A0A088AWP7_HUMAN Loading...

GLI pathogenesis related 2

AlphaFold DB , UniProt , Accession A0A088AWP7, Species HUMAN (Homo sapiens, Human), Gene GLIPR2, Length 62 aa.

						>A0A088AWP7_HUMAN|A0A088AWP7|GLIPR2
MGKSASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQTLHGHGMEEHQEDGRGEGVRK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.3	Very low	78.2	Confident	251 Å²	251	107.5 Å²	107.5	100%	1.236	60%	0.598	S	S	*	*				0	114	0	-60.5	-166.7	-166.1	0	0	108.6
2	G	61.5	Low	79.4	Confident	83 Å²	83	107.3 Å²	107.3	86%	0.856	59%	0.589	S	S	*	*	P	Polyproline II helix	trans	-69.8	141.4	-179.8	0	0	0	0	0	111.8
3	K	61.2	Low	80.3	Confident	165 Å²	165	103.5 Å²	103.5	72%	0.717	57%	0.572	S	S	*	*	P	Polyproline II helix	trans	-69.7	133.7	171.2	-71.7	167.2	-177.9	163.9	0	108.2
4	S	83.1	Confident	81.1	Confident	73 Å²	73	99.1 Å²	99.1	51%	0.51	55%	0.546	S	S	.	.	P	Polyproline II helix	trans	-67.3	147.7	175.2	62	0	0	0	0	111.2	S6 K7 Q8	S4-S6 VanDerWaalsContact C-N 3.27Å; S4-S6 PolarHBondContact O-N 2.86Å; S4-K7 WeakPolarHBondContact O-CB 3.48Å; S4-K7 PolarHBondContact O-N 2.81Å; S4-Q8 PolarHBondContact O-N 2.88Å; S4-Q8 VanDerWaalsContact O-N 3.16Å
5	A	84.1	Confident	81.9	Confident	86 Å²	86	101.4 Å²	101.4	71%	0.711	55%	0.548	S	S	*	.	H	α-helix	trans	-55.1	-40.8	-179.4	0	0	0	0	0	112.6	K7 Q8 F9	A5-K7 VanDerWaalsContact C-N 3.32Å; A5-K7 PolarHBondContact O-N 3.29Å; A5-Q8 PolarHBondContact O-N 3.12Å; A5-F9 PolarHBondContact O-N 3.02Å
6	S	83.6	Confident	82.7	Confident	56 Å²	56	98.5 Å²	98.5	39%	0.392	54%	0.543	S	S	.	.	H	α-helix	trans	-60.6	-38.3	175.4	170.2	0	0	0	0	112.7	S4 Q8 F9 H10	S4-S6 VanDerWaalsContact C-N 3.27Å; S4-S6 PolarHBondContact O-N 2.86Å; S6-Q8 VanDerWaalsContact C-N 3.35Å; S6-F9 PolarHBondContact O-N 3.12Å; S6-H10 PolarHBondContact O-N 2.87Å; S6-H10 PolarHBondContact O-ND1 3.3Å; S6-H10 PolarHBondContact OG-CE1 3.2Å
7	K	85.1	Confident	83.4	Confident	117 Å²	117	98.9 Å²	98.9	51%	0.509	54%	0.54	S	S	.	.	H	α-helix	trans	-68.2	-36.9	177.2	-173.8	174.9	-177.7	175.7	0	111.6	S4 A5 N11	S4-K7 WeakPolarHBondContact O-CB 3.48Å; S4-K7 PolarHBondContact O-N 2.81Å; A5-K7 VanDerWaalsContact C-N 3.32Å; A5-K7 PolarHBondContact O-N 3.29Å; K7-N11 VanDerWaalsContact O-CG 3.28Å; K7-N11 PolarHBondContact O-N 3.2Å; K7-N11 PolarHBondContact O-ND2 2.77Å
8	Q	88.9	Confident	83.9	Confident	109 Å²	109	95.3 Å²	95.3	51%	0.509	52%	0.519	S	S	.	.	H	α-helix	trans	-65.4	-48.6	175.4	-175.3	174.3	-51.6	0	0	110.8	S4 A5 S6 H10 N11 E12	S4-Q8 PolarHBondContact O-N 2.88Å; S4-Q8 VanDerWaalsContact O-N 3.16Å; A5-Q8 PolarHBondContact O-N 3.12Å; S6-Q8 VanDerWaalsContact C-N 3.35Å; Q8-H10 PolarHBondContact O-N 3.44Å; Q8-N11 PolarHBondContact O-N 2.99Å; Q8-N11 VanDerWaalsContact O-N 3.09Å; Q8-E12 HydrophobicContact CG-CG 4.48Å; Q8-E12 VanDerWaalsContact CG-OE1 3.29Å; Q8-E12 WeakPolarHBondContact CG-OE1 3.32Å; Q8-E12 PolarHBondContact NE2-OE1 2.93Å; Q8-E12 PolarHBondContact O-N 3.27Å
9	F	88.3	Confident	84.5	Confident	128 Å²	128	95 Å²	95	56%	0.561	51%	0.514	S	S	*	.	H	α-helix	trans	-55.3	-49.3	177.8	-180	-104.7	0	0	0	112.5	A5 S6 N11 E12 V13	A5-F9 PolarHBondContact O-N 3.02Å; S6-F9 PolarHBondContact O-N 3.12Å; F9-N11 PolarHBondContact O-N 3.49Å; F9-E12 PolarHBondContact O-N 3.27Å; F9-V13 HydrophobicContact CD1-CG2 4.37Å; F9-V13 HydrophobicContact CD2-CG2 4.3Å; F9-V13 HydrophobicContact CE1-CG2 3.99Å; F9-V13 HydrophobicContact CE2-CG2 3.91Å; F9-V13 HydrophobicContact CZ-CG2 3.75Å; F9-V13 WeakPolarHBondContact O-CG2 3.3Å; F9-V13 PolarHBondContact O-N 3.35Å
10	H	87.8	Confident	84.9	Confident	41 Å²	41	97.7 Å²	97.7	19%	0.19	52%	0.518	C	S	.	.	H	α-helix	trans	-57.4	-38	178	-64.5	153	0	0	0	113	S6 Q8 L14 L31 N36	S6-H10 PolarHBondContact O-N 2.87Å; S6-H10 PolarHBondContact O-ND1 3.3Å; S6-H10 PolarHBondContact OG-CE1 3.2Å; Q8-H10 PolarHBondContact O-N 3.44Å; H10-L14 WeakPolarHBondContact O-CB 3.41Å; H10-L14 PolarHBondContact O-N 3.01Å; H10-L31 HydrophobicContact CB-CD1 4.06Å; H10-L31 HydrophobicContact CB-CD2 4.11Å; H10-N36 PolarHBondContact CD2-ND2 3.37Å
11	N	89.5	Confident	85.4	Confident	73 Å²	73	96.6 Å²	96.6	39%	0.39	51%	0.506	S	S	.	.	H	α-helix	trans	-73.1	-39.7	-179.5	-68.9	-32.2	0	0	0	112.1	K7 Q8 F9 L14 K15	K7-N11 VanDerWaalsContact O-CG 3.28Å; K7-N11 PolarHBondContact O-N 3.2Å; K7-N11 PolarHBondContact O-ND2 2.77Å; Q8-N11 PolarHBondContact O-N 2.99Å; Q8-N11 VanDerWaalsContact O-N 3.09Å; F9-N11 PolarHBondContact O-N 3.49Å; N11-L14 PolarHBondContact O-N 3.3Å; N11-K15 VanDerWaalsContact O-CB 3.3Å; N11-K15 WeakPolarHBondContact O-CB 3.42Å; N11-K15 PolarHBondContact O-N 2.94Å
12	E	92.5	Very high	87.5	Confident	105 Å²	105	91.9 Å²	91.9	49%	0.491	48%	0.481	S	S	.	.	H	α-helix	trans	-63.7	-46.4	177.4	-72.1	173.5	-172.2	0	0	111	Q8 F9 L14 K15 A16	Q8-E12 HydrophobicContact CG-CG 4.48Å; Q8-E12 VanDerWaalsContact CG-OE1 3.29Å; Q8-E12 WeakPolarHBondContact CG-OE1 3.32Å; Q8-E12 PolarHBondContact NE2-OE1 2.93Å; Q8-E12 PolarHBondContact O-N 3.27Å; F9-E12 PolarHBondContact O-N 3.27Å; E12-L14 PolarHBondContact O-N 3.21Å; E12-K15 PolarHBondContact O-N 3.12Å; E12-A16 PolarHBondContact O-N 3.41Å
13	V	91.4	Very high	89.1	Confident	59 Å²	59	95.9 Å²	95.9	36%	0.358	48%	0.475	S	S	.	.	H	α-helix	trans	-59.8	-47.5	175.5	174.6	0	0	0	0	110.9	F9 K15 A16 H17	F9-V13 HydrophobicContact CD1-CG2 4.37Å; F9-V13 HydrophobicContact CD2-CG2 4.3Å; F9-V13 HydrophobicContact CE1-CG2 3.99Å; F9-V13 HydrophobicContact CE2-CG2 3.91Å; F9-V13 HydrophobicContact CZ-CG2 3.75Å; F9-V13 WeakPolarHBondContact O-CG2 3.3Å; F9-V13 PolarHBondContact O-N 3.35Å; V13-K15 VanDerWaalsContact C-N 3.31Å; V13-K15 PolarHBondContact O-N 3.12Å; V13-A16 PolarHBondContact O-N 3.18Å; V13-H17 PolarHBondContact O-N 3.42Å; V13-H17 PolarHBondContact O-ND1 2.8Å
14	L	91.9	Very high	90.6	Very high	41 Å²	41	93.5 Å²	93.5	22%	0.215	47%	0.467	C	S	.	.	H	α-helix	trans	-60.9	-42.1	178.7	-178.6	67.1	0	0	0	111.8	H10 N11 E12 H17 N18 L29 L31	H10-L14 WeakPolarHBondContact O-CB 3.41Å; H10-L14 PolarHBondContact O-N 3.01Å; N11-L14 PolarHBondContact O-N 3.3Å; E12-L14 PolarHBondContact O-N 3.21Å; L14-H17 PolarHBondContact O-N 3.32Å; L14-N18 WeakPolarHBondContact O-CB 3.38Å; L14-N18 PolarHBondContact O-N 3.23Å; L14-L29 HydrophobicContact CD1-CB 3.88Å; L14-L31 HydrophobicContact CB-CD2 4.06Å; L14-L31 HydrophobicContact CB-CG 4.41Å; L14-L31 HydrophobicContact CD2-CD1 4.45Å; L14-L31 HydrophobicContact CD2-CD2 4.23Å; L14-L31 HydrophobicContact CD2-CG 3.72Å; L14-L31 HydrophobicContact CG-CD2 4.49Å; L14-L31 HydrophobicContact CG-CG 4.49Å
15	K	92.2	Very high	91.1	Very high	134 Å²	134	93.4 Å²	93.4	58%	0.583	48%	0.477	S	S	*	.	H	α-helix	trans	-60	-51.3	179.8	-177.3	-177.2	172.2	-166.9	0	110.8	N11 E12 V13 H17 N18 E19	N11-K15 VanDerWaalsContact O-CB 3.3Å; N11-K15 WeakPolarHBondContact O-CB 3.42Å; N11-K15 PolarHBondContact O-N 2.94Å; E12-K15 PolarHBondContact O-N 3.12Å; V13-K15 VanDerWaalsContact C-N 3.31Å; V13-K15 PolarHBondContact O-N 3.12Å; K15-H17 VanDerWaalsContact C-N 3.32Å; K15-H17 PolarHBondContact O-N 3.33Å; K15-N18 PolarHBondContact O-N 3.34Å; K15-E19 WeakPolarHBondContact CE-OE1 3.35Å; K15-E19 IonicContact NZ-OE1 3.92Å; K15-E19 WeakPolarHBondContact O-CG 3.39Å; K15-E19 PolarHBondContact O-N 3.45Å
16	A	94.4	Very high	91.6	Very high	55 Å²	55	92.2 Å²	92.2	46%	0.455	46%	0.46	S	S	.	.	H	α-helix	trans	-57.8	-43.1	-179.6	0	0	0	0	0	112.6	E12 V13 Y20	E12-A16 PolarHBondContact O-N 3.41Å; V13-A16 PolarHBondContact O-N 3.18Å; A16-Y20 PolarHBondContact O-N 3.43Å
17	H	94.3	Very high	91.9	Very high	106 Å²	106	94 Å²	94	49%	0.491	47%	0.47	S	S	.	.	H	α-helix	trans	-66.2	-42.6	177.6	-74.4	80.6	0	0	0	112.3	V13 L14 K15 Y20 R21	V13-H17 PolarHBondContact O-N 3.42Å; V13-H17 PolarHBondContact O-ND1 2.8Å; L14-H17 PolarHBondContact O-N 3.32Å; K15-H17 VanDerWaalsContact C-N 3.32Å; K15-H17 PolarHBondContact O-N 3.33Å; H17-Y20 PolarHBondContact O-N 3.41Å; H17-R21 VanDerWaalsContact O-CG 3.32Å; H17-R21 WeakPolarHBondContact O-CG 3Å; H17-R21 PolarHBondContact O-N 3.48Å
18	N	93.4	Very high	92.1	Very high	33 Å²	33	93 Å²	93	18%	0.176	48%	0.477	C	S	.	.	H	α-helix	trans	-68.9	-34.1	-179.6	-77.5	-13.9	0	0	0	112.5	L14 K15 R21 Q22 P28 L29	L14-N18 WeakPolarHBondContact O-CB 3.38Å; L14-N18 PolarHBondContact O-N 3.23Å; K15-N18 PolarHBondContact O-N 3.34Å; N18-R21 PolarHBondContact O-N 3.44Å; N18-Q22 VanDerWaalsContact O-CB 3.3Å; N18-Q22 WeakPolarHBondContact O-CB 3.43Å; N18-Q22 PolarHBondContact O-N 3.11Å; N18-P28 HydrophobicContact CB-CB 4.45Å; N18-L29 PolarHBondContact ND2-O 3.21Å; N18-L29 WeakPolarHBondContact OD1-CB 3.31Å; N18-L29 PolarHBondContact OD1-N 3.2Å
19	E	95	Very high	92.2	Very high	90 Å²	90	91.4 Å²	91.4	42%	0.421	47%	0.471	S	S	.	.	H	α-helix	trans	-61.6	-43.8	171.6	-73.9	174.5	177.1	0	0	111.5	K15 Q22 K23	K15-E19 WeakPolarHBondContact CE-OE1 3.35Å; K15-E19 IonicContact NZ-OE1 3.92Å; K15-E19 WeakPolarHBondContact O-CG 3.39Å; K15-E19 PolarHBondContact O-N 3.45Å; E19-Q22 PolarHBondContact O-N 2.93Å; E19-K23 WeakPolarHBondContact O-CG 3.46Å; E19-K23 PolarHBondContact O-N 3.1Å
20	Y	93.2	Very high	92.2	Very high	149 Å²	149	94.5 Å²	94.5	58%	0.584	48%	0.484	S	S	*	.	H	α-helix	trans	-63.3	-48.4	175	-175.5	-101.4	0	0	0	111.6	A16 H17 Q22 K23 H24	A16-Y20 PolarHBondContact O-N 3.43Å; H17-Y20 PolarHBondContact O-N 3.41Å; Y20-Q22 VanDerWaalsContact C-N 3.27Å; Y20-Q22 PolarHBondContact O-N 3.36Å; Y20-K23 WeakPolarHBondContact O-CB 3.3Å; Y20-K23 PolarHBondContact O-N 3.41Å; Y20-K23 VanDerWaalsContact O-N 3.12Å; Y20-H24 AromaticContact CE1-CD2 3.65Å; Y20-H24 AromaticContact CE1-NE2 3.81Å; Y20-H24 AromaticContact CE2-CD2 3.84Å; Y20-H24 AromaticContact CE2-NE2 3.38Å; Y20-H24 WeakPolarHBondContact CE2-NE2 3.32Å; Y20-H24 AromaticContact CZ-CD2 3.56Å; Y20-H24 AromaticContact CZ-NE2 3.2Å; Y20-H24 PolarHBondContact O-CD2 2.89Å; Y20-H24 VanDerWaalsContact O-CD2 3.27Å; Y20-H24 PolarHBondContact O-N 3.26Å; Y20-H24 PolarHBondContact OH-NE2 2.92Å
21	R	94.1	Very high	92	Very high	74 Å²	74	96.3 Å²	96.3	28%	0.279	50%	0.495	S	S	.	.	H	α-helix	trans	-58.8	-39	177.6	-71.5	173.2	73.5	102.3	-4.8	112.4	H17 N18 K23 H24 G25 V26 P27	H17-R21 VanDerWaalsContact O-CG 3.32Å; H17-R21 WeakPolarHBondContact O-CG 3Å; H17-R21 PolarHBondContact O-N 3.48Å; N18-R21 PolarHBondContact O-N 3.44Å; R21-K23 PolarHBondContact O-N 3.07Å; R21-H24 CarbonylContact O-C 3.44Å; R21-H24 PolarHBondContact O-N 3.06Å; R21-H24 VanDerWaalsContact O-N 3.12Å; R21-G25 PolarHBondContact O-N 3.42Å; R21-G25 VanDerWaalsContact O-N 3.12Å; R21-V26 HydrophobicContact CB-CB 4.08Å; R21-V26 HydrophobicContact CG-CB 4.47Å; R21-V26 VanDerWaalsContact NH2-CG1 3.35Å; R21-V26 PolarHBondContact O-N 3.16Å; R21-P27 VanDerWaalsContact CZ-O 3.27Å; R21-P27 PolarHBondContact NE-O 3.47Å; R21-P27 PolarHBondContact NH2-O 3.12Å
22	Q	92.8	Very high	91.8	Very high	152 Å²	152	95.4 Å²	95.4	71%	0.71	49%	0.493	S	S	*	.	H	α-helix	trans	-61.4	-42.9	176.3	-176.3	-180	47.4	0	0	111.9	N18 E19 Y20 H24 G25	N18-Q22 VanDerWaalsContact O-CB 3.3Å; N18-Q22 WeakPolarHBondContact O-CB 3.43Å; N18-Q22 PolarHBondContact O-N 3.11Å; E19-Q22 PolarHBondContact O-N 2.93Å; Y20-Q22 VanDerWaalsContact C-N 3.27Å; Y20-Q22 PolarHBondContact O-N 3.36Å; Q22-H24 PolarHBondContact O-N 3.39Å; Q22-G25 PolarHBondContact O-N 3.19Å
23	K	93.4	Very high	91.1	Very high	168 Å²	168	99.3 Å²	99.3	73%	0.73	51%	0.509	S	S	*	.	H	α-helix	trans	-58.5	-30.3	175.8	-68.3	172.3	-175.5	178.9	0	112.5	E19 Y20 R21	E19-K23 WeakPolarHBondContact O-CG 3.46Å; E19-K23 PolarHBondContact O-N 3.1Å; Y20-K23 WeakPolarHBondContact O-CB 3.3Å; Y20-K23 PolarHBondContact O-N 3.41Å; Y20-K23 VanDerWaalsContact O-N 3.12Å; R21-K23 PolarHBondContact O-N 3.07Å
24	H	94.7	Very high	90.4	Very high	115 Å²	115	101.2 Å²	101.2	53%	0.532	52%	0.517	S	S	.	.	T	Hydrogen-bonded Turn	trans	-95.7	7.2	178.6	-68.4	-78.3	0	0	0	113.8	Y20 R21 Q22 V26	Y20-H24 AromaticContact CE1-CD2 3.65Å; Y20-H24 AromaticContact CE1-NE2 3.81Å; Y20-H24 AromaticContact CE2-CD2 3.84Å; Y20-H24 AromaticContact CE2-NE2 3.38Å; Y20-H24 WeakPolarHBondContact CE2-NE2 3.32Å; Y20-H24 AromaticContact CZ-CD2 3.56Å; Y20-H24 AromaticContact CZ-NE2 3.2Å; Y20-H24 PolarHBondContact O-CD2 2.89Å; Y20-H24 VanDerWaalsContact O-CD2 3.27Å; Y20-H24 PolarHBondContact O-N 3.26Å; Y20-H24 PolarHBondContact OH-NE2 2.92Å; R21-H24 CarbonylContact O-C 3.44Å; R21-H24 PolarHBondContact O-N 3.06Å; R21-H24 VanDerWaalsContact O-N 3.12Å; Q22-H24 PolarHBondContact O-N 3.39Å; H24-V26 HydrophobicContact CB-CG2 4.03Å; H24-V26 PolarHBondContact O-N 3.09Å
25	G	91.8	Very high	89.6	Confident	70 Å²	70	104.4 Å²	104.4	72%	0.722	53%	0.534	S	S	*	.	T	Hydrogen-bonded Turn	trans	68.7	16	-179.6	0	0	0	0	0	114.6	R21 Q22	R21-G25 PolarHBondContact O-N 3.42Å; R21-G25 VanDerWaalsContact O-N 3.12Å; Q22-G25 PolarHBondContact O-N 3.19Å
26	V	94.5	Very high	88.8	Confident	61 Å²	61	100 Å²	100	37%	0.37	52%	0.516	S	S	.	.	P	Polyproline II helix	trans	-89.3	138.4	-177.5	-174.6	0	0	0	0	109.9	R21 H24	R21-V26 HydrophobicContact CB-CB 4.08Å; R21-V26 HydrophobicContact CG-CB 4.47Å; R21-V26 VanDerWaalsContact NH2-CG1 3.35Å; R21-V26 PolarHBondContact O-N 3.16Å; H24-V26 HydrophobicContact CB-CG2 4.03Å; H24-V26 PolarHBondContact O-N 3.09Å
27	P	91	Very high	87.9	Confident	93 Å²	93	103.7 Å²	103.7	60%	0.604	52%	0.519	S	S	*	.	P	Polyproline II helix	trans	-56	145.8	178.2	-27	34.6	0	0	0	113.7	R21	R21-P27 VanDerWaalsContact CZ-O 3.27Å; R21-P27 PolarHBondContact NE-O 3.47Å; R21-P27 PolarHBondContact NH2-O 3.12Å
28	P	88.7	Confident	86.8	Confident	98 Å²	98	103.3 Å²	103.3	64%	0.636	52%	0.517	S	S	*	.	P	Polyproline II helix	trans	-71.6	150	-177.5	30	-35.5	0	0	0	112.5	N18	N18-P28 HydrophobicContact CB-CB 4.45Å
29	L	90.5	Very high	85.8	Confident	75 Å²	75	105 Å²	105	39%	0.393	54%	0.535	S	S	.	.	P	Polyproline II helix	trans	-83.7	159	172.7	-61.3	174.2	0	0	0	111.3	L14 N18	L14-L29 HydrophobicContact CD1-CB 3.88Å; N18-L29 PolarHBondContact ND2-O 3.21Å; N18-L29 WeakPolarHBondContact OD1-CB 3.31Å; N18-L29 PolarHBondContact OD1-N 3.2Å
30	K	88.6	Confident	84.8	Confident	193 Å²	193	105.5 Å²	105.5	84%	0.839	54%	0.538	S	S	*	.			trans	-122.3	147.5	173.3	-62.7	179.4	-177.5	175.2	0	109.1	C32	K30-C32 PolarHBondContact O-N 3.03Å
31	L	84.8	Confident	83.8	Confident	79 Å²	79	103.3 Å²	103.3	41%	0.414	53%	0.533	S	S	.	.			trans	-63.2	130.8	175.2	-72.6	175.9	0	0	0	110.6	H10 L14	H10-L31 HydrophobicContact CB-CD1 4.06Å; H10-L31 HydrophobicContact CB-CD2 4.11Å; L14-L31 HydrophobicContact CB-CD2 4.06Å; L14-L31 HydrophobicContact CB-CG 4.41Å; L14-L31 HydrophobicContact CD2-CD1 4.45Å; L14-L31 HydrophobicContact CD2-CD2 4.23Å; L14-L31 HydrophobicContact CD2-CG 3.72Å; L14-L31 HydrophobicContact CG-CD2 4.49Å; L14-L31 HydrophobicContact CG-CG 4.49Å
32	C	83.9	Confident	82.1	Confident	53 Å²	53	103.8 Å²	103.8	36%	0.358	54%	0.544	S	S	.	.			trans	-117.2	122.6	173.1	-178.2	0	0	0	0	109.3	K30 N34 L35 N36	K30-C32 PolarHBondContact O-N 3.03Å; C32-N34 VanDerWaalsContact C-N 3.28Å; C32-N34 PolarHBondContact O-N 3.23Å; C32-L35 HydrophobicContact CB-CB 4.15Å; C32-L35 HydrophobicContact CB-CD1 3.89Å; C32-L35 HydrophobicContact CB-CG 4.1Å; C32-L35 PolarHBondContact O-N 3.03Å; C32-N36 PolarHBondContact O-N 3.04Å; C32-N36 VanDerWaalsContact O-N 3.12Å; C32-N36 PolarHBondContact O-OD1 3.4Å
33	K	78.3	Confident	80.4	Confident	188 Å²	188	103.7 Å²	103.7	82%	0.817	55%	0.548	S	S	*	.	H	α-helix	trans	-63.6	-33.2	-175.8	-65.8	-178.3	-178.7	176.9	0	112.9	R37	K33-R37 PolarHBondContact O-N 3.45Å
34	N	77.4	Confident	78.7	Confident	99 Å²	99	103.7 Å²	103.7	53%	0.529	55%	0.55	S	S	.	*	H	α-helix	trans	-70.8	-47.4	-179.9	-67	-11.5	0	0	0	111.2	C32 N36 R37 E38	C32-N34 VanDerWaalsContact C-N 3.28Å; C32-N34 PolarHBondContact O-N 3.23Å; N34-N36 VanDerWaalsContact C-N 3.32Å; N34-N36 PolarHBondContact O-N 3.23Å; N34-R37 WeakPolarHBondContact O-CB 3.41Å; N34-R37 PolarHBondContact O-N 2.98Å; N34-R37 VanDerWaalsContact O-N 3.1Å; N34-E38 PolarHBondContact O-N 3.17Å
35	L	73.6	Confident	77	Confident	108 Å²	108	101.1 Å²	101.1	57%	0.565	55%	0.554	S	S	*	*	H	α-helix	trans	-61.1	-40.1	176.6	-69.1	175.6	0	0	0	112.1	C32 R37 E38 A39	C32-L35 HydrophobicContact CB-CB 4.15Å; C32-L35 HydrophobicContact CB-CD1 3.89Å; C32-L35 HydrophobicContact CB-CG 4.1Å; C32-L35 PolarHBondContact O-N 3.03Å; L35-R37 VanDerWaalsContact C-N 3.29Å; L35-R37 PolarHBondContact O-N 2.96Å; L35-E38 PolarHBondContact O-N 3.16Å; L35-A39 WeakPolarHBondContact O-CB 3.29Å; L35-A39 PolarHBondContact O-N 2.96Å
36	N	76.1	Confident	75.3	Confident	40 Å²	40	104 Å²	104	21%	0.214	55%	0.549	C	S	.	.	H	α-helix	trans	-63.6	-37.3	176.3	-73.2	17.3	0	0	0	111.9	H10 C32 N34 Q40	H10-N36 PolarHBondContact CD2-ND2 3.37Å; C32-N36 PolarHBondContact O-N 3.04Å; C32-N36 VanDerWaalsContact O-N 3.12Å; C32-N36 PolarHBondContact O-OD1 3.4Å; N34-N36 VanDerWaalsContact C-N 3.32Å; N34-N36 PolarHBondContact O-N 3.23Å; N36-Q40 VanDerWaalsContact O-CG 3.31Å; N36-Q40 WeakPolarHBondContact O-CG 3.38Å; N36-Q40 PolarHBondContact O-N 3.09Å; N36-Q40 VanDerWaalsContact O-N 3.16Å
37	R	76.8	Confident	73.2	Confident	134 Å²	134	104.2 Å²	104.2	51%	0.506	56%	0.563	S	S	.	*	H	α-helix	trans	-68.3	-44.6	176.5	-175	176.6	120.8	-106.9	-2	111.3	K33 N34 L35 Q40 Q41	K33-R37 PolarHBondContact O-N 3.45Å; N34-R37 WeakPolarHBondContact O-CB 3.41Å; N34-R37 PolarHBondContact O-N 2.98Å; N34-R37 VanDerWaalsContact O-N 3.1Å; L35-R37 VanDerWaalsContact C-N 3.29Å; L35-R37 PolarHBondContact O-N 2.96Å; R37-Q40 PolarHBondContact O-N 3.14Å; R37-Q41 VanDerWaalsContact O-CG 3.28Å; R37-Q41 WeakPolarHBondContact O-CG 3.28Å; R37-Q41 PolarHBondContact O-N 2.95Å
38	E	70.6	Confident	71.1	Confident	97 Å²	97	108.3 Å²	108.3	45%	0.453	58%	0.576	S	S	.	*	H	α-helix	trans	-63.3	-45.6	177.7	-73.3	168.6	-155.9	0	0	111.6	N34 L35 Q40 Q41 T42	N34-E38 PolarHBondContact O-N 3.17Å; L35-E38 PolarHBondContact O-N 3.16Å; E38-Q40 VanDerWaalsContact C-N 3.29Å; E38-Q40 PolarHBondContact O-N 2.92Å; E38-Q41 WeakPolarHBondContact O-CA 3.43Å; E38-Q41 WeakPolarHBondContact O-CB 3.46Å; E38-Q41 PolarHBondContact O-N 3.03Å; E38-T42 PolarHBondContact O-N 3.32Å; E38-T42 PolarHBondContact O-OG1 2.67Å; E38-T42 VanDerWaalsContact O-OG1 3.14Å
39	A	72.4	Confident	69.6	Low	68 Å²	68	111.2 Å²	111.2	56%	0.562	58%	0.581	S	S	*	*	H	α-helix	trans	-59.6	-38.9	176.3	0	0	0	0	0	112.5	L35 Q41	L35-A39 WeakPolarHBondContact O-CB 3.29Å; L35-A39 PolarHBondContact O-N 2.96Å; A39-Q41 VanDerWaalsContact C-N 3.31Å
40	Q	74.5	Confident	67.9	Low	102 Å²	102	116.2 Å²	116.2	48%	0.477	60%	0.603	S	S	.	*	H	α-helix	trans	-66	-34	172.9	-76	176.4	-15.6	0	0	112.1	N36 R37 E38 H44	N36-Q40 VanDerWaalsContact O-CG 3.31Å; N36-Q40 WeakPolarHBondContact O-CG 3.38Å; N36-Q40 PolarHBondContact O-N 3.09Å; N36-Q40 VanDerWaalsContact O-N 3.16Å; R37-Q40 PolarHBondContact O-N 3.14Å; E38-Q40 VanDerWaalsContact C-N 3.29Å; E38-Q40 PolarHBondContact O-N 2.92Å; Q40-H44 PolarHBondContact O-CE1 2.96Å; Q40-H44 VanDerWaalsContact O-CE1 3.24Å; Q40-H44 PolarHBondContact O-ND1 3.33Å
41	Q	71.3	Confident	66.3	Low	103 Å²	103	115.3 Å²	115.3	48%	0.481	60%	0.601	S	S	.	*	H	α-helix	trans	-73.5	-38.3	179.9	-73.8	175.2	-21.8	0	0	112.6	R37 E38 A39 L43 H44	R37-Q41 VanDerWaalsContact O-CG 3.28Å; R37-Q41 WeakPolarHBondContact O-CG 3.28Å; R37-Q41 PolarHBondContact O-N 2.95Å; E38-Q41 WeakPolarHBondContact O-CA 3.43Å; E38-Q41 WeakPolarHBondContact O-CB 3.46Å; E38-Q41 PolarHBondContact O-N 3.03Å; A39-Q41 VanDerWaalsContact C-N 3.31Å; Q41-L43 PolarHBondContact O-N 2.73Å; Q41-H44 PolarHBondContact O-N 3.24Å
42	T	58.8	Low	64.6	Low	83 Å²	83	119.8 Å²	119.8	51%	0.509	62%	0.62	S	S	.	*	H	α-helix	trans	-60.6	-32.8	-179.8	-52.8	0	0	0	0	112.7	E38 H44 G45 H46	E38-T42 PolarHBondContact O-N 3.32Å; E38-T42 PolarHBondContact O-OG1 2.67Å; E38-T42 VanDerWaalsContact O-OG1 3.14Å; T42-H44 VanDerWaalsContact C-N 3.26Å; T42-H44 PolarHBondContact O-N 3.35Å; T42-G45 PolarHBondContact O-N 2.91Å; T42-H46 PolarHBondContact O-N 3.36Å
43	L	56.9	Low	63.3	Low	151 Å²	151	125.6 Å²	125.6	79%	0.791	64%	0.641	S	S	*	*	H	α-helix	trans	-67.3	-24.3	177.5	-169.3	61.7	0	0	0	113.6	Q41	Q41-L43 PolarHBondContact O-N 2.73Å
44	H	57.9	Low	62.4	Low	168 Å²	168	123.1 Å²	123.1	78%	0.778	64%	0.637	S	S	*	*	H	α-helix	trans	-89.1	-14.2	178.9	-60.5	93.6	0	0	0	112.8	Q40 Q41 T42	Q40-H44 PolarHBondContact O-CE1 2.96Å; Q40-H44 VanDerWaalsContact O-CE1 3.24Å; Q40-H44 PolarHBondContact O-ND1 3.33Å; Q41-H44 PolarHBondContact O-N 3.24Å; T42-H44 VanDerWaalsContact C-N 3.26Å; T42-H44 PolarHBondContact O-N 3.35Å
45	G	59.2	Low	61.6	Low	60 Å²	60	122 Å²	122	62%	0.619	65%	0.65	S	S	*	*	H	α-helix	trans	-111.1	-19.1	-169.6	0	0	0	0	0	116	T42 G47	T42-G45 PolarHBondContact O-N 2.91Å; G45-G47 PolarHBondContact O-N 2.97Å
46	H	55.4	Low	60.9	Low	132 Å²	132	127.6 Å²	127.6	61%	0.611	66%	0.663	S	S	*	*			trans	-92.4	94.8	176.3	-91	51.2	0	0	0	110.3	T42 M48	T42-H46 PolarHBondContact O-N 3.36Å; H46-M48 PolarHBondContact O-N 3Å
47	G	50.7	Low	59.9	Low	64 Å²	64	129.6 Å²	129.6	66%	0.66	69%	0.693	S	S	*	*			trans	-53.9	130.8	150.6	0	0	0	0	0	108.3	G45 E49	G45-G47 PolarHBondContact O-N 2.97Å; G47-E49 PolarHBondContact O-N 3.26Å
48	M	45.7	Very low	59.2	Low	179 Å²	179	132.5 Å²	132.5	88%	0.882	71%	0.712	S	S	*	*			trans	-31.7	101.6	177.7	-59.2	178.5	168.1	0	0	112.5	H46 E50	H46-M48 PolarHBondContact O-N 3Å; M48-E50 PolarHBondContact O-N 3.39Å
49	E	57.1	Low	58.3	Low	160 Å²	160	131 Å²	131	75%	0.748	72%	0.722	S	S	*	*			trans	-76.4	109.3	159.3	-84.3	-168.8	152.9	0	0	106.8	G47 H51	G47-E49 PolarHBondContact O-N 3.26Å; E49-H51 PolarHBondContact O-N 3.3Å; E49-H51 VanDerWaalsContact O-N 3.07Å
50	E	54.7	Low	57.4	Low	180 Å²	180	134.7 Å²	134.7	84%	0.841	74%	0.738	S	S	*	*			trans	-63.3	105.3	176.8	-50.6	-170.5	-170.9	0	0	108	M48 Q52	M48-E50 PolarHBondContact O-N 3.39Å; E50-Q52 PolarHBondContact O-N 3.07Å
51	H	56.3	Low	56.2	Low	173 Å²	173	141.2 Å²	141.2	80%	0.801	76%	0.758	S	S	*	*			trans	-65.2	102.3	166.8	-96.6	-96.4	0	0	0	107.8	E49 E53	E49-H51 PolarHBondContact O-N 3.3Å; E49-H51 VanDerWaalsContact O-N 3.07Å; H51-E53 PolarHBondContact O-N 3.27Å
52	Q	48.5	Very low	55	Low	173 Å²	173	149.4 Å²	149.4	81%	0.808	79%	0.792	S	S	*	*			trans	-72.2	108.1	167.9	-175.9	156.8	43.5	0	0	107.7	E50 D54	E50-Q52 PolarHBondContact O-N 3.07Å; Q52-D54 VanDerWaalsContact C-N 3.34Å; Q52-D54 PolarHBondContact O-N 3.26Å; Q52-D54 VanDerWaalsContact O-OD1 3.1Å
53	E	57.9	Low	54.8	Low	175 Å²	175	152.8 Å²	152.8	82%	0.818	81%	0.807	S	S	*	*			trans	-64.5	90.9	172.7	-60.8	-85	143.2	0	0	108.9	H51 G55	H51-E53 PolarHBondContact O-N 3.27Å; E53-G55 PolarHBondContact O-N 2.98Å
54	D	59.3	Low	54.7	Low	136 Å²	136	152.8 Å²	152.8	73%	0.727	81%	0.807	S	S	*	*			trans	-73.3	83.7	168.9	42.6	-38.5	0	0	0	108.8	Q52 R56	Q52-D54 VanDerWaalsContact C-N 3.34Å; Q52-D54 PolarHBondContact O-N 3.26Å; Q52-D54 VanDerWaalsContact O-OD1 3.1Å; D54-R56 VanDerWaalsContact C-N 3.28Å; D54-R56 PolarHBondContact O-N 3.22Å
55	G	60.5	Low	54.5	Low	77 Å²	77	152 Å²	152	79%	0.794	81%	0.809	S	S	*	*			trans	-52.3	73.3	-172.4	0	0	0	0	0	116.5	E53	E53-G55 PolarHBondContact O-N 2.98Å
56	R	57.7	Low	54.2	Low	225 Å²	225	157.4 Å²	157.4	85%	0.849	82%	0.82	S	S	*	*			trans	-109.1	70.7	161.1	-64.3	-168.5	-149	-115.8	2.4	109.6	D54 E58	D54-R56 VanDerWaalsContact C-N 3.28Å; D54-R56 PolarHBondContact O-N 3.22Å; R56-E58 VanDerWaalsContact C-N 3.27Å; R56-E58 PolarHBondContact O-N 3.07Å; R56-E58 VanDerWaalsContact O-N 3.09Å
57	G	56.6	Low	54.2	Low	81 Å²	81	159 Å²	159	84%	0.835	83%	0.833	S	S	*	*			trans	-74.7	82.2	159.3	0	0	0	0	0	109.6	G59	G57-G59 PolarHBondContact O-N 3.26Å
58	E	60.3	Low	54.4	Low	195 Å²	195	165.3 Å²	165.3	91%	0.911	85%	0.845	S	S	*	*			trans	-77.1	101.1	163.4	-72.7	-148	167.5	0	0	109.1	R56	R56-E58 VanDerWaalsContact C-N 3.27Å; R56-E58 PolarHBondContact O-N 3.07Å; R56-E58 VanDerWaalsContact O-N 3.09Å
59	G	53.1	Low	55	Low	65 Å²	65	164.4 Å²	164.4	67%	0.67	84%	0.842	S	S	*	*			trans	-148.1	56.2	178.3	0	0	0	0	0	111.5	G57 R61	G57-G59 PolarHBondContact O-N 3.26Å; G59-R61 PolarHBondContact O-N 3.44Å; G59-R61 VanDerWaalsContact O-N 3.11Å
60	V	51.9	Low	54.9	Low	147 Å²	147	164.7 Å²	164.7	89%	0.891	85%	0.85	S	S	*	*			trans	-65	108.8	162.5	174.1	0	0	0	0	107.3
61	R	50.7	Low	54.9	Low	238 Å²	238	163.4 Å²	163.4	90%	0.898	85%	0.85	S	S	*	*			trans	-118.4	125.5	157.3	-67.3	-168.9	179.7	168.4	2.7	106.9	G59	G59-R61 PolarHBondContact O-N 3.44Å; G59-R61 VanDerWaalsContact O-N 3.11Å
62	K	45.8	Very low	54.7	Low	276 Å²	276	162.5 Å²	162.5	100%	1.2	86%	0.855	S	S	*	*			trans	-46.4	0	-176.1	-88.4	179.9	163.5	-177.3	0	113.9

Retrieved 62 of 62 residues in 174.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).