A0A088DEG0_MOUSE Loading...

Shank3 splice variant III

AlphaFold DB , UniProt , Accession A0A088DEG0, Species MOUSE (Mus musculus, Mouse), Gene Shank3, Length 35 aa.

						>A0A088DEG0_MOUSE|A0A088DEG0|Shank3
LFERQGLPGPEKLPGSLRKGIPRTKSVGSSAASVS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	L	82.4	Confident	89	Confident	144 Å²	144	106.1 Å²	106.1	75%	0.754	55%	0.553	S	S	*	*				0	-61.6	0	-170.6	150.9	0	0	0	109.8	E3 R4 Q5	L1-E3 PolarHBondContact O-N 3.04Å; L1-R4 PolarHBondContact O-N 2.79Å; L1-R4 VanDerWaalsContact O-N 3.13Å; L1-Q5 WeakPolarHBondContact O-CG 3.33Å; L1-Q5 PolarHBondContact O-N 2.75Å; L1-Q5 VanDerWaalsContact O-N 3.1Å
2	F	86.8	Confident	89.1	Confident	75 Å²	75	109.5 Å²	109.5	33%	0.329	56%	0.56	S	S	.	*	T	Hydrogen-bonded Turn	trans	-52.7	-55.5	177	-67.4	-88	0	0	0	113.3	R4 Q5 G6 L7 P8 L13	F2-R4 PolarHBondContact O-N 3.27Å; F2-Q5 PolarHBondContact O-N 2.68Å; F2-G6 PolarHBondContact O-N 3.26Å; F2-L7 HydrophobicContact CB-CB 4.32Å; F2-L7 PolarHBondContact O-N 3.35Å; F2-L7 HydrophobicContact CD1-CD1 4.41Å; F2-L7 HydrophobicContact CD1-CB 4.01Å; F2-L7 CarbonylContact C-O 3.46Å; F2-P8 WeakPolarHBondContact CD1-O 3.4Å; F2-L13 HydrophobicContact CZ-CD1 4.25Å
3	E	87.9	Confident	89	Confident	172 Å²	172	105.3 Å²	105.3	80%	0.804	54%	0.539	S	S	*	.	G	3₁₀ helix	trans	-56.6	-37.5	177.8	-62.6	166.2	172.2	0	0	112.9	L1 Q5 G6	L1-E3 PolarHBondContact O-N 3.04Å; E3-Q5 VanDerWaalsContact C-N 3.31Å; E3-Q5 PolarHBondContact O-N 3.05Å; E3-G6 PolarHBondContact O-N 3.44Å
4	R	88.6	Confident	89.1	Confident	219 Å²	219	103.3 Å²	103.3	83%	0.826	54%	0.536	S	S	*	.	G	3₁₀ helix	trans	-72.1	-25.2	-178.9	-63.4	-177.9	176.5	-135.4	-0.6	112.8	L1 F2	L1-R4 PolarHBondContact O-N 2.79Å; L1-R4 VanDerWaalsContact O-N 3.13Å; F2-R4 PolarHBondContact O-N 3.27Å
5	Q	89.6	Confident	89	Confident	135 Å²	135	99.3 Å²	99.3	63%	0.631	53%	0.531	S	S	*	.	G	3₁₀ helix	trans	-94.8	4.5	175.5	-57	-51.4	91.2	0	0	112.6	L1 F2 E3 L7	L1-Q5 WeakPolarHBondContact O-CG 3.33Å; L1-Q5 PolarHBondContact O-N 2.75Å; L1-Q5 VanDerWaalsContact O-N 3.1Å; F2-Q5 PolarHBondContact O-N 2.68Å; E3-Q5 VanDerWaalsContact C-N 3.31Å; E3-Q5 PolarHBondContact O-N 3.05Å; Q5-L7 HydrophobicContact CB-CD1 4Å; Q5-L7 PolarHBondContact O-N 3.38Å; Q5-L7 HydrophobicContact CB-CG 3.88Å
6	G	92.3	Very high	88.6	Confident	70 Å²	70	98.5 Å²	98.5	72%	0.722	54%	0.535	S	S	*	.	T	Hydrogen-bonded Turn	trans	65.1	17.1	-171.5	0	0	0	0	0	113.4	F2 E3	F2-G6 PolarHBondContact O-N 3.26Å; E3-G6 PolarHBondContact O-N 3.44Å
7	L	90.3	Very high	88.1	Confident	90 Å²	90	98.8 Å²	98.8	47%	0.471	54%	0.535	S	S	.	.	P	Polyproline II helix	trans	-84.1	146.4	178.7	-67.4	176.1	0	0	0	110.4	F2 Q5 G9	F2-L7 HydrophobicContact CB-CB 4.32Å; F2-L7 PolarHBondContact O-N 3.35Å; F2-L7 HydrophobicContact CD1-CD1 4.41Å; F2-L7 HydrophobicContact CD1-CB 4.01Å; F2-L7 CarbonylContact C-O 3.46Å; Q5-L7 HydrophobicContact CB-CD1 4Å; Q5-L7 PolarHBondContact O-N 3.38Å; Q5-L7 HydrophobicContact CB-CG 3.88Å; L7-G9 PolarHBondContact O-N 3.27Å
8	P	89	Confident	88.1	Confident	75 Å²	75	100.7 Å²	100.7	49%	0.487	53%	0.534	S	S	.	.	P	Polyproline II helix	trans	-52.9	140.1	171.5	18.4	-29.2	0	0	0	111.1	F2 K12	F2-P8 WeakPolarHBondContact CD1-O 3.4Å; P8-K12 HydrophobicContact CB-CB 4.1Å; P8-K12 HydrophobicContact CB-CD 3.17Å; P8-K12 HydrophobicContact CB-CG 4.26Å; P8-K12 HydrophobicContact CG-CD 4.4Å
9	G	91.5	Very high	87.8	Confident	11 Å²	11	105.4 Å²	105.4	11%	0.113	55%	0.549	C	S	.	.	P	Polyproline II helix	trans	-62.5	168.1	-179.8	0	0	0	0	0	112.8	L7 E11 K12	L7-G9 PolarHBondContact O-N 3.27Å; G9-E11 PolarHBondContact N-OE1 3.15Å; G9-E11 PolarHBondContact O-N 3.07Å; G9-E11 WeakPolarHBondContact CA-OE2 3.4Å; G9-E11 WeakPolarHBondContact CA-OE1 3.22Å; G9-K12 PolarHBondContact O-N 3.03Å
10	P	89	Confident	87.4	Confident	67 Å²	67	101.9 Å²	101.9	44%	0.435	54%	0.54	S	S	.	.	G	3₁₀ helix	trans	-58.3	-22.6	-177.3	25.3	-34.3	0	0	0	112.9	K12 L13 R18	P10-K12 PolarHBondContact O-N 3.02Å; P10-L13 HydrophobicContact CB-CD1 4.38Å; P10-L13 WeakPolarHBondContact O-CB 3.49Å; P10-L13 PolarHBondContact O-N 2.91Å; P10-R18 WeakPolarHBondContact O-CD 3.36Å; P10-R18 PolarHBondContact O-NE 3.03Å; P10-R18 WeakPolarHBondContact O-CG 3.18Å
11	E	91.3	Very high	87	Confident	109 Å²	109	104.5 Å²	104.5	51%	0.509	55%	0.552	S	S	.	*	G	3₁₀ helix	trans	-61.1	-10.3	175	72.3	-74.1	168.6	0	0	114.8	G9 R18	G9-E11 PolarHBondContact N-OE1 3.15Å; G9-E11 PolarHBondContact O-N 3.07Å; G9-E11 WeakPolarHBondContact CA-OE2 3.4Å; G9-E11 WeakPolarHBondContact CA-OE1 3.22Å; E11-R18 VanDerWaalsContact C-CZ 3.46Å; E11-R18 PolarHBondContact O-NH2 3.1Å; E11-R18 PolarHBondContact O-NH1 3.2Å; E11-R18 PolarHBondContact O-NE 2.9Å
12	K	90.1	Very high	86.8	Confident	147 Å²	147	102.1 Å²	102.1	64%	0.639	55%	0.546	S	S	*	.	G	3₁₀ helix	trans	-101.6	-8.8	175	-72.1	158	-178.5	-79.8	0	113.4	P8 G9 P10	P8-K12 HydrophobicContact CB-CB 4.1Å; P8-K12 HydrophobicContact CB-CD 3.17Å; P8-K12 HydrophobicContact CB-CG 4.26Å; P8-K12 HydrophobicContact CG-CD 4.4Å; G9-K12 PolarHBondContact O-N 3.03Å; P10-K12 PolarHBondContact O-N 3.02Å
13	L	88.2	Confident	86.2	Confident	55 Å²	55	110.7 Å²	110.7	29%	0.288	58%	0.576	S	S	.	*	S	Bend	trans	-71	158.1	175.5	-61.8	176.8	0	0	0	111.3	F2 P10 L17 R18	F2-L13 HydrophobicContact CZ-CD1 4.25Å; P10-L13 HydrophobicContact CB-CD1 4.38Å; P10-L13 WeakPolarHBondContact O-CB 3.49Å; P10-L13 PolarHBondContact O-N 2.91Å; L13-L17 HydrophobicContact CB-CB 4.28Å; L13-R18 HydrophobicContact CB-CG 4Å; L13-R18 PolarHBondContact O-NE 3.23Å; L13-R18 PolarHBondContact O-NH2 3.13Å
14	P	90.6	Very high	85.2	Confident	77 Å²	77	107.6 Å²	107.6	50%	0.5	57%	0.568	S	S	.	*			trans	-59.8	146.5	169.6	6.5	-7.6	0	0	0	111.2	S16 L17 R18	P14-S16 PolarHBondContact O-N 3.47Å; P14-L17 HydrophobicContact CG-CD1 4.07Å; P14-L17 HydrophobicContact CG-CD2 4.32Å; P14-L17 PolarHBondContact O-N 3.24Å; P14-R18 PolarHBondContact O-N 3.19Å; P14-R18 VanDerWaalsContact O-N 3.15Å
15	G	88	Confident	83.9	Confident	44 Å²	44	106.8 Å²	106.8	45%	0.454	57%	0.571	S	S	.	*	H	α-helix	trans	-57.5	-28.5	-169.4	0	0	0	0	0	115.5	K19	G15-K19 WeakPolarHBondContact O-CG 3.41Å
16	S	82.9	Confident	82.7	Confident	86 Å²	86	105.2 Å²	105.2	60%	0.601	58%	0.575	S	S	*	*	H	α-helix	trans	-68.3	-36	173.9	49.6	0	0	0	0	113.1	P14	P14-S16 PolarHBondContact O-N 3.47Å
17	L	80.1	Confident	81.4	Confident	103 Å²	103	108.4 Å²	108.4	54%	0.539	58%	0.58	S	S	.	*	H	α-helix	trans	-79.7	-30.4	178.6	-81.7	68.3	0	0	0	111.8	L13 P14 K19 G20	L13-L17 HydrophobicContact CB-CB 4.28Å; P14-L17 HydrophobicContact CG-CD1 4.07Å; P14-L17 HydrophobicContact CG-CD2 4.32Å; P14-L17 PolarHBondContact O-N 3.24Å; L17-K19 PolarHBondContact O-N 3.24Å; L17-K19 VanDerWaalsContact C-N 3.26Å; L17-G20 PolarHBondContact O-N 3.45Å
18	R	87.7	Confident	80	Confident	134 Å²	134	107 Å²	107	51%	0.506	59%	0.587	S	S	.	*	H	α-helix	trans	-60.3	-37	175.2	-63.6	-166.5	-164.4	158.6	12.4	112.8	P10 E11 L13 P14 G20	P10-R18 WeakPolarHBondContact O-CD 3.36Å; P10-R18 PolarHBondContact O-NE 3.03Å; P10-R18 WeakPolarHBondContact O-CG 3.18Å; E11-R18 VanDerWaalsContact C-CZ 3.46Å; E11-R18 PolarHBondContact O-NH2 3.1Å; E11-R18 PolarHBondContact O-NH1 3.2Å; E11-R18 PolarHBondContact O-NE 2.9Å; L13-R18 HydrophobicContact CB-CG 4Å; L13-R18 PolarHBondContact O-NE 3.23Å; L13-R18 PolarHBondContact O-NH2 3.13Å; P14-R18 PolarHBondContact O-N 3.19Å; P14-R18 VanDerWaalsContact O-N 3.15Å; R18-G20 PolarHBondContact O-N 3.45Å
19	K	83	Confident	78.5	Confident	190 Å²	190	108.9 Å²	108.9	83%	0.826	60%	0.602	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78	1	-177.6	-67	178.3	-179.5	-176.4	0	112.8	G15 L17	G15-K19 WeakPolarHBondContact O-CG 3.41Å; L17-K19 PolarHBondContact O-N 3.24Å; L17-K19 VanDerWaalsContact C-N 3.26Å
20	G	77.9	Confident	77.2	Confident	35 Å²	35	114.2 Å²	114.2	36%	0.361	64%	0.638	S	S	.	*			trans	69.9	161.6	-168.3	0	0	0	0	0	111	L17 R18	L17-G20 PolarHBondContact O-N 3.45Å; R18-G20 PolarHBondContact O-N 3.45Å
21	I	80.2	Confident	75.8	Confident	156 Å²	156	114.8 Å²	114.8	80%	0.8	65%	0.648	S	S	*	*	S	Bend	trans	-66.2	127.4	168.2	-58.5	170.2	0	0	0	105.9	R23	I21-R23 PolarHBondContact O-N 2.74Å
22	P	78.4	Confident	74.3	Confident	95 Å²	95	113.8 Å²	113.8	62%	0.617	66%	0.659	S	S	*	*			trans	-46	129.9	172.7	-27	33.6	0	0	0	108.9	T24	P22-T24 HydrophobicContact CB-CG2 4.35Å; P22-T24 PolarHBondContact O-N 3.18Å; P22-T24 PolarHBondContact O-OG1 2.73Å
23	R	72.7	Confident	72.8	Confident	255 Å²	255	112.7 Å²	112.7	96%	0.962	67%	0.67	S	S	*	*			trans	-70.7	39.7	176.6	-71.6	-167	174.6	111.3	-3.6	111.9	I21 K25	I21-R23 PolarHBondContact O-N 2.74Å; R23-K25 PolarHBondContact O-N 3.45Å
24	T	67.9	Low	71.2	Confident	106 Å²	106	116.1 Å²	116.1	65%	0.65	69%	0.692	S	S	*	*	S	Bend	trans	-57	136.7	157	52.5	0	0	0	0	106.7	P22 S26	P22-T24 HydrophobicContact CB-CG2 4.35Å; P22-T24 PolarHBondContact O-N 3.18Å; P22-T24 PolarHBondContact O-OG1 2.73Å; T24-S26 VanDerWaalsContact C-N 3.32Å; T24-S26 PolarHBondContact O-N 3.32Å
25	K	62.3	Low	69.5	Low	203 Å²	203	121.8 Å²	121.8	88%	0.883	73%	0.734	S	S	*	*			trans	-51.3	102.1	174.2	-65.7	177.1	75.4	177.9	0	107.2	R23 V27	R23-K25 PolarHBondContact O-N 3.45Å; K25-V27 PolarHBondContact O-N 3.11Å
26	S	63.5	Low	68.6	Low	102 Å²	102	125.7 Å²	125.7	71%	0.713	75%	0.748	S	S	*	*			trans	-63.8	106.3	171.9	176.8	0	0	0	0	105	T24 G28	T24-S26 VanDerWaalsContact C-N 3.32Å; T24-S26 PolarHBondContact O-N 3.32Å; S26-G28 PolarHBondContact O-N 2.98Å; S26-G28 VanDerWaalsContact O-N 3.11Å
27	V	65.1	Low	67.8	Low	136 Å²	136	127.7 Å²	127.7	82%	0.824	76%	0.756	S	S	*	*			trans	-63.2	110.3	158.5	-74.4	0	0	0	0	104.2	K25	K25-V27 PolarHBondContact O-N 3.11Å
28	G	61	Low	67.1	Low	61 Å²	61	129.1 Å²	129.1	63%	0.629	77%	0.768	S	S	*	*			trans	-45.8	142.9	-159.6	0	0	0	0	0	113.6	S26 S30	S26-G28 PolarHBondContact O-N 2.98Å; S26-G28 VanDerWaalsContact O-N 3.11Å; G28-S30 PolarHBondContact O-N 3.09Å
29	S	57.8	Low	65.9	Low	114 Å²	114	128.8 Å²	128.8	80%	0.797	78%	0.783	S	S	*	*			trans	-54.6	91.4	167.7	-177	0	0	0	0	109.2	A31	S29-A31 VanDerWaalsContact C-N 3.34Å; S29-A31 PolarHBondContact O-N 2.75Å; S29-A31 VanDerWaalsContact O-N 3.09Å
30	S	63.5	Low	64.8	Low	124 Å²	124	125 Å²	125	87%	0.867	78%	0.78	S	S	*	*			trans	-71.2	95.6	164.2	-169.1	0	0	0	0	106.6	G28	G28-S30 PolarHBondContact O-N 3.09Å
31	A	59	Low	64	Low	78 Å²	78	131 Å²	131	65%	0.645	81%	0.808	S	S	*	*			trans	-148.9	83.2	168	0	0	0	0	0	108.6	S29	S29-A31 VanDerWaalsContact C-N 3.34Å; S29-A31 PolarHBondContact O-N 2.75Å; S29-A31 VanDerWaalsContact O-N 3.09Å
32	A	60	Low	62.8	Low	88 Å²	88	129.2 Å²	129.2	73%	0.727	81%	0.809	S	S	*	*			trans	45.1	92.9	137.9	0	0	0	0	0	117.9
33	S	58.5	Low	61.6	Low	125 Å²	125	131.8 Å²	131.8	87%	0.874	82%	0.824	S	S	*	*			trans	-84	89.1	133.3	59.1	0	0	0	0	108.1
34	V	55.7	Low	60.7	Low	126 Å²	126	121.6 Å²	121.6	76%	0.764	81%	0.812	S	S	*	*			trans	-133.3	91.7	160.6	179.6	0	0	0	0	107.1
35	S	53.8	Low	60	Low	196 Å²	196	123 Å²	123	100%	1.371	83%	0.827	S	S	*	*				179.6	0	125.4	17	0	0	0	0	108.8

Retrieved 35 of 35 residues in 48.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).