A0A089NFS3_HUMAN Loading...

Deoxyribonuclease 1

AlphaFold DB , UniProt , Accession A0A089NFS3, Species HUMAN (Homo sapiens, Human), Gene DNASE1, Length 32 aa.

						>A0A089NFS3_HUMAN|A0A089NFS3|DNASE1
IVVAGMLLRGAVVPDSALPFNFQAAYGLSDQL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	I	57.8	Low	66.8	Low	211 Å²	211	117.8 Å²	117.8	100%	1.082	68%	0.682	S	S	*	*				0	91.9	0	-70.8	159.9	0	0	0	107.8
2	V	59.6	Low	67.7	Low	124 Å²	124	117.1 Å²	117.1	75%	0.752	68%	0.681	S	S	*	*			trans	-142.8	-34.4	174.6	-169.3	0	0	0	0	108.7	A4 G5	V2-A4 VanDerWaalsContact C-N 3.33Å; V2-A4 PolarHBondContact O-N 3.37Å; V2-G5 PolarHBondContact O-N 3.46Å; V2-G5 VanDerWaalsContact O-N 3.08Å
3	V	61.3	Low	68.5	Low	118 Å²	118	115.3 Å²	115.3	72%	0.715	67%	0.672	S	S	*	*	H	α-helix	trans	-55.4	-40.2	175.8	-174.4	0	0	0	0	113.3	G5 M6	V3-G5 VanDerWaalsContact C-N 3.3Å; V3-G5 PolarHBondContact O-N 3.3Å; V3-M6 PolarHBondContact O-N 2.94Å
4	A	68.2	Low	69.1	Low	48 Å²	48	114.1 Å²	114.1	40%	0.397	67%	0.67	S	S	.	*	H	α-helix	trans	-63.9	-33.9	177.8	0	0	0	0	0	112.7	V2 M6 L7 L8	V2-A4 VanDerWaalsContact C-N 3.33Å; V2-A4 PolarHBondContact O-N 3.37Å; A4-M6 VanDerWaalsContact C-N 3.31Å; A4-M6 PolarHBondContact O-N 3.05Å; A4-L7 PolarHBondContact O-N 3.09Å; A4-L8 WeakPolarHBondContact O-CB 3.48Å; A4-L8 WeakPolarHBondContact O-CD1 3.28Å; A4-L8 WeakPolarHBondContact O-CG 3.49Å; A4-L8 PolarHBondContact O-N 3.07Å
5	G	63.9	Low	69.4	Low	39 Å²	39	114.5 Å²	114.5	40%	0.402	67%	0.668	S	S	.	*	H	α-helix	trans	-66.8	-29.8	-178.2	0	0	0	0	0	113.7	V2 V3 R9	V2-G5 PolarHBondContact O-N 3.46Å; V2-G5 VanDerWaalsContact O-N 3.08Å; V3-G5 VanDerWaalsContact C-N 3.3Å; V3-G5 PolarHBondContact O-N 3.3Å; G5-R9 WeakPolarHBondContact O-CG 3.26Å
6	M	69.3	Low	69.8	Low	158 Å²	158	113.2 Å²	113.2	78%	0.778	67%	0.667	S	S	*	*	H	α-helix	trans	-74.2	-41.2	176.3	-170.9	175.6	-133.5	0	0	111.6	V3 A4 R9	V3-M6 PolarHBondContact O-N 2.94Å; A4-M6 VanDerWaalsContact C-N 3.31Å; A4-M6 PolarHBondContact O-N 3.05Å; M6-R9 PolarHBondContact O-N 3.23Å
7	L	73.5	Confident	70.5	Confident	130 Å²	130	112 Å²	112	68%	0.681	67%	0.673	S	S	*	*	H	α-helix	trans	-67.3	-36	177.9	-64.9	173.1	0	0	0	112	A4 R9 G10	A4-L7 PolarHBondContact O-N 3.09Å; L7-R9 VanDerWaalsContact C-N 3.32Å; L7-R9 PolarHBondContact O-N 2.9Å; L7-G10 PolarHBondContact O-N 2.96Å
8	L	72.3	Confident	71.4	Confident	118 Å²	118	112.2 Å²	112.2	62%	0.618	67%	0.669	S	S	*	*	H	α-helix	trans	-70.3	-23.3	179.1	-69.2	169.4	0	0	0	113.7	A4 G10 A11	A4-L8 WeakPolarHBondContact O-CB 3.48Å; A4-L8 WeakPolarHBondContact O-CD1 3.28Å; A4-L8 WeakPolarHBondContact O-CG 3.49Å; A4-L8 PolarHBondContact O-N 3.07Å; L8-G10 VanDerWaalsContact C-N 3.28Å; L8-G10 PolarHBondContact O-N 3.4Å; L8-A11 PolarHBondContact O-N 3.45Å
9	R	67.3	Low	72	Confident	213 Å²	213	112.4 Å²	112.4	80%	0.804	67%	0.674	S	S	*	*	H	α-helix	trans	-66.4	-29.9	176.7	-75.9	-178.5	-172.2	-129.4	2.6	113	G5 M6 L7 A11	G5-R9 WeakPolarHBondContact O-CG 3.26Å; M6-R9 PolarHBondContact O-N 3.23Å; L7-R9 VanDerWaalsContact C-N 3.32Å; L7-R9 PolarHBondContact O-N 2.9Å; R9-A11 VanDerWaalsContact C-N 3.33Å
10	G	69.9	Low	72.7	Confident	72 Å²	72	112.9 Å²	112.9	74%	0.742	67%	0.667	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.6	-9.9	175.1	0	0	0	0	0	113.9	L7 L8 V12	L7-G10 PolarHBondContact O-N 2.96Å; L8-G10 VanDerWaalsContact C-N 3.28Å; L8-G10 PolarHBondContact O-N 3.4Å; G10-V12 VanDerWaalsContact C-N 3.3Å
11	A	71.8	Confident	73.3	Confident	65 Å²	65	111.9 Å²	111.9	54%	0.537	66%	0.659	S	S	.	*	T	Hydrogen-bonded Turn	trans	-87.8	2.4	179.8	0	0	0	0	0	113.1	L8 R9 V13	L8-A11 PolarHBondContact O-N 3.45Å; R9-A11 VanDerWaalsContact C-N 3.33Å; A11-V13 PolarHBondContact O-N 2.84Å
12	V	77.8	Confident	74.7	Confident	109 Å²	109	107.7 Å²	107.7	66%	0.661	63%	0.632	S	S	*	*			trans	-72.6	100.8	172.1	-178.3	0	0	0	0	107.8	G10 P14	G10-V12 VanDerWaalsContact C-N 3.3Å; V12-P14 WeakPolarHBondContact O-CD 3.43Å
13	V	78.4	Confident	76	Confident	94 Å²	94	106.5 Å²	106.5	57%	0.57	62%	0.619	S	S	*	*			trans	-75.3	117.1	172.5	-178.6	0	0	0	0	107.3	A11 S16	A11-V13 PolarHBondContact O-N 2.84Å; V13-S16 VanDerWaalsContact O-CB 3.31Å; V13-S16 WeakPolarHBondContact O-CB 2.86Å; V13-S16 PolarHBondContact O-N 3.2Å; V13-S16 PolarHBondContact O-OG 3.38Å
14	P	76.6	Confident	77.1	Confident	99 Å²	99	104.5 Å²	104.5	64%	0.643	62%	0.615	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.2	146.6	174.1	-22	33.3	0	0	0	109.9	V12 S16	V12-P14 WeakPolarHBondContact O-CD 3.43Å; P14-S16 PolarHBondContact O-N 3.25Å
15	D	73.8	Confident	77.9	Confident	120 Å²	120	104.9 Å²	104.9	64%	0.642	62%	0.618	S	S	*	*	T	Hydrogen-bonded Turn	trans	64.1	2.7	174.9	-52.4	-47.4	0	0	0	116.9	A17 L18	D15-A17 PolarHBondContact O-N 2.94Å; D15-A17 VanDerWaalsContact O-N 3.16Å; D15-L18 HydrophobicContact CB-CD1 3.56Å; D15-L18 HydrophobicContact CB-CG 3.83Å; D15-L18 PolarHBondContact O-N 3.16Å; D15-L18 VanDerWaalsContact O-N 3.08Å; D15-L18 WeakPolarHBondContact OD1-CD1 3.42Å
16	S	75.8	Confident	79	Confident	93 Å²	93	110.8 Å²	110.8	65%	0.65	63%	0.629	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64	-19	179.4	55.2	0	0	0	0	114.8	V13 P14	V13-S16 VanDerWaalsContact O-CB 3.31Å; V13-S16 WeakPolarHBondContact O-CB 2.86Å; V13-S16 PolarHBondContact O-N 3.2Å; V13-S16 PolarHBondContact O-OG 3.38Å; P14-S16 PolarHBondContact O-N 3.25Å
17	A	81.9	Confident	79.8	Confident	93 Å²	93	106.3 Å²	106.3	77%	0.769	62%	0.624	S	S	*	*	T	Hydrogen-bonded Turn	trans	-112.5	12.6	177	0	0	0	0	0	112.7	D15	D15-A17 PolarHBondContact O-N 2.94Å; D15-A17 VanDerWaalsContact O-N 3.16Å
18	L	86.3	Confident	80.1	Confident	115 Å²	115	105 Å²	105	60%	0.602	62%	0.617	S	S	*	*	P	Polyproline II helix	trans	-64.5	133.3	173	-68.6	-175	0	0	0	109.4	D15 F20	D15-L18 HydrophobicContact CB-CD1 3.56Å; D15-L18 HydrophobicContact CB-CG 3.83Å; D15-L18 PolarHBondContact O-N 3.16Å; D15-L18 VanDerWaalsContact O-N 3.08Å; D15-L18 WeakPolarHBondContact OD1-CD1 3.42Å; L18-F20 PolarHBondContact O-N 3.4Å
19	P	83.3	Confident	80.3	Confident	116 Å²	116	103.3 Å²	103.3	75%	0.753	62%	0.615	S	S	*	*	P	Polyproline II helix	trans	-56.6	138	169.8	-23.4	33.5	0	0	0	110.5	N21	P19-N21 PolarHBondContact O-N 3.45Å
20	F	85.1	Confident	80.5	Confident	122 Å²	122	100.1 Å²	100.1	54%	0.535	61%	0.614	S	S	.	*	P	Polyproline II helix	trans	-64.5	123.9	174.3	-176.2	-94.2	0	0	0	110	L18 F22 A25 Y26	L18-F20 PolarHBondContact O-N 3.4Å; F20-F22 HydrophobicContact CB-CE2 4.23Å; F20-F22 HydrophobicContact CB-CZ 4.4Å; F20-F22 HydrophobicContact CD1-CB 4.42Å; F20-F22 AromaticContact CD1-CD1 3.47Å; F20-F22 HydrophobicContact CD1-CD1 3.47Å; F20-F22 VanDerWaalsContact CD1-CD1 3.47Å; F20-F22 AromaticContact CD1-CD2 3.71Å; F20-F22 HydrophobicContact CD1-CD2 3.71Å; F20-F22 AromaticContact CD1-CE1 3.41Å; F20-F22 HydrophobicContact CD1-CE1 3.41Å; F20-F22 VanDerWaalsContact CD1-CE1 3.41Å; F20-F22 AromaticContact CD1-CE2 3.67Å; F20-F22 HydrophobicContact CD1-CE2 3.67Å; F20-F22 AromaticContact CD1-CG 3.61Å; F20-F22 HydrophobicContact CD1-CG 3.61Å; F20-F22 AromaticContact CD1-CZ 3.52Å; F20-F22 HydrophobicContact CD1-CZ 3.52Å; F20-F22 HydrophobicContact CE1-CB 4.44Å; F20-F22 AromaticContact CE1-CD1 3.44Å; F20-F22 HydrophobicContact CE1-CD1 3.44Å; F20-F22 VanDerWaalsContact CE1-CD1 3.44Å; F20-F22 HydrophobicContact CE1-CD2 4.44Å; F20-F22 AromaticContact CE1-CE1 3.61Å; F20-F22 HydrophobicContact CE1-CE1 3.61Å; F20-F22 AromaticContact CE1-CG 3.88Å; F20-F22 HydrophobicContact CE1-CG 3.88Å; F20-F22 HydrophobicContact CE1-CZ 4.2Å; F20-F22 HydrophobicContact CG-CE2 4.42Å; F20-F22 HydrophobicContact CG-CZ 4.31Å; F20-F22 WeakPolarHBondContact O-CD2 3.41Å; F20-F22 PolarHBondContact O-N 2.66Å; F20-A25 HydrophobicContact CE1-CB 3.76Å; F20-A25 HydrophobicContact CZ-CB 3.51Å; F20-Y26 HydrophobicContact CE1-CE2 4.23Å
21	N	86.6	Confident	80.5	Confident	93 Å²	93	105.2 Å²	105.2	50%	0.497	62%	0.618	S	S	.	*			trans	-86.1	89.5	178.4	-171.7	-19.6	0	0	0	110.5	P19 Q23 A24 A25	P19-N21 PolarHBondContact O-N 3.45Å; N21-Q23 PolarHBondContact O-N 3.08Å; N21-Q23 WeakPolarHBondContact OD1-CA 3.33Å; N21-Q23 VanDerWaalsContact OD1-CB 3.28Å; N21-Q23 WeakPolarHBondContact OD1-CB 3.31Å; N21-Q23 PolarHBondContact OD1-N 3.42Å; N21-Q23 VanDerWaalsContact OD1-N 3.09Å; N21-A24 HydrophobicContact CB-CB 4.12Å; N21-A24 PolarHBondContact O-N 3.06Å; N21-A24 PolarHBondContact OD1-N 3.41Å; N21-A25 WeakPolarHBondContact O-CB 3.46Å; N21-A25 PolarHBondContact O-N 3.17Å
22	F	85.7	Confident	80.1	Confident	122 Å²	122	113.4 Å²	113.4	54%	0.535	65%	0.652	S	S	.	*	H	α-helix	trans	-61.8	-32.9	175.6	-66.4	-82.4	0	0	0	112.9	F20 A25 Y26 L28	F20-F22 HydrophobicContact CB-CE2 4.23Å; F20-F22 HydrophobicContact CB-CZ 4.4Å; F20-F22 HydrophobicContact CD1-CB 4.42Å; F20-F22 AromaticContact CD1-CD1 3.47Å; F20-F22 HydrophobicContact CD1-CD1 3.47Å; F20-F22 VanDerWaalsContact CD1-CD1 3.47Å; F20-F22 AromaticContact CD1-CD2 3.71Å; F20-F22 HydrophobicContact CD1-CD2 3.71Å; F20-F22 AromaticContact CD1-CE1 3.41Å; F20-F22 HydrophobicContact CD1-CE1 3.41Å; F20-F22 VanDerWaalsContact CD1-CE1 3.41Å; F20-F22 AromaticContact CD1-CE2 3.67Å; F20-F22 HydrophobicContact CD1-CE2 3.67Å; F20-F22 AromaticContact CD1-CG 3.61Å; F20-F22 HydrophobicContact CD1-CG 3.61Å; F20-F22 AromaticContact CD1-CZ 3.52Å; F20-F22 HydrophobicContact CD1-CZ 3.52Å; F20-F22 HydrophobicContact CE1-CB 4.44Å; F20-F22 AromaticContact CE1-CD1 3.44Å; F20-F22 HydrophobicContact CE1-CD1 3.44Å; F20-F22 VanDerWaalsContact CE1-CD1 3.44Å; F20-F22 HydrophobicContact CE1-CD2 4.44Å; F20-F22 AromaticContact CE1-CE1 3.61Å; F20-F22 HydrophobicContact CE1-CE1 3.61Å; F20-F22 AromaticContact CE1-CG 3.88Å; F20-F22 HydrophobicContact CE1-CG 3.88Å; F20-F22 HydrophobicContact CE1-CZ 4.2Å; F20-F22 HydrophobicContact CG-CE2 4.42Å; F20-F22 HydrophobicContact CG-CZ 4.31Å; F20-F22 WeakPolarHBondContact O-CD2 3.41Å; F20-F22 PolarHBondContact O-N 2.66Å; F22-A25 PolarHBondContact O-N 3.03Å; F22-Y26 HydrophobicContact CB-CD2 4.41Å; F22-Y26 HydrophobicContact CD1-CD2 4.16Å; F22-Y26 AromaticContact CD1-CE2 3.9Å; F22-Y26 HydrophobicContact CD1-CE2 3.9Å; F22-Y26 WeakPolarHBondContact O-CB 3.18Å; F22-Y26 PolarHBondContact O-N 3.41Å; F22-L28 HydrophobicContact CB-CD1 4.43Å
23	Q	87.1	Confident	80.2	Confident	99 Å²	99	113.7 Å²	113.7	46%	0.463	65%	0.651	S	S	.	*	H	α-helix	trans	-63.1	-46.4	179.7	-164.8	-176.5	-10.7	0	0	111.2	N21 G27 L28	N21-Q23 PolarHBondContact O-N 3.08Å; N21-Q23 WeakPolarHBondContact OD1-CA 3.33Å; N21-Q23 VanDerWaalsContact OD1-CB 3.28Å; N21-Q23 WeakPolarHBondContact OD1-CB 3.31Å; N21-Q23 PolarHBondContact OD1-N 3.42Å; N21-Q23 VanDerWaalsContact OD1-N 3.09Å; Q23-G27 CarbonylContact O-C 3.54Å; Q23-G27 VanDerWaalsContact O-CA 3.26Å; Q23-G27 WeakPolarHBondContact O-CA 3.47Å; Q23-G27 PolarHBondContact O-N 3.41Å; Q23-L28 HydrophobicContact CG-CB 4.25Å; Q23-L28 WeakPolarHBondContact CG-O 3.48Å; Q23-L28 PolarHBondContact NE2-O 3.36Å; Q23-L28 PolarHBondContact O-N 3.37Å
24	A	84.5	Confident	80.3	Confident	76 Å²	76	114.7 Å²	114.7	63%	0.628	66%	0.656	S	S	*	*	H	α-helix	trans	-70	-37.2	175.9	0	0	0	0	0	112.6	N21	N21-A24 HydrophobicContact CB-CB 4.12Å; N21-A24 PolarHBondContact O-N 3.06Å; N21-A24 PolarHBondContact OD1-N 3.41Å
25	A	85.9	Confident	80.5	Confident	57 Å²	57	115.6 Å²	115.6	47%	0.471	66%	0.656	S	S	.	*	H	α-helix	trans	-72.2	-36.5	-177.5	0	0	0	0	0	113.4	F20 N21 F22	F20-A25 HydrophobicContact CE1-CB 3.76Å; F20-A25 HydrophobicContact CZ-CB 3.51Å; N21-A25 WeakPolarHBondContact O-CB 3.46Å; N21-A25 PolarHBondContact O-N 3.17Å; F22-A25 PolarHBondContact O-N 3.03Å
26	Y	85.9	Confident	80.9	Confident	162 Å²	162	115.3 Å²	115.3	64%	0.635	66%	0.657	S	S	*	*	H	α-helix	trans	-113.6	7.7	-174.3	-63.8	-72.6	0	0	0	113.4	F20 F22 L28	F20-Y26 HydrophobicContact CE1-CE2 4.23Å; F22-Y26 HydrophobicContact CB-CD2 4.41Å; F22-Y26 HydrophobicContact CD1-CD2 4.16Å; F22-Y26 AromaticContact CD1-CE2 3.9Å; F22-Y26 HydrophobicContact CD1-CE2 3.9Å; F22-Y26 WeakPolarHBondContact O-CB 3.18Å; F22-Y26 PolarHBondContact O-N 3.41Å; Y26-L28 PolarHBondContact O-N 3.33Å
27	G	85.4	Confident	81.3	Confident	64 Å²	64	116.7 Å²	116.7	66%	0.66	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	59.7	29.7	-179.8	0	0	0	0	0	112.8	Q23 S29	Q23-G27 CarbonylContact O-C 3.54Å; Q23-G27 VanDerWaalsContact O-CA 3.26Å; Q23-G27 WeakPolarHBondContact O-CA 3.47Å; Q23-G27 PolarHBondContact O-N 3.41Å; G27-S29 PolarHBondContact O-N 3.41Å
28	L	81	Confident	81.2	Confident	103 Å²	103	118.3 Å²	118.3	54%	0.539	65%	0.65	S	S	.	*			trans	-67	135.5	178.6	-51.4	173.7	0	0	0	107.3	F22 Q23 Y26	F22-L28 HydrophobicContact CB-CD1 4.43Å; Q23-L28 HydrophobicContact CG-CB 4.25Å; Q23-L28 WeakPolarHBondContact CG-O 3.48Å; Q23-L28 PolarHBondContact NE2-O 3.36Å; Q23-L28 PolarHBondContact O-N 3.37Å; Y26-L28 PolarHBondContact O-N 3.33Å
29	S	76.9	Confident	80.8	Confident	82 Å²	82	118.5 Å²	118.5	57%	0.573	65%	0.654	S	S	*	*			trans	-114.3	134.4	170.9	63.3	0	0	0	0	107.4	G27 Q31	G27-S29 PolarHBondContact O-N 3.41Å; S29-Q31 PolarHBondContact O-N 3.32Å
30	D	71.9	Confident	80.7	Confident	147 Å²	147	118.7 Å²	118.7	79%	0.786	65%	0.646	S	S	*	*			trans	-69.3	82.6	165	-87.5	-49	0	0	0	107	L32	D30-L32 PolarHBondContact O-N 3.08Å
31	Q	69.1	Low	80.3	Confident	179 Å²	179	118.4 Å²	118.4	84%	0.836	66%	0.655	S	S	*	*			trans	-85.8	96.1	175.1	-152.5	178	-34.4	0	0	106.8	S29	S29-Q31 PolarHBondContact O-N 3.32Å
32	L	63.4	Low	79.7	Confident	237 Å²	237	120.7 Å²	120.7	100%	1.241	67%	0.67	S	S	*	*			trans	-82	0	176.4	-147.2	151.5	0	0	0	110.5	D30	D30-L32 PolarHBondContact O-N 3.08Å

Retrieved 32 of 32 residues in 78.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).