L	97.3	Very high	92.7	Very high	151 Å²	151	107.4 Å²	107.4	79%	0.791	59%	0.59	S	S	*	*	P	Polyproline II helix	trans	-72.8	150.6	165.9	-62.5	177.6	0	0	0	110.2	R98	L96-R98 PolarHBondContact O-N 3.5Å
97	P	95.4	Very high	92.6	Very high	65 Å²	65	112.9 Å²	112.9	42%	0.422	62%	0.619	S	S	.	*	P	Polyproline II helix	trans	-53.5	134.3	174.1	-21.9	30.1	0	0	0	111.5	F80	F80-P97 HydrophobicContact CD1-CB 4.07Å; F80-P97 HydrophobicContact CD1-CG 4.06Å; F80-P97 HydrophobicContact CD2-CG 3.62Å; F80-P97 HydrophobicContact CE1-CB 3.99Å; F80-P97 HydrophobicContact CE1-CG 3.98Å; F80-P97 HydrophobicContact CE2-CB 4.44Å; F80-P97 HydrophobicContact CE2-CG 3.55Å; F80-P97 HydrophobicContact CG-CB 4.33Å; F80-P97 HydrophobicContact CG-CG 3.88Å; F80-P97 HydrophobicContact CZ-CB 4.18Å; F80-P97 HydrophobicContact CZ-CG 3.73Å
98	R	91	Very high	92.6	Very high	179 Å²	179	112.9 Å²	112.9	68%	0.675	61%	0.607	S	S	*	*	P	Polyproline II helix	trans	-89.5	127	169.7	-62.5	-176.9	-177.3	-167.2	0.7	108.2	L96	L96-R98 PolarHBondContact O-N 3.5Å
99	L	90.8	Very high	92.4	Very high	162 Å²	162	107.6 Å²	107.6	85%	0.848	59%	0.592	S	S	*	*	P	Polyproline II helix	trans	-99.4	121.8	171.6	-56.4	176.8	0	0	0	106.6
100	E	85.9	Confident	92.2	Very high	158 Å²	158	110.9 Å²	110.9	74%	0.738	59%	0.586	S	S	*	*	P	Polyproline II helix	trans	-70.8	136.2	171	-64.1	-60.3	132.8	0	0	108.2	D102	E100-D102 PolarHBondContact O-N 2.85Å
101	P	81.6	Confident	91.7	Very high	116 Å²	116	113.1 Å²	113.1	75%	0.753	60%	0.597	S	S	*	*	P	Polyproline II helix	trans	-65.9	132.7	172.2	27.3	-31.3	0	0	0	109.5
102	D	69.9	Low	91.2	Very high	240 Å²	240	119.8 Å²	119.8	100%	1.283	63%	0.633	S	S	*	*			trans	-64.5	0	174.8	-66.3	-51.1	0	0	0	112.8	E100	E100-D102 PolarHBondContact O-N 2.85Å

Retrieved 102 of 102 residues in 55.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).