A0A088T1A1_HUMAN Loading...

Cystic fibrosis transmembrane conductance regulator

AlphaFold DB , UniProt , Accession A0A088T1A1, Species HUMAN (Homo sapiens, Human), Gene CFTR, Length 52 aa.

						>A0A088T1A1_HUMAN|A0A088T1A1|CFTR
VGLLGRTGSGKSTLLSAFLRLLNTEGEIQIDGVSWDSITLQQWRKVFGVIPQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	V	90.6	Very high	95.4	Very high	204 Å²	204	108.4 Å²	108.4	100%	1.236	67%	0.674	S	S	*	*				0	137	0	-180	0	0	0	0	108.2
2	G	93.9	Very high	95.4	Very high	68 Å²	68	106.2 Å²	106.2	70%	0.701	67%	0.666	S	S	*	*			trans	-102.3	138.3	175.5	0	0	0	0	0	111.4
3	L	94.8	Very high	95.4	Very high	107 Å²	107	104.5 Å²	104.5	56%	0.56	65%	0.654	S	S	*	*			trans	-109.6	115.8	175.3	-174.6	74.8	0	0	0	109.8	K11 L14	L3-K11 HydrophobicContact CD2-CB 4.12Å; L3-K11 HydrophobicContact CD2-CG 4Å; L3-K11 HydrophobicContact CG-CG 4.27Å; L3-L14 HydrophobicContact CD2-CD2 3.7Å
4	L	95.9	Very high	95.4	Very high	167 Å²	167	101.9 Å²	101.9	87%	0.874	63%	0.633	S	S	*	*			trans	-117.7	151.9	-176.3	-63.7	163.3	0	0	0	110.6
5	G	96.4	Very high	95.3	Very high	45 Å²	45	101.9 Å²	101.9	46%	0.464	63%	0.626	S	S	.	*			trans	168.3	161.4	177.3	0	0	0	0	0	112.9	K11	G5-K11 WeakPolarHBondContact O-CE 3.44Å; G5-K11 PolarHBondContact O-NZ 3.42Å
6	R	97.3	Very high	95.3	Very high	220 Å²	220	97.9 Å²	97.9	83%	0.83	60%	0.604	S	S	*	*			trans	-60.4	161.6	177	-65.1	-175	-70	-176.4	-1.6	112.1	G8 S9 K11	R6-G8 PolarHBondContact O-N 2.89Å; R6-S9 WeakPolarHBondContact O-CB 3.39Å; R6-S9 PolarHBondContact O-N 2.8Å; R6-S9 VanDerWaalsContact O-N 3.13Å; R6-S9 PolarHBondContact O-OG 2.63Å; R6-K11 PolarHBondContact O-NZ 3.34Å
7	T	96.4	Very high	95.3	Very high	147 Å²	147	92.9 Å²	92.9	90%	0.902	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.4	139.2	169.5	-56.5	0	0	0	0	110.1	S9	T7-S9 VanDerWaalsContact C-N 3.29Å; T7-S9 PolarHBondContact O-N 3Å
8	G	95.3	Very high	95.2	Very high	80 Å²	80	91.9 Å²	91.9	83%	0.825	56%	0.561	S	S	*	*	T	Hydrogen-bonded Turn	trans	80.8	-2.8	-175.5	0	0	0	0	0	115.4	R6 G10	R6-G8 PolarHBondContact O-N 2.89Å; G8-G10 PolarHBondContact O-N 3.14Å
9	S	96.6	Very high	95.2	Very high	68 Å²	68	88.7 Å²	88.7	48%	0.476	54%	0.54	S	S	.	.	S	Bend	trans	-72.1	6.4	179.7	76.9	0	0	0	0	115.2	R6 T7 K11	R6-S9 WeakPolarHBondContact O-CB 3.39Å; R6-S9 PolarHBondContact O-N 2.8Å; R6-S9 VanDerWaalsContact O-N 3.13Å; R6-S9 PolarHBondContact O-OG 2.63Å; T7-S9 VanDerWaalsContact C-N 3.29Å; T7-S9 PolarHBondContact O-N 3Å; S9-K11 PolarHBondContact OG-NZ 3.37Å
10	G	95.9	Very high	95.1	Very high	29 Å²	29	87.8 Å²	87.8	30%	0.299	53%	0.526	S	S	.	.	S	Bend	trans	84.6	9.6	177.3	0	0	0	0	0	116.8	G8 S12 T13 L14	G8-G10 PolarHBondContact O-N 3.14Å; G10-S12 PolarHBondContact O-N 3.29Å; G10-T13 CarbonylContact O-C 3.58Å; G10-T13 WeakPolarHBondContact O-CB 3.15Å; G10-T13 PolarHBondContact O-N 3.25Å; G10-T13 VanDerWaalsContact O-N 3.16Å; G10-L14 PolarHBondContact O-N 3.1Å
11	K	96.3	Very high	95.1	Very high	57 Å²	57	88.5 Å²	88.5	25%	0.248	53%	0.527	C	S	.	.	H	α-helix	trans	-56.8	-50.2	178.9	-61.4	177.7	-60.4	-67.7	0	112.7	L3 G5 R6 S9 T13 L14 L15	L3-K11 HydrophobicContact CD2-CB 4.12Å; L3-K11 HydrophobicContact CD2-CG 4Å; L3-K11 HydrophobicContact CG-CG 4.27Å; G5-K11 WeakPolarHBondContact O-CE 3.44Å; G5-K11 PolarHBondContact O-NZ 3.42Å; R6-K11 PolarHBondContact O-NZ 3.34Å; S9-K11 PolarHBondContact OG-NZ 3.37Å; K11-T13 VanDerWaalsContact C-N 3.31Å; K11-T13 PolarHBondContact O-N 2.98Å; K11-L14 PolarHBondContact O-N 3.04Å; K11-L15 PolarHBondContact O-N 2.68Å
12	S	95.1	Very high	95.3	Very high	82 Å²	82	81.9 Å²	81.9	57%	0.573	48%	0.484	S	S	*	.	H	α-helix	trans	-67.4	-34.2	176.8	-47.8	0	0	0	0	111.7	G10 L14 L15 S16	G10-S12 PolarHBondContact O-N 3.29Å; S12-L14 VanDerWaalsContact C-N 3.33Å; S12-L14 PolarHBondContact O-N 3.24Å; S12-L15 PolarHBondContact O-N 2.95Å; S12-S16 PolarHBondContact O-N 3.31Å; S12-S16 PolarHBondContact O-OG 2.76Å
13	T	95.9	Very high	95.2	Very high	84 Å²	84	86.8 Å²	86.8	52%	0.515	49%	0.494	S	S	.	.	H	α-helix	trans	-62.2	-40.8	173.8	-47.5	0	0	0	0	111.4	G10 K11 S16 A17 L22	G10-T13 CarbonylContact O-C 3.58Å; G10-T13 WeakPolarHBondContact O-CB 3.15Å; G10-T13 PolarHBondContact O-N 3.25Å; G10-T13 VanDerWaalsContact O-N 3.16Å; K11-T13 VanDerWaalsContact C-N 3.31Å; K11-T13 PolarHBondContact O-N 2.98Å; T13-S16 PolarHBondContact O-N 3.08Å; T13-A17 WeakPolarHBondContact O-CB 3.44Å; T13-A17 PolarHBondContact O-N 2.81Å; T13-L22 HydrophobicContact CG2-CD2 3.86Å
14	L	95.1	Very high	95.2	Very high	68 Å²	68	84.3 Å²	84.3	36%	0.356	48%	0.484	S	S	.	.	H	α-helix	trans	-64.6	-43.1	176.4	-175.6	64.9	0	0	0	111.8	L3 G10 K11 S12 S16 A17 F18	L3-L14 HydrophobicContact CD2-CD2 3.7Å; G10-L14 PolarHBondContact O-N 3.1Å; K11-L14 PolarHBondContact O-N 3.04Å; S12-L14 VanDerWaalsContact C-N 3.33Å; S12-L14 PolarHBondContact O-N 3.24Å; L14-S16 VanDerWaalsContact C-N 3.31Å; L14-S16 PolarHBondContact O-N 3.19Å; L14-A17 WeakPolarHBondContact O-CB 3.28Å; L14-A17 PolarHBondContact O-N 3.18Å; L14-A17 VanDerWaalsContact O-N 3.16Å; L14-F18 HydrophobicContact CD1-CD1 4.47Å; L14-F18 HydrophobicContact CD1-CE1 3.81Å; L14-F18 HydrophobicContact CD1-CE2 4.43Å; L14-F18 HydrophobicContact CD1-CZ 3.79Å; L14-F18 HydrophobicContact CD2-CE2 4.24Å; L14-F18 HydrophobicContact CD2-CZ 4.05Å; L14-F18 HydrophobicContact CG-CE1 4.23Å; L14-F18 HydrophobicContact CG-CE2 3.94Å; L14-F18 HydrophobicContact CG-CZ 3.78Å; L14-F18 WeakPolarHBondContact O-CG 3.31Å; L14-F18 PolarHBondContact O-N 3.5Å
15	L	94.5	Very high	95.1	Very high	102 Å²	102	85.9 Å²	85.9	53%	0.534	49%	0.487	S	S	.	.	H	α-helix	trans	-59.4	-44.2	173.7	-68.1	174.9	0	0	0	111.3	K11 S12 A17 F18 L19	K11-L15 PolarHBondContact O-N 2.68Å; S12-L15 PolarHBondContact O-N 2.95Å; L15-A17 VanDerWaalsContact C-N 3.31Å; L15-A17 PolarHBondContact O-N 3.5Å; L15-F18 PolarHBondContact O-N 2.96Å; L15-L19 WeakPolarHBondContact O-CG 3.46Å; L15-L19 PolarHBondContact O-N 2.77Å; L15-L19 VanDerWaalsContact O-N 3.08Å
16	S	94.8	Very high	94.9	Very high	38 Å²	38	86.7 Å²	86.7	27%	0.266	50%	0.495	S	S	.	.	H	α-helix	trans	-64.2	-33.6	175.6	-66	0	0	0	0	113	S12 T13 L14 L19 R20 L21	S12-S16 PolarHBondContact O-N 3.31Å; S12-S16 PolarHBondContact O-OG 2.76Å; T13-S16 PolarHBondContact O-N 3.08Å; L14-S16 VanDerWaalsContact C-N 3.31Å; L14-S16 PolarHBondContact O-N 3.19Å; S16-L19 PolarHBondContact O-N 3.49Å; S16-R20 PolarHBondContact O-N 2.96Å; S16-R20 VanDerWaalsContact O-N 3.14Å; S16-L21 PolarHBondContact O-N 3.35Å
17	A	94.8	Very high	94.8	Very high	14 Å²	14	81.6 Å²	81.6	12%	0.116	48%	0.481	C	S	.	.	H	α-helix	trans	-65	-45.8	173.3	0	0	0	0	0	111.5	T13 L14 L15 L19 R20 L22 T24	T13-A17 WeakPolarHBondContact O-CB 3.44Å; T13-A17 PolarHBondContact O-N 2.81Å; L14-A17 WeakPolarHBondContact O-CB 3.28Å; L14-A17 PolarHBondContact O-N 3.18Å; L14-A17 VanDerWaalsContact O-N 3.16Å; L15-A17 VanDerWaalsContact C-N 3.31Å; L15-A17 PolarHBondContact O-N 3.5Å; A17-L19 VanDerWaalsContact C-N 3.28Å; A17-L19 PolarHBondContact O-N 3.28Å; A17-R20 WeakPolarHBondContact O-CA 3.12Å; A17-R20 PolarHBondContact O-N 3.28Å; A17-L22 HydrophobicContact CB-CD1 4.17Å; A17-T24 HydrophobicContact CB-CG2 3.74Å
18	F	94.7	Very high	94.7	Very high	75 Å²	75	76.7 Å²	76.7	33%	0.329	45%	0.448	S	S	.	.	H	α-helix	trans	-60	-38.3	175.5	-66.1	-20.7	0	0	0	112.6	L14 L15 R20 I28 W43 F47	L14-F18 HydrophobicContact CD1-CD1 4.47Å; L14-F18 HydrophobicContact CD1-CE1 3.81Å; L14-F18 HydrophobicContact CD1-CE2 4.43Å; L14-F18 HydrophobicContact CD1-CZ 3.79Å; L14-F18 HydrophobicContact CD2-CE2 4.24Å; L14-F18 HydrophobicContact CD2-CZ 4.05Å; L14-F18 HydrophobicContact CG-CE1 4.23Å; L14-F18 HydrophobicContact CG-CE2 3.94Å; L14-F18 HydrophobicContact CG-CZ 3.78Å; L14-F18 WeakPolarHBondContact O-CG 3.31Å; L14-F18 PolarHBondContact O-N 3.5Å; L15-F18 PolarHBondContact O-N 2.96Å; F18-R20 PolarHBondContact O-N 3.04Å; F18-I28 HydrophobicContact CD1-CD1 3.56Å; F18-I28 HydrophobicContact CE1-CD1 3.9Å; F18-W43 PolarHBondContact O-NE1 2.8Å; F18-F47 HydrophobicContact CB-CE1 4.07Å; F18-F47 HydrophobicContact CB-CZ 4.26Å
19	L	94.4	Very high	94.8	Very high	30 Å²	30	78.1 Å²	78.1	16%	0.157	43%	0.434	C	S	.	.	T	Hydrogen-bonded Turn	trans	-80.4	1.3	176	-62.3	174.8	0	0	0	113.6	L15 S16 A17 L21 R44 F47 V49	L15-L19 WeakPolarHBondContact O-CG 3.46Å; L15-L19 PolarHBondContact O-N 2.77Å; L15-L19 VanDerWaalsContact O-N 3.08Å; S16-L19 PolarHBondContact O-N 3.49Å; A17-L19 VanDerWaalsContact C-N 3.28Å; A17-L19 PolarHBondContact O-N 3.28Å; L19-L21 HydrophobicContact CB-CD1 3.87Å; L19-L21 HydrophobicContact CB-CG 3.78Å; L19-L21 HydrophobicContact CD1-CD1 3.92Å; L19-L21 PolarHBondContact O-N 3.18Å; L19-R44 PolarHBondContact O-NE 3.2Å; L19-R44 PolarHBondContact O-NH2 3.45Å; L19-F47 HydrophobicContact CD2-CB 3.74Å; L19-F47 HydrophobicContact CD2-CD1 4.49Å; L19-F47 HydrophobicContact CD2-CD2 4.08Å; L19-F47 HydrophobicContact CD2-CG 3.85Å; L19-V49 HydrophobicContact CD1-CG2 3.91Å; L19-V49 HydrophobicContact CD2-CG2 3.9Å; L19-V49 HydrophobicContact CG-CG2 4.4Å
20	R	94.1	Very high	94.7	Very high	70 Å²	70	77.6 Å²	77.6	26%	0.264	43%	0.425	S	S	.	.	T	Hydrogen-bonded Turn	trans	48.6	48.1	-174	-60.4	177.4	77.1	167.7	16.5	111.3	S16 A17 F18 W35 D36 L40 R44	S16-R20 PolarHBondContact O-N 2.96Å; S16-R20 VanDerWaalsContact O-N 3.14Å; A17-R20 WeakPolarHBondContact O-CA 3.12Å; A17-R20 PolarHBondContact O-N 3.28Å; F18-R20 PolarHBondContact O-N 3.04Å; R20-W35 HydrophobicContact CG-CE3 3.68Å; R20-W35 HydrophobicContact CG-CZ3 3.8Å; R20-W35 PolarHBondContact NH1-O 3.45Å; R20-D36 IonicContact CZ-OD1 3.86Å; R20-D36 IonicContact NH2-OD1 3.04Å; R20-D36 PolarHBondContact NH2-OD1 2.86Å; R20-L40 HydrophobicContact CB-CD1 3.59Å; R20-L40 HydrophobicContact CG-CD1 4.31Å; R20-R44 PolarHBondContact O-NH2 3.48Å
21	L	94.3	Very high	94.7	Very high	104 Å²	104	84 Å²	84	55%	0.545	45%	0.452	S	S	.	.			trans	-92.1	-7.2	174.8	-65.5	172.9	0	0	0	112.4	S16 L19	S16-L21 PolarHBondContact O-N 3.35Å; L19-L21 HydrophobicContact CB-CD1 3.87Å; L19-L21 HydrophobicContact CB-CG 3.78Å; L19-L21 HydrophobicContact CD1-CD1 3.92Å; L19-L21 PolarHBondContact O-N 3.18Å
22	L	94.4	Very high	94.7	Very high	64 Å²	64	84.2 Å²	84.2	34%	0.335	47%	0.471	S	S	.	.	S	Bend	trans	-138.4	158.4	176.8	56.1	96.7	0	0	0	109.4	T13 A17 T24	T13-L22 HydrophobicContact CG2-CD2 3.86Å; A17-L22 HydrophobicContact CB-CD1 4.17Å; L22-T24 HydrophobicContact CD1-CG2 3.41Å; L22-T24 VanDerWaalsContact CD1-CG2 3.41Å; L22-T24 HydrophobicContact CG-CG2 4.41Å
23	N	93.3	Very high	94.7	Very high	171 Å²	171	83.4 Å²	83.4	91%	0.914	46%	0.462	S	S	*	.			trans	-71.1	130.7	175.3	-67.8	-21.9	0	0	0	109.7
24	T	92.9	Very high	94.7	Very high	56 Å²	56	80.1 Å²	80.1	34%	0.344	44%	0.443	S	S	.	.			trans	-132.8	151.2	-175.5	51.4	0	0	0	0	110.2	A17 L22 W35	A17-T24 HydrophobicContact CB-CG2 3.74Å; L22-T24 HydrophobicContact CD1-CG2 3.41Å; L22-T24 VanDerWaalsContact CD1-CG2 3.41Å; L22-T24 HydrophobicContact CG-CG2 4.41Å; T24-W35 WeakPolarHBondContact OG1-CH2 3.44Å
25	E	94.4	Very high	94.7	Very high	199 Å²	199	77.3 Å²	77.3	93%	0.93	43%	0.428	S	S	*	.			trans	-106.7	153.3	167.9	-65	177	-171.4	0	0	109.8
26	G	93.6	Very high	94.7	Very high	62 Å²	62	77.4 Å²	77.4	64%	0.639	43%	0.429	S	S	*	.	S	Bend	trans	100.5	-164.8	-178.1	0	0	0	0	0	113.5	W35	G26-W35 WeakPolarHBondContact O-CZ2 3.43Å
27	E	93.8	Very high	94.8	Very high	114 Å²	114	79.4 Å²	79.4	53%	0.533	44%	0.443	S	S	.	.			trans	-135.1	141.5	-175.5	-174.3	177.8	-170.7	0	0	111	Q29 S34	E27-Q29 VanDerWaalsContact CD-NE2 3.33Å; E27-Q29 HydrophobicContact CG-CG 4.15Å; E27-Q29 PolarHBondContact OE1-NE2 3.08Å; E27-S34 WeakPolarHBondContact OE1-CB 3.48Å; E27-S34 PolarHBondContact OE1-OG 3.14Å
28	I	95.2	Very high	94.8	Very high	43 Å²	43	81.2 Å²	81.2	22%	0.221	45%	0.45	C	S	.	.			trans	-122.9	131.3	168.7	-52.3	-175.8	0	0	0	108.5	F18 W35 W43	F18-I28 HydrophobicContact CD1-CD1 3.56Å; F18-I28 HydrophobicContact CE1-CD1 3.9Å; I28-W35 HydrophobicContact CB-CD2 4.05Å; I28-W35 HydrophobicContact CB-CE3 3.96Å; I28-W35 HydrophobicContact CB-CG 4.47Å; I28-W35 HydrophobicContact CB-CZ3 4.29Å; I28-W35 HydrophobicContact CD1-CE3 3.92Å; I28-W35 HydrophobicContact CD1-CH2 3.91Å; I28-W35 HydrophobicContact CD1-CZ3 3.46Å; I28-W35 VanDerWaalsContact CD1-CZ3 3.46Å; I28-W35 HydrophobicContact CG1-CD2 4.28Å; I28-W35 HydrophobicContact CG1-CE3 3.95Å; I28-W35 HydrophobicContact CG1-CH2 3.88Å; I28-W35 HydrophobicContact CG1-CZ2 4.23Å; I28-W35 HydrophobicContact CG1-CZ3 3.74Å; I28-W35 PolarHBondContact O-N 3.34Å; I28-W43 HydrophobicContact CB-CH2 4.08Å; I28-W43 HydrophobicContact CB-CZ2 4.12Å; I28-W43 HydrophobicContact CG2-CH2 3.74Å; I28-W43 HydrophobicContact CG2-CZ2 3.87Å
29	Q	96.3	Very high	94.9	Very high	111 Å²	111	81.4 Å²	81.4	52%	0.519	46%	0.458	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.5	136	174.9	-60.8	-177.9	-5.2	0	0	110	E27 V33	E27-Q29 VanDerWaalsContact CD-NE2 3.33Å; E27-Q29 HydrophobicContact CG-CG 4.15Å; E27-Q29 PolarHBondContact OE1-NE2 3.08Å; Q29-V33 VanDerWaalsContact CA-O 3.28Å; Q29-V33 WeakPolarHBondContact CA-O 3.27Å
30	I	95.4	Very high	95	Very high	57 Å²	57	83.4 Å²	83.4	29%	0.292	47%	0.468	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.5	122.6	170.8	-64.8	171.5	0	0	0	106.8	G32 V33 W43 V46 F47	I30-G32 PolarHBondContact O-N 3.42Å; I30-G32 VanDerWaalsContact O-N 3.14Å; I30-V33 PolarHBondContact N-O 3.29Å; I30-V33 WeakPolarHBondContact O-CB 3.29Å; I30-V33 PolarHBondContact O-N 3.33Å; I30-W43 HydrophobicContact CB-CH2 4.43Å; I30-W43 HydrophobicContact CB-CZ3 4.32Å; I30-W43 HydrophobicContact CD1-CE3 4.45Å; I30-W43 HydrophobicContact CD1-CH2 3.43Å; I30-W43 VanDerWaalsContact CD1-CH2 3.43Å; I30-W43 HydrophobicContact CD1-CZ2 3.89Å; I30-W43 HydrophobicContact CD1-CZ3 3.74Å; I30-W43 HydrophobicContact CG1-CH2 3.61Å; I30-W43 HydrophobicContact CG1-CZ2 4.44Å; I30-W43 HydrophobicContact CG1-CZ3 3.96Å; I30-V46 HydrophobicContact CD1-CG2 3.87Å; I30-F47 HydrophobicContact CD1-CE1 4.49Å; I30-F47 HydrophobicContact CD1-CE2 4.25Å; I30-F47 HydrophobicContact CD1-CZ 3.78Å
31	D	95.5	Very high	95.1	Very high	162 Å²	162	86.5 Å²	86.5	87%	0.866	49%	0.485	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.9	35.6	-177.5	-55.7	-37.6	0	0	0	113.5	V33	D31-V33 VanDerWaalsContact C-N 3.28Å; D31-V33 PolarHBondContact O-N 2.99Å
32	G	96.3	Very high	95.2	Very high	62 Å²	62	86.5 Å²	86.5	64%	0.639	48%	0.483	S	S	*	.	T	Hydrogen-bonded Turn	trans	79.4	0.9	-177.8	0	0	0	0	0	115.2	I30	I30-G32 PolarHBondContact O-N 3.42Å; I30-G32 VanDerWaalsContact O-N 3.14Å
33	V	95.5	Very high	95.3	Very high	65 Å²	65	83.6 Å²	83.6	39%	0.394	47%	0.467	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.3	118	175.8	-177.9	0	0	0	0	109.7	Q29 I30 D31 S37 I38	Q29-V33 VanDerWaalsContact CA-O 3.28Å; Q29-V33 WeakPolarHBondContact CA-O 3.27Å; I30-V33 PolarHBondContact N-O 3.29Å; I30-V33 WeakPolarHBondContact O-CB 3.29Å; I30-V33 PolarHBondContact O-N 3.33Å; D31-V33 VanDerWaalsContact C-N 3.28Å; D31-V33 PolarHBondContact O-N 2.99Å; V33-S37 WeakPolarHBondContact CG1-OG 3.5Å; V33-I38 HydrophobicContact CG1-CG2 3.92Å
34	S	95.3	Very high	95.5	Very high	16 Å²	16	80 Å²	80	11%	0.112	44%	0.441	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.5	139.7	175.5	-174.5	0	0	0	0	111.7	E27 D36 S37	E27-S34 WeakPolarHBondContact OE1-CB 3.48Å; E27-S34 PolarHBondContact OE1-OG 3.14Å; S34-D36 PolarHBondContact O-N 3.16Å; S34-D36 VanDerWaalsContact O-N 3.1Å; S34-S37 WeakPolarHBondContact O-CB 3.16Å; S34-S37 PolarHBondContact O-N 2.95Å; S34-S37 PolarHBondContact O-OG 2.84Å
35	W	95.2	Very high	95.6	Very high	8 Å²	8	84.6 Å²	84.6	3%	0.03	46%	0.456	C	S	.	.	T	Hydrogen-bonded Turn	trans	-60	-17.7	174.7	65.8	-8.8	0	0	0	114.7	R20 T24 G26 I28 W43	R20-W35 HydrophobicContact CG-CE3 3.68Å; R20-W35 HydrophobicContact CG-CZ3 3.8Å; R20-W35 PolarHBondContact NH1-O 3.45Å; T24-W35 WeakPolarHBondContact OG1-CH2 3.44Å; G26-W35 WeakPolarHBondContact O-CZ2 3.43Å; I28-W35 HydrophobicContact CB-CD2 4.05Å; I28-W35 HydrophobicContact CB-CE3 3.96Å; I28-W35 HydrophobicContact CB-CG 4.47Å; I28-W35 HydrophobicContact CB-CZ3 4.29Å; I28-W35 HydrophobicContact CD1-CE3 3.92Å; I28-W35 HydrophobicContact CD1-CH2 3.91Å; I28-W35 HydrophobicContact CD1-CZ3 3.46Å; I28-W35 VanDerWaalsContact CD1-CZ3 3.46Å; I28-W35 HydrophobicContact CG1-CD2 4.28Å; I28-W35 HydrophobicContact CG1-CE3 3.95Å; I28-W35 HydrophobicContact CG1-CH2 3.88Å; I28-W35 HydrophobicContact CG1-CZ2 4.23Å; I28-W35 HydrophobicContact CG1-CZ3 3.74Å; I28-W35 PolarHBondContact O-N 3.34Å; W35-W43 HydrophobicContact CB-CD2 3.68Å; W35-W43 HydrophobicContact CB-CE3 3.54Å; W35-W43 HydrophobicContact CB-CG 4.47Å; W35-W43 HydrophobicContact CB-CH2 3.69Å; W35-W43 HydrophobicContact CB-CZ2 3.83Å; W35-W43 HydrophobicContact CB-CZ3 3.55Å; W35-W43 HydrophobicContact CE3-CZ2 4.13Å
36	D	94.5	Very high	95.6	Very high	104 Å²	104	79.6 Å²	79.6	56%	0.556	44%	0.439	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.5	-12.9	178.1	-67.2	-40.4	0	0	0	111.7	R20 S34	R20-D36 IonicContact CZ-OD1 3.86Å; R20-D36 IonicContact NH2-OD1 3.04Å; R20-D36 PolarHBondContact NH2-OD1 2.86Å; S34-D36 PolarHBondContact O-N 3.16Å; S34-D36 VanDerWaalsContact O-N 3.1Å
37	S	96.4	Very high	95.7	Very high	81 Å²	81	79.6 Å²	79.6	57%	0.566	42%	0.421	S	S	*	.	S	Bend	trans	-85.5	-7.8	175.9	72.5	0	0	0	0	113.8	V33 S34	V33-S37 WeakPolarHBondContact CG1-OG 3.5Å; S34-S37 WeakPolarHBondContact O-CB 3.16Å; S34-S37 PolarHBondContact O-N 2.95Å; S34-S37 PolarHBondContact O-OG 2.84Å
38	I	96	Very high	95.7	Very high	52 Å²	52	78.1 Å²	78.1	27%	0.267	44%	0.437	S	S	.	.	S	Bend	trans	-133.6	164.2	-177.7	68.2	172.8	0	0	0	112.4	V33 Q42 W43	V33-I38 HydrophobicContact CG1-CG2 3.92Å; I38-Q42 HydrophobicContact CB-CB 4.44Å; I38-Q42 HydrophobicContact CD1-CB 4.13Å; I38-W43 HydrophobicContact CD1-CB 3.97Å; I38-W43 HydrophobicContact CD1-CE3 3.9Å; I38-W43 HydrophobicContact CG1-CB 4.23Å; I38-W43 HydrophobicContact CG1-CE3 4.38Å
39	T	96.7	Very high	95.6	Very high	79 Å²	79	80 Å²	80	49%	0.485	45%	0.45	S	S	.	.			trans	-70.7	152.2	177.8	67	0	0	0	0	112	Q41 Q42 W43	T39-Q41 PolarHBondContact O-N 3.32Å; T39-Q42 VanDerWaalsContact N-OE1 3.09Å; T39-Q42 PolarHBondContact O-N 3.31Å; T39-Q42 VanDerWaalsContact O-N 3.08Å; T39-Q42 WeakPolarHBondContact OG1-CB 3.34Å; T39-Q42 VanDerWaalsContact OG1-CD 3.3Å; T39-Q42 VanDerWaalsContact OG1-CG 3.27Å; T39-Q42 WeakPolarHBondContact OG1-CG 3.45Å; T39-Q42 PolarHBondContact OG1-N 2.83Å; T39-Q42 PolarHBondContact OG1-OE1 2.78Å; T39-W43 PolarHBondContact O-N 3.2Å
40	L	95.5	Very high	95.4	Very high	71 Å²	71	82.4 Å²	82.4	37%	0.372	47%	0.465	S	S	.	.	H	α-helix	trans	-53.8	-38.2	175.9	-178	64	0	0	0	112.9	R20 R44	R20-L40 HydrophobicContact CB-CD1 3.59Å; R20-L40 HydrophobicContact CG-CD1 4.31Å; L40-R44 HydrophobicContact CD1-CG 4.41Å; L40-R44 WeakPolarHBondContact O-CB 3.38Å; L40-R44 WeakPolarHBondContact O-CG 3.49Å; L40-R44 PolarHBondContact O-N 2.81Å
41	Q	96.8	Very high	94.7	Very high	136 Å²	136	85.1 Å²	85.1	64%	0.636	49%	0.486	S	S	*	.	H	α-helix	trans	-68.8	-41.3	179	-170.3	-175.1	4.3	0	0	111.8	T39 R44 K45	T39-Q41 PolarHBondContact O-N 3.32Å; Q41-R44 PolarHBondContact O-N 3.16Å; Q41-K45 VanDerWaalsContact O-CG 3.31Å; Q41-K45 WeakPolarHBondContact O-CG 3.36Å; Q41-K45 PolarHBondContact O-N 2.86Å
42	Q	96.6	Very high	93.2	Very high	104 Å²	104	89.9 Å²	89.9	49%	0.486	50%	0.503	S	S	.	.	H	α-helix	trans	-64.6	-44	175.4	-73.7	165.5	-48.6	0	0	111.1	I38 T39 R44 K45	I38-Q42 HydrophobicContact CB-CB 4.44Å; I38-Q42 HydrophobicContact CD1-CB 4.13Å; T39-Q42 VanDerWaalsContact N-OE1 3.09Å; T39-Q42 PolarHBondContact O-N 3.31Å; T39-Q42 VanDerWaalsContact O-N 3.08Å; T39-Q42 WeakPolarHBondContact OG1-CB 3.34Å; T39-Q42 VanDerWaalsContact OG1-CD 3.3Å; T39-Q42 VanDerWaalsContact OG1-CG 3.27Å; T39-Q42 WeakPolarHBondContact OG1-CG 3.45Å; T39-Q42 PolarHBondContact OG1-N 2.83Å; T39-Q42 PolarHBondContact OG1-OE1 2.78Å; Q42-R44 PolarHBondContact O-N 3.45Å; Q42-K45 PolarHBondContact O-N 2.98Å
43	W	96.8	Very high	93.1	Very high	3 Å²	3	91.3 Å²	91.3	1%	0.011	50%	0.496	C	S	.	.	H	α-helix	trans	-58.5	-48.6	175.3	-178	-99.8	0	0	0	112	F18 I28 I30 W35 I38 T39 K45 V46 F47	F18-W43 PolarHBondContact O-NE1 2.8Å; I28-W43 HydrophobicContact CB-CH2 4.08Å; I28-W43 HydrophobicContact CB-CZ2 4.12Å; I28-W43 HydrophobicContact CG2-CH2 3.74Å; I28-W43 HydrophobicContact CG2-CZ2 3.87Å; I30-W43 HydrophobicContact CB-CH2 4.43Å; I30-W43 HydrophobicContact CB-CZ3 4.32Å; I30-W43 HydrophobicContact CD1-CE3 4.45Å; I30-W43 HydrophobicContact CD1-CH2 3.43Å; I30-W43 VanDerWaalsContact CD1-CH2 3.43Å; I30-W43 HydrophobicContact CD1-CZ2 3.89Å; I30-W43 HydrophobicContact CD1-CZ3 3.74Å; I30-W43 HydrophobicContact CG1-CH2 3.61Å; I30-W43 HydrophobicContact CG1-CZ2 4.44Å; I30-W43 HydrophobicContact CG1-CZ3 3.96Å; W35-W43 HydrophobicContact CB-CD2 3.68Å; W35-W43 HydrophobicContact CB-CE3 3.54Å; W35-W43 HydrophobicContact CB-CG 4.47Å; W35-W43 HydrophobicContact CB-CH2 3.69Å; W35-W43 HydrophobicContact CB-CZ2 3.83Å; W35-W43 HydrophobicContact CB-CZ3 3.55Å; W35-W43 HydrophobicContact CE3-CZ2 4.13Å; I38-W43 HydrophobicContact CD1-CB 3.97Å; I38-W43 HydrophobicContact CD1-CE3 3.9Å; I38-W43 HydrophobicContact CG1-CB 4.23Å; I38-W43 HydrophobicContact CG1-CE3 4.38Å; T39-W43 PolarHBondContact O-N 3.2Å; W43-K45 PolarHBondContact O-N 3.13Å; W43-V46 WeakPolarHBondContact O-CG2 3.49Å; W43-V46 PolarHBondContact O-N 3.42Å; W43-F47 AromaticContact CD1-CE2 3.85Å; W43-F47 HydrophobicContact CD2-CE2 4.2Å; W43-F47 AromaticContact CE2-CE2 3.65Å; W43-F47 AromaticContact CE2-CZ 3.94Å; W43-F47 HydrophobicContact CG-CE2 4.33Å; W43-F47 HydrophobicContact CZ2-CE2 4.09Å; W43-F47 AromaticContact CZ2-CZ 3.91Å; W43-F47 HydrophobicContact CZ2-CZ 3.91Å; W43-F47 AromaticContact NE1-CE2 3.42Å; W43-F47 AromaticContact NE1-CZ 3.92Å; W43-F47 VanDerWaalsContact O-CD2 3.29Å; W43-F47 WeakPolarHBondContact O-CD2 3.47Å; W43-F47 WeakPolarHBondContact O-CE2 3.16Å
44	R	96	Very high	92.9	Very high	94 Å²	94	92.6 Å²	92.6	36%	0.355	50%	0.502	S	S	.	.	H	α-helix	trans	-65.6	-24.9	-179.8	-73.5	177.9	178.8	169	4.1	113.7	L19 R20 L40 Q41 Q42 V46 F47	L19-R44 PolarHBondContact O-NE 3.2Å; L19-R44 PolarHBondContact O-NH2 3.45Å; R20-R44 PolarHBondContact O-NH2 3.48Å; L40-R44 HydrophobicContact CD1-CG 4.41Å; L40-R44 WeakPolarHBondContact O-CB 3.38Å; L40-R44 WeakPolarHBondContact O-CG 3.49Å; L40-R44 PolarHBondContact O-N 2.81Å; Q41-R44 PolarHBondContact O-N 3.16Å; Q42-R44 PolarHBondContact O-N 3.45Å; R44-V46 VanDerWaalsContact C-N 3.26Å; R44-V46 PolarHBondContact O-N 3.03Å; R44-F47 PolarHBondContact O-N 3.47Å
45	K	95.9	Very high	92.8	Very high	154 Å²	154	96.9 Å²	96.9	67%	0.67	52%	0.523	S	S	*	.	H	α-helix	trans	-68.2	-21.3	178.8	-81	175.6	179	-177.2	0	113.9	Q41 Q42 W43 F47	Q41-K45 VanDerWaalsContact O-CG 3.31Å; Q41-K45 WeakPolarHBondContact O-CG 3.36Å; Q41-K45 PolarHBondContact O-N 2.86Å; Q42-K45 PolarHBondContact O-N 2.98Å; W43-K45 PolarHBondContact O-N 3.13Å; K45-F47 VanDerWaalsContact C-N 3.3Å
46	V	94.9	Very high	92.7	Very high	94 Å²	94	102.1 Å²	102.1	57%	0.57	55%	0.552	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.5	-10.5	178.7	-55.3	0	0	0	0	113.1	I30 W43 R44	I30-V46 HydrophobicContact CD1-CG2 3.87Å; W43-V46 WeakPolarHBondContact O-CG2 3.49Å; W43-V46 PolarHBondContact O-N 3.42Å; R44-V46 VanDerWaalsContact C-N 3.26Å; R44-V46 PolarHBondContact O-N 3.03Å
47	F	95.1	Very high	92.6	Very high	61 Å²	61	102 Å²	102	27%	0.268	55%	0.552	S	S	.	*			trans	-99.1	126.9	179.1	-62.7	-87.5	0	0	0	111.4	F18 L19 I30 W43 R44 K45 V49	F18-F47 HydrophobicContact CB-CE1 4.07Å; F18-F47 HydrophobicContact CB-CZ 4.26Å; L19-F47 HydrophobicContact CD2-CB 3.74Å; L19-F47 HydrophobicContact CD2-CD1 4.49Å; L19-F47 HydrophobicContact CD2-CD2 4.08Å; L19-F47 HydrophobicContact CD2-CG 3.85Å; I30-F47 HydrophobicContact CD1-CE1 4.49Å; I30-F47 HydrophobicContact CD1-CE2 4.25Å; I30-F47 HydrophobicContact CD1-CZ 3.78Å; W43-F47 AromaticContact CD1-CE2 3.85Å; W43-F47 HydrophobicContact CD2-CE2 4.2Å; W43-F47 AromaticContact CE2-CE2 3.65Å; W43-F47 AromaticContact CE2-CZ 3.94Å; W43-F47 HydrophobicContact CG-CE2 4.33Å; W43-F47 HydrophobicContact CZ2-CE2 4.09Å; W43-F47 AromaticContact CZ2-CZ 3.91Å; W43-F47 HydrophobicContact CZ2-CZ 3.91Å; W43-F47 AromaticContact NE1-CE2 3.42Å; W43-F47 AromaticContact NE1-CZ 3.92Å; W43-F47 VanDerWaalsContact O-CD2 3.29Å; W43-F47 WeakPolarHBondContact O-CD2 3.47Å; W43-F47 WeakPolarHBondContact O-CE2 3.16Å; R44-F47 PolarHBondContact O-N 3.47Å; K45-F47 VanDerWaalsContact C-N 3.3Å; F47-V49 HydrophobicContact CB-CG2 4.22Å
48	G	94.8	Very high	92.3	Very high	84 Å²	84	103.4 Å²	103.4	87%	0.866	55%	0.551	S	S	*	*			trans	-94.1	121.7	160.3	0	0	0	0	0	109.6
49	V	91.8	Very high	92	Very high	82 Å²	82	107.1 Å²	107.1	50%	0.497	57%	0.572	S	S	.	*			trans	-124.8	130.3	-177.7	-177.4	0	0	0	0	109.4	L19 F47	L19-V49 HydrophobicContact CD1-CG2 3.91Å; L19-V49 HydrophobicContact CD2-CG2 3.9Å; L19-V49 HydrophobicContact CG-CG2 4.4Å; F47-V49 HydrophobicContact CB-CG2 4.22Å
50	I	91.9	Very high	91.7	Very high	162 Å²	162	109.2 Å²	109.2	83%	0.831	58%	0.578	S	S	*	*			trans	-103	112.9	170.8	-59	174.1	0	0	0	106.3
51	P	80.7	Confident	91.4	Very high	113 Å²	113	112.4 Å²	112.4	73%	0.734	60%	0.596	S	S	*	*			trans	-58.4	144.1	175.6	-21.6	32.9	0	0	0	111.1
52	Q	65.2	Low	90.9	Very high	262 Å²	262	110.3 Å²	110.3	100%	1.224	59%	0.592	S	S	*	*			trans	-75.2	0	170.4	-94.4	-118.1	-72.2	0	0	111.5

Retrieved 52 of 52 residues in 41 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).