A0A089PPW6_HUMAN Loading...

Mutant cystic fibrosis transmembrane conductance regulator

AlphaFold DB , UniProt , Accession A0A089PPW6, Species HUMAN (Homo sapiens, Human), Gene CFTR, Length 41 aa.

>A0A089PPW6_HUMAN|A0A089PPW6|CFTR
DQRAGKISERLVITSEMIENIQSVKAYCWEEAREKMIENLR
Structure Viewer
Loading PAE data...
(Predicted Aligned Error values between residue pairs)
Error loading PAE data: please refresh the page.

 

Download Structure   PDB   PAE   Table  
Site Residue pLDDT pLDDT confidence pLDDT10 pLDDT10 confidence SASA SASA [Ų] SASA10 SASA10 [Ų] RSA RSA unformatted RSA10 RSA10 unformatted Surface Surface10 (not used) Disorder (not used) Disorder Sec. str. Secondary structure Isomer Phi (φ) Psi (ψ) Omega (ω) Chi 1 (χ1) Chi 2 (χ2) Chi 3 (χ3) Chi 4 (χ4) Chi 5 (χ5) Tau (τ) Contacts (colored by PAE) Contact details
1D85.1Confident93.3Very high158 Ų158106.7 Ų106.785%0.84555%0.545SS*.  0115.70-176.4-45.3000108R3 A4 G5D1-R3 PolarHBondContact O-N 2.86Å; D1-R3 WeakPolarHBondContact OD1-CA 3.22Å; D1-R3 WeakPolarHBondContact OD1-CB 3.31Å; D1-R3 PolarHBondContact OD1-N 3.11Å; D1-A4 HydrophobicContact CB-CB 3.89Å; D1-A4 PolarHBondContact O-N 3.38Å; D1-A4 PolarHBondContact OD1-N 3.19Å; D1-A4 VanDerWaalsContact OD1-N 3.1Å; D1-G5 PolarHBondContact O-N 3.41Å
2Q88.1Confident93.5Very high186 Ų186104.3 Ų104.387%0.86954%0.538SS*.Hα-helixtrans-63.2-29.8-176.9-73.9179.8-12.900112.6G5 K6Q2-G5 PolarHBondContact O-N 3.13Å; Q2-K6 PolarHBondContact O-N 3.01Å
3R92.4Very high93.6Very high191 Ų19198.6 Ų98.672%0.72151%0.509SS*.Hα-helixtrans-71.3-42.3177.2-178.4-174.8178.8-175.40.6110.9D1 G5 K6 I7D1-R3 PolarHBondContact O-N 2.86Å; D1-R3 WeakPolarHBondContact OD1-CA 3.22Å; D1-R3 WeakPolarHBondContact OD1-CB 3.31Å; D1-R3 PolarHBondContact OD1-N 3.11Å; R3-G5 VanDerWaalsContact C-N 3.26Å; R3-G5 PolarHBondContact O-N 3.4Å; R3-K6 PolarHBondContact O-N 3.38Å; R3-I7 HydrophobicContact CG-CD1 3.95Å; R3-I7 VanDerWaalsContact O-CG1 3.29Å; R3-I7 WeakPolarHBondContact O-CG1 3.43Å; R3-I7 PolarHBondContact O-N 3.41Å
4A94.8Very high93.8Very high55 Ų5595.1 Ų95.146%0.45550%0.495SS..Hα-helixtrans-59.6-38.617600000111.8D1 I7 S8D1-A4 HydrophobicContact CB-CB 3.89Å; D1-A4 PolarHBondContact O-N 3.38Å; D1-A4 PolarHBondContact OD1-N 3.19Å; D1-A4 VanDerWaalsContact OD1-N 3.1Å; A4-I7 PolarHBondContact O-N 3.28Å; A4-S8 PolarHBondContact O-N 3.28Å
5G94.6Very high94Very high41 Ų4192.7 Ų92.742%0.42349%0.489SS..Hα-helixtrans-60-52.9174.700000113.1D1 Q2 R3 I7 S8 E9D1-G5 PolarHBondContact O-N 3.41Å; Q2-G5 PolarHBondContact O-N 3.13Å; R3-G5 VanDerWaalsContact C-N 3.26Å; R3-G5 PolarHBondContact O-N 3.4Å; G5-I7 VanDerWaalsContact C-N 3.28Å; G5-I7 PolarHBondContact O-N 3.42Å; G5-S8 WeakPolarHBondContact O-CB 3.09Å; G5-S8 PolarHBondContact O-N 2.97Å; G5-S8 VanDerWaalsContact O-N 3.13Å; G5-E9 PolarHBondContact O-N 3.31Å
6K93.4Very high94.1Very high96 Ų9692.8 Ų92.842%0.41749%0.486SS..Hα-helixtrans-59.4-37.2176.9-72.3-169.1173.9-160.80113.1Q2 R3 R10 R41Q2-K6 PolarHBondContact O-N 3.01Å; R3-K6 PolarHBondContact O-N 3.38Å; K6-R10 WeakPolarHBondContact O-CB 3.45Å; K6-R10 PolarHBondContact O-N 3.48Å; K6-R10 VanDerWaalsContact O-N 3.08Å; K6-R41 PolarHBondContact NZ-O 3.37Å; K6-R41 PolarHBondContact NZ-OXT 3.36Å
7I95.3Very high94.1Very high64 Ų6490.2 Ų90.233%0.32847%0.472SS..Hα-helixtrans-65.1-45.1176.4-69.9167.2000110.2R3 A4 G5 E9 R10 L11R3-I7 HydrophobicContact CG-CD1 3.95Å; R3-I7 VanDerWaalsContact O-CG1 3.29Å; R3-I7 WeakPolarHBondContact O-CG1 3.43Å; R3-I7 PolarHBondContact O-N 3.41Å; A4-I7 PolarHBondContact O-N 3.28Å; G5-I7 VanDerWaalsContact C-N 3.28Å; G5-I7 PolarHBondContact O-N 3.42Å; I7-E9 PolarHBondContact O-N 3.08Å; I7-R10 PolarHBondContact O-N 3.18Å; I7-L11 HydrophobicContact CG2-CD1 4Å; I7-L11 HydrophobicContact CG2-CG 4.43Å; I7-L11 VanDerWaalsContact O-CG 3.3Å; I7-L11 WeakPolarHBondContact O-CG 3.41Å; I7-L11 PolarHBondContact O-N 3.09Å
8S95.8Very high94.3Very high72 Ų7291.4 Ų91.450%0.50348%0.477SS..Hα-helixtrans-60.8-45.1178.6-167.30000111.9A4 G5 L11 V12A4-S8 PolarHBondContact O-N 3.28Å; G5-S8 WeakPolarHBondContact O-CB 3.09Å; G5-S8 PolarHBondContact O-N 2.97Å; G5-S8 VanDerWaalsContact O-N 3.13Å; S8-L11 PolarHBondContact O-N 2.96Å; S8-V12 WeakPolarHBondContact O-CG2 3.38Å; S8-V12 PolarHBondContact O-N 3.24Å; S8-V12 VanDerWaalsContact O-N 3.14Å
9E94.8Very high94.5Very high100 Ų10093.9 Ų93.947%0.46749%0.486SS..Hα-helixtrans-61.5-46.1178.2-175173.3-16500111.7G5 I7 L11 V12 I13 L40G5-E9 PolarHBondContact O-N 3.31Å; I7-E9 PolarHBondContact O-N 3.08Å; E9-L11 VanDerWaalsContact C-N 3.3Å; E9-L11 PolarHBondContact O-N 2.88Å; E9-V12 PolarHBondContact O-N 3.02Å; E9-I13 HydrophobicContact CG-CD1 4Å; E9-I13 WeakPolarHBondContact O-CG1 3.45Å; E9-I13 PolarHBondContact O-N 3.27Å; E9-I13 VanDerWaalsContact O-N 3.15Å; E9-L40 HydrophobicContact CG-CD1 4.47Å; E9-L40 HydrophobicContact CG-CD2 4.05Å
10R95.4Very high94.6Very high96 Ų9693.1 Ų93.136%0.36248%0.483SS..Hα-helixtrans-62.1-37.6177.2-165.9172.766.7-139.11112.5K6 I7 T14 I37K6-R10 WeakPolarHBondContact O-CB 3.45Å; K6-R10 PolarHBondContact O-N 3.48Å; K6-R10 VanDerWaalsContact O-N 3.08Å; I7-R10 PolarHBondContact O-N 3.18Å; R10-T14 WeakPolarHBondContact O-CB 3.48Å; R10-T14 PolarHBondContact O-N 3.37Å; R10-T14 PolarHBondContact O-OG1 3.02Å; R10-I37 HydrophobicContact CG-CD1 4.26Å; R10-I37 HydrophobicContact CG-CG2 4.4Å
11L96.3Very high94.7Very high115 Ų11591.9 Ų91.960%0.60248%0.476SS*.Hα-helixtrans-64-45.7177.7-75.7170.8000111.8I7 S8 E9 T14 S15I7-L11 HydrophobicContact CG2-CD1 4Å; I7-L11 HydrophobicContact CG2-CG 4.43Å; I7-L11 VanDerWaalsContact O-CG 3.3Å; I7-L11 WeakPolarHBondContact O-CG 3.41Å; I7-L11 PolarHBondContact O-N 3.09Å; S8-L11 PolarHBondContact O-N 2.96Å; E9-L11 VanDerWaalsContact C-N 3.3Å; E9-L11 PolarHBondContact O-N 2.88Å; L11-T14 PolarHBondContact O-N 3.05Å; L11-S15 PolarHBondContact O-N 3.42Å
12V96.3Very high95.3Very high77 Ų7792.3 Ų92.347%0.46747%0.473SS..Hα-helixtrans-60.2-51.3179173.50000110.6S8 E9 T14 S15 E16S8-V12 WeakPolarHBondContact O-CG2 3.38Å; S8-V12 PolarHBondContact O-N 3.24Å; S8-V12 VanDerWaalsContact O-N 3.14Å; E9-V12 PolarHBondContact O-N 3.02Å; V12-T14 VanDerWaalsContact C-N 3.3Å; V12-T14 PolarHBondContact O-N 3.17Å; V12-S15 WeakPolarHBondContact O-CB 3.45Å; V12-S15 PolarHBondContact O-N 3.42Å; V12-S15 VanDerWaalsContact O-N 3.13Å; V12-E16 PolarHBondContact O-N 3.33Å
13I94.7Very high95.8Very high31 Ų3186.2 Ų86.216%0.15945%0.451CS..Hα-helixtrans-63.2-37.9-178.2-66.7166.6000111.6E9 M17 M36 I37 L40E9-I13 HydrophobicContact CG-CD1 4Å; E9-I13 WeakPolarHBondContact O-CG1 3.45Å; E9-I13 PolarHBondContact O-N 3.27Å; E9-I13 VanDerWaalsContact O-N 3.15Å; I13-M17 WeakPolarHBondContact O-CB 3.39Å; I13-M17 PolarHBondContact O-N 3.04Å; I13-M36 HydrophobicContact CG2-SD 3.99Å; I13-I37 HydrophobicContact CB-CD1 4.38Å; I13-I37 HydrophobicContact CG2-CD1 3.76Å; I13-L40 HydrophobicContact CD1-CD1 3.41Å; I13-L40 VanDerWaalsContact CD1-CD1 3.41Å
14T95.7Very high96Very high50 Ų5077.2 Ų77.231%0.30742%0.417SS..Hα-helixtrans-68.3-37.8177.3-52.60000111.4R10 L11 V12 M17 I18R10-T14 WeakPolarHBondContact O-CB 3.48Å; R10-T14 PolarHBondContact O-N 3.37Å; R10-T14 PolarHBondContact O-OG1 3.02Å; L11-T14 PolarHBondContact O-N 3.05Å; V12-T14 VanDerWaalsContact C-N 3.3Å; V12-T14 PolarHBondContact O-N 3.17Å; T14-M17 PolarHBondContact O-N 3.37Å; T14-I18 HydrophobicContact CG2-CD1 4.13Å; T14-I18 WeakPolarHBondContact O-CG1 3.33Å; T14-I18 PolarHBondContact O-N 3.47Å
15S97.4Very high96.1Very high58 Ų5881 Ų8141%0.40642%0.423SS..Hα-helixtrans-60.7-50.6174.9-161.50000111L11 V12 M17 I18 E19L11-S15 PolarHBondContact O-N 3.42Å; V12-S15 WeakPolarHBondContact O-CB 3.45Å; V12-S15 PolarHBondContact O-N 3.42Å; V12-S15 VanDerWaalsContact O-N 3.13Å; S15-M17 VanDerWaalsContact C-N 3.27Å; S15-M17 PolarHBondContact O-N 3.3Å; S15-I18 PolarHBondContact O-N 3.15Å; S15-I18 VanDerWaalsContact O-N 3.14Å; S15-E19 WeakPolarHBondContact O-CG 3.31Å; S15-E19 PolarHBondContact O-N 3.07Å; S15-E19 PolarHBondContact OG-OE1 3.14Å
16E95.3Very high96.3Very high95 Ų9582.8 Ų82.844%0.44443%0.434SS..Hα-helixtrans-60.2-36.9178.5-68.8177.5178.100112.3V12 N20V12-E16 PolarHBondContact O-N 3.33Å; E16-N20 WeakPolarHBondContact O-CB 3.45Å; E16-N20 PolarHBondContact O-N 3.13Å; E16-N20 VanDerWaalsContact O-N 3.11Å; E16-N20 PolarHBondContact O-ND2 2.67Å
17M94.8Very high96.5Very high49 Ų4985.5 Ų85.524%0.24144%0.443CS..Hα-helixtrans-66.5-41176.7-170.9-179.483.100112.2I13 T14 S15 N20 I21 V24 R33I13-M17 WeakPolarHBondContact O-CB 3.39Å; I13-M17 PolarHBondContact O-N 3.04Å; T14-M17 PolarHBondContact O-N 3.37Å; S15-M17 VanDerWaalsContact C-N 3.27Å; S15-M17 PolarHBondContact O-N 3.3Å; M17-N20 CarbonylContact O-C 3.45Å; M17-N20 PolarHBondContact O-N 3.19Å; M17-I21 WeakPolarHBondContact O-CA 3.46Å; M17-I21 PolarHBondContact O-N 3.02Å; M17-I21 VanDerWaalsContact O-N 3.09Å; M17-V24 HydrophobicContact CG-CG2 4.28Å; M17-R33 HydrophobicContact CG-CG 4.24Å; M17-R33 HydrophobicContact SD-CB 3.59Å; M17-R33 VanDerWaalsContact SD-CB 3.59Å; M17-R33 HydrophobicContact SD-CG 3.74Å
18I96.8Very high96.6Very high111 Ų11187.1 Ų87.157%0.56946%0.458SS*.Hα-helixtrans-67-45.1177.9-69.5168.1000110.2T14 S15 N20 I21T14-I18 HydrophobicContact CG2-CD1 4.13Å; T14-I18 WeakPolarHBondContact O-CG1 3.33Å; T14-I18 PolarHBondContact O-N 3.47Å; S15-I18 PolarHBondContact O-N 3.15Å; S15-I18 VanDerWaalsContact O-N 3.14Å; I18-N20 PolarHBondContact O-N 3.44Å; I18-I21 WeakPolarHBondContact O-CB 3.46Å; I18-I21 WeakPolarHBondContact O-CG2 3.34Å; I18-I21 PolarHBondContact O-N 3.14Å
19E98.4Very high96.7Very high140 Ų14089.6 Ų89.665%0.65446%0.457SS*.Hα-helixtrans-59-34.9177.2-74.1172.4-160.600112S15S15-E19 WeakPolarHBondContact O-CG 3.31Å; S15-E19 PolarHBondContact O-N 3.07Å; S15-E19 PolarHBondContact OG-OE1 3.14Å
20N96.8Very high96.7Very high77 Ų7788.8 Ų88.841%0.41245%0.453SS..THydrogen-bonded Turntrans-106.625.3-177.5-61.6-67.9000113.9E16 M17 I18 Q22 S23 V24E16-N20 WeakPolarHBondContact O-CB 3.45Å; E16-N20 PolarHBondContact O-N 3.13Å; E16-N20 VanDerWaalsContact O-N 3.11Å; E16-N20 PolarHBondContact O-ND2 2.67Å; M17-N20 CarbonylContact O-C 3.45Å; M17-N20 PolarHBondContact O-N 3.19Å; I18-N20 PolarHBondContact O-N 3.44Å; N20-Q22 PolarHBondContact O-N 3.2Å; N20-S23 PolarHBondContact O-N 3.1Å; N20-S23 VanDerWaalsContact O-N 3.08Å; N20-V24 PolarHBondContact O-N 2.92Å
21I97Very high96.8Very high68 Ų6889.9 Ų89.935%0.34946%0.462SS..Hα-helixtrans-61.2-30.5-172.7-169.759.8000113.5M17 I18 V24 K25M17-I21 WeakPolarHBondContact O-CA 3.46Å; M17-I21 PolarHBondContact O-N 3.02Å; M17-I21 VanDerWaalsContact O-N 3.09Å; I18-I21 WeakPolarHBondContact O-CB 3.46Å; I18-I21 WeakPolarHBondContact O-CG2 3.34Å; I18-I21 PolarHBondContact O-N 3.14Å; I21-V24 HydrophobicContact CD1-CB 4.39Å; I21-V24 PolarHBondContact O-N 2.93Å; I21-K25 HydrophobicContact CG1-CD 4.39Å; I21-K25 WeakPolarHBondContact O-CG 3.46Å; I21-K25 PolarHBondContact O-N 3.5Å
22Q97.6Very high96.7Very high167 Ų16787.3 Ų87.378%0.7846%0.457SS*.Hα-helixtrans-64.5-41.4176.9-69.6-173.3-22.900111.6N20 K25 A26N20-Q22 PolarHBondContact O-N 3.2Å; Q22-K25 PolarHBondContact O-N 3.4Å; Q22-A26 VanDerWaalsContact O-CB 3.31Å; Q22-A26 WeakPolarHBondContact O-CB 3.49Å; Q22-A26 PolarHBondContact O-N 3.14Å
23S97.4Very high96.6Very high57 Ų5786.2 Ų86.240%0.39945%0.445SS..Hα-helixtrans-67-41176.1-55.10000111.5N20 K25 A26 Y27N20-S23 PolarHBondContact O-N 3.1Å; N20-S23 VanDerWaalsContact O-N 3.08Å; S23-K25 VanDerWaalsContact C-N 3.31Å; S23-K25 PolarHBondContact O-N 3.35Å; S23-A26 PolarHBondContact O-N 3.26Å; S23-Y27 WeakPolarHBondContact O-CD2 3.34Å; S23-Y27 PolarHBondContact O-N 3.09Å; S23-Y27 VanDerWaalsContact O-N 3.13Å
24V97.1Very high96.6Very high3 Ų391.3 Ų91.32%0.01847%0.468CS..Hα-helixtrans-57.4-47.1175.7174.80000110.6M17 N20 I21 Y27 C28 W29 E30 R33M17-V24 HydrophobicContact CG-CG2 4.28Å; N20-V24 PolarHBondContact O-N 2.92Å; I21-V24 HydrophobicContact CD1-CB 4.39Å; I21-V24 PolarHBondContact O-N 2.93Å; V24-Y27 PolarHBondContact O-N 3.31Å; V24-C28 PolarHBondContact O-N 3.39Å; V24-W29 HydrophobicContact CG1-CB 4.21Å; V24-W29 PolarHBondContact O-N 2.98Å; V24-E30 HydrophobicContact CG1-CG 4.47Å; V24-R33 HydrophobicContact CG1-CG 4.25Å; V24-R33 HydrophobicContact CG2-CG 4.39Å
25K97.1Very high96.6Very high134 Ų13494 Ų9458%0.58348%0.476SS*.Hα-helixtrans-68.7-37.8178.4-70.9-179176.6-174.50113.2I21 Q22 S23 Y27 C28I21-K25 HydrophobicContact CG1-CD 4.39Å; I21-K25 WeakPolarHBondContact O-CG 3.46Å; I21-K25 PolarHBondContact O-N 3.5Å; Q22-K25 PolarHBondContact O-N 3.4Å; S23-K25 VanDerWaalsContact C-N 3.31Å; S23-K25 PolarHBondContact O-N 3.35Å; K25-Y27 PolarHBondContact O-N 3.29Å; K25-C28 PolarHBondContact O-N 3.02Å
26A98.2Very high96.4Very high78 Ų7895.4 Ų95.465%0.64548%0.477SS*.Hα-helixtrans-64-31.8179.300000112.5Q22 S23Q22-A26 VanDerWaalsContact O-CB 3.31Å; Q22-A26 WeakPolarHBondContact O-CB 3.49Å; Q22-A26 PolarHBondContact O-N 3.14Å; S23-A26 PolarHBondContact O-N 3.26Å
27Y97.7Very high96.2Very high154 Ų15493 Ų9360%0.60447%0.466SS*.THydrogen-bonded Turntrans-103.63.1179.1-64-64.3000114.5S23 V24 K25 W29S23-Y27 WeakPolarHBondContact O-CD2 3.34Å; S23-Y27 PolarHBondContact O-N 3.09Å; S23-Y27 VanDerWaalsContact O-N 3.13Å; V24-Y27 PolarHBondContact O-N 3.31Å; K25-Y27 PolarHBondContact O-N 3.29Å; Y27-W29 VanDerWaalsContact C-N 3.32Å; Y27-W29 VanDerWaalsContact CB-CE2 3.48Å; Y27-W29 HydrophobicContact CD2-CH2 4Å; Y27-W29 HydrophobicContact CD2-CZ2 4.01Å; Y27-W29 HydrophobicContact CD2-CZ3 4.27Å; Y27-W29 HydrophobicContact CE2-CH2 4.49Å; Y27-W29 HydrophobicContact CG-CD2 4.49Å; Y27-W29 HydrophobicContact CG-CH2 4.44Å; Y27-W29 AromaticContact CG-CZ2 3.98Å; Y27-W29 HydrophobicContact CG-CZ2 3.98Å; Y27-W29 PolarHBondContact O-N 3.36Å
28C97.3Very high96.2Very high97 Ų9796.4 Ų96.466%0.65548%0.482SS*.THydrogen-bonded Turntrans52.846.1-176.3-53.40000113.1V24 K25 E30V24-C28 PolarHBondContact O-N 3.39Å; K25-C28 PolarHBondContact O-N 3.02Å; C28-E30 VanDerWaalsContact C-N 3.31Å; C28-E30 WeakPolarHBondContact CA-OE2 3.46Å; C28-E30 PolarHBondContact O-N 3Å
29W97.9Very high95.9Very high125 Ų12597.4 Ų97.447%0.47349%0.488SS..  trans-89.215.6-176.4-73.3-7.7000114.5V24 Y27 E31 A32 R33V24-W29 HydrophobicContact CG1-CB 4.21Å; V24-W29 PolarHBondContact O-N 2.98Å; Y27-W29 VanDerWaalsContact C-N 3.32Å; Y27-W29 VanDerWaalsContact CB-CE2 3.48Å; Y27-W29 HydrophobicContact CD2-CH2 4Å; Y27-W29 HydrophobicContact CD2-CZ2 4.01Å; Y27-W29 HydrophobicContact CD2-CZ3 4.27Å; Y27-W29 HydrophobicContact CE2-CH2 4.49Å; Y27-W29 HydrophobicContact CG-CD2 4.49Å; Y27-W29 HydrophobicContact CG-CH2 4.44Å; Y27-W29 AromaticContact CG-CZ2 3.98Å; Y27-W29 HydrophobicContact CG-CZ2 3.98Å; Y27-W29 PolarHBondContact O-N 3.36Å; W29-E31 PolarHBondContact O-N 2.68Å; W29-A32 PolarHBondContact O-N 3.39Å; W29-R33 WeakPolarHBondContact O-CG 3.44Å; W29-R33 PolarHBondContact O-N 3.38Å
30E96.2Very high95.3Very high82 Ų8292 Ų9238%0.38346%0.463SS..Hα-helixtrans-56-47.9-177.2-65.981.4-17900111.7V24 C28 A32 R33 E34V24-E30 HydrophobicContact CG1-CG 4.47Å; C28-E30 VanDerWaalsContact C-N 3.31Å; C28-E30 WeakPolarHBondContact CA-OE2 3.46Å; C28-E30 PolarHBondContact O-N 3Å; E30-A32 PolarHBondContact O-N 3.42Å; E30-R33 PolarHBondContact O-N 3.49Å; E30-E34 WeakPolarHBondContact O-CG 3.46Å; E30-E34 PolarHBondContact O-N 3.32Å
31E96.8Very high94.4Very high120 Ų12099.1 Ų99.156%0.56149%0.485SS*.Hα-helixtrans-65.7-38.3-178.7-167.9-171.8157.900112.6W29 R33 E34 K35W29-E31 PolarHBondContact O-N 2.68Å; E31-R33 VanDerWaalsContact C-N 3.33Å; E31-E34 PolarHBondContact O-N 3.41Å; E31-K35 WeakPolarHBondContact O-CG 3.3Å; E31-K35 PolarHBondContact O-N 3.08Å; E31-K35 VanDerWaalsContact O-N 3.09Å; E31-K35 VanDerWaalsContact OE1-CE 3.31Å; E31-K35 WeakPolarHBondContact OE1-CE 3.21Å; E31-K35 IonicContact OE1-NZ 2.67Å; E31-K35 PolarHBondContact OE1-NZ 3.13Å
32A94.7Very high94.3Very high60 Ų60100.7 Ų100.750%0.49649%0.491SS..Hα-helixtrans-66.7-38.2177.600000111.4W29 E30 M36W29-A32 PolarHBondContact O-N 3.39Å; E30-A32 PolarHBondContact O-N 3.42Å; A32-M36 PolarHBondContact O-N 3.27Å; A32-M36 VanDerWaalsContact O-N 3.17Å
33R93.8Very high94.1Very high55 Ų5597.2 Ų97.221%0.20848%0.476CS..Hα-helixtrans-67.8-41174.8-69.2-64.3-165.1-172.55.2111.9M17 V24 W29 E30 E31 M36 I37M17-R33 HydrophobicContact CG-CG 4.24Å; M17-R33 HydrophobicContact SD-CB 3.59Å; M17-R33 VanDerWaalsContact SD-CB 3.59Å; M17-R33 HydrophobicContact SD-CG 3.74Å; V24-R33 HydrophobicContact CG1-CG 4.25Å; V24-R33 HydrophobicContact CG2-CG 4.39Å; W29-R33 WeakPolarHBondContact O-CG 3.44Å; W29-R33 PolarHBondContact O-N 3.38Å; E30-R33 PolarHBondContact O-N 3.49Å; E31-R33 VanDerWaalsContact C-N 3.33Å; R33-M36 WeakPolarHBondContact O-CB 3.4Å; R33-M36 PolarHBondContact O-N 2.99Å; R33-I37 PolarHBondContact O-N 3.17Å; R33-I37 VanDerWaalsContact O-N 3.1Å
34E94.3Very high94Very high137 Ų13799.4 Ų99.464%0.6448%0.48SS*.Hα-helixtrans-59.1-48.4176-77.2179.6-176.200111.8E30 E31 M36 I37 E38E30-E34 WeakPolarHBondContact O-CG 3.46Å; E30-E34 PolarHBondContact O-N 3.32Å; E31-E34 PolarHBondContact O-N 3.41Å; E34-M36 VanDerWaalsContact C-N 3.29Å; E34-M36 PolarHBondContact O-N 3.2Å; E34-I37 PolarHBondContact O-N 3.14Å; E34-E38 WeakPolarHBondContact O-CB 3.44Å; E34-E38 PolarHBondContact O-N 3.02Å
35K95.5Very high93.8Very high108 Ų108105.1 Ų105.147%0.4751%0.508SS..Hα-helixtrans-60.6-38176.9-72175.5-174.2166.50112.6E31 E38 N39E31-K35 WeakPolarHBondContact O-CG 3.3Å; E31-K35 PolarHBondContact O-N 3.08Å; E31-K35 VanDerWaalsContact O-N 3.09Å; E31-K35 VanDerWaalsContact OE1-CE 3.31Å; E31-K35 WeakPolarHBondContact OE1-CE 3.21Å; E31-K35 IonicContact OE1-NZ 2.67Å; E31-K35 PolarHBondContact OE1-NZ 3.13Å; K35-E38 PolarHBondContact O-N 3.28Å; K35-N39 VanDerWaalsContact O-CG 3.27Å; K35-N39 PolarHBondContact O-N 3.35Å; K35-N39 PolarHBondContact O-ND2 2.92Å; K35-N39 VanDerWaalsContact O-ND2 3.14Å
36M92.9Very high93.6Very high86 Ų86103.3 Ų103.342%0.42450%0.503SS..Hα-helixtrans-62.4-44.5176.8-177.6-179.4-73.500111.7I13 A32 R33 E34I13-M36 HydrophobicContact CG2-SD 3.99Å; A32-M36 PolarHBondContact O-N 3.27Å; A32-M36 VanDerWaalsContact O-N 3.17Å; R33-M36 WeakPolarHBondContact O-CB 3.4Å; R33-M36 PolarHBondContact O-N 2.99Å; E34-M36 VanDerWaalsContact C-N 3.29Å; E34-M36 PolarHBondContact O-N 3.2Å
37I92.4Very high93.2Very high44 Ų44104.9 Ų104.923%0.22649%0.494CS..Hα-helixtrans-71.4-35.6178.3-64.4-64.1000111.9R10 I13 R33 E34 N39 L40R10-I37 HydrophobicContact CG-CD1 4.26Å; R10-I37 HydrophobicContact CG-CG2 4.4Å; I13-I37 HydrophobicContact CB-CD1 4.38Å; I13-I37 HydrophobicContact CG2-CD1 3.76Å; R33-I37 PolarHBondContact O-N 3.17Å; R33-I37 VanDerWaalsContact O-N 3.1Å; E34-I37 PolarHBondContact O-N 3.14Å; I37-N39 VanDerWaalsContact C-N 3.3Å; I37-N39 PolarHBondContact O-N 2.8Å; I37-L40 HydrophobicContact CD1-CD1 4.47Å; I37-L40 PolarHBondContact O-N 3.1Å; I37-L40 VanDerWaalsContact O-N 3.14Å
38E93.9Very high92.9Very high121 Ų121101.4 Ų101.457%0.56549%0.486SS*.Hα-helixtrans-60.6-39.8177.2-173.4171.1-161.300112.1E34 K35 L40 R41E34-E38 WeakPolarHBondContact O-CB 3.44Å; E34-E38 PolarHBondContact O-N 3.02Å; K35-E38 PolarHBondContact O-N 3.28Å; E38-L40 PolarHBondContact O-N 3.3Å; E38-L40 VanDerWaalsContact O-N 3.17Å; E38-R41 WeakPolarHBondContact O-CB 3.29Å; E38-R41 PolarHBondContact O-N 2.85Å
39N90.3Very high92.6Very high133 Ų133101.8 Ų101.871%0.71147%0.473SS*.THydrogen-bonded Turntrans-66.3-14.1177.6-69.9-28.4000114.3K35 I37K35-N39 VanDerWaalsContact O-CG 3.27Å; K35-N39 PolarHBondContact O-N 3.35Å; K35-N39 PolarHBondContact O-ND2 2.92Å; K35-N39 VanDerWaalsContact O-ND2 3.14Å; I37-N39 VanDerWaalsContact C-N 3.3Å; I37-N39 PolarHBondContact O-N 2.8Å
40L87.4Confident92.2Very high25 Ų2599.8 Ų99.813%0.13147%0.473CS..THydrogen-bonded Turntrans-953.6178.9-63.8169.9000113.3E9 I13 I37 E38E9-L40 HydrophobicContact CG-CD1 4.47Å; E9-L40 HydrophobicContact CG-CD2 4.05Å; I13-L40 HydrophobicContact CD1-CD1 3.41Å; I13-L40 VanDerWaalsContact CD1-CD1 3.41Å; I37-L40 HydrophobicContact CD1-CD1 4.47Å; I37-L40 PolarHBondContact O-N 3.1Å; I37-L40 VanDerWaalsContact O-N 3.14Å; E38-L40 PolarHBondContact O-N 3.3Å; E38-L40 VanDerWaalsContact O-N 3.17Å
41R77.7Confident91.8Very high227 Ų227101.5 Ų101.586%0.85748%0.481SS*.  trans-670167.9-81177.3142.3162.5-5.4111K6 E38K6-R41 PolarHBondContact NZ-O 3.37Å; K6-R41 PolarHBondContact NZ-OXT 3.36Å; E38-R41 WeakPolarHBondContact O-CB 3.29Å; E38-R41 PolarHBondContact O-N 2.85Å

Retrieved 41 of 41 residues in 93.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).