Y155A_MYCTU Loading...

Uncharacterized protein Rv1155A

AlphaFold DB , UniProt , Accession A0A089QKZ7, Species MYCTU (Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)), Gene n/a, Length 62 aa.

						>Y155A_MYCTU|A0A089QKZ7
MGESKSPQESSSEGETKRKFREALDRKMAQSSSGSDHKDGGGKQSRAHGPVASRREFRRKSG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48	Very low	62.5	Low	230 Å²	230	116.7 Å²	116.7	100%	1.133	68%	0.675	S	S	*	*				0	112.9	0	-62.9	-58.8	-165.2	0	0	106.6	E3	M1-E3 PolarHBondContact O-N 3.22Å
2	G	62.9	Low	63.9	Low	79 Å²	79	112.6 Å²	112.6	81%	0.814	66%	0.657	S	S	*	*			trans	-65.7	115.2	171.1	0	0	0	0	0	107.3	S4	G2-S4 PolarHBondContact O-N 3.27Å
3	E	60.3	Low	65.3	Low	182 Å²	182	107.1 Å²	107.1	85%	0.85	62%	0.622	S	S	*	*			trans	-58.4	108.5	176.1	-77.5	162.6	82.5	0	0	107.9	M1 K5	M1-E3 PolarHBondContact O-N 3.22Å; E3-K5 PolarHBondContact O-N 2.72Å
4	S	57.8	Low	67	Low	118 Å²	118	101.8 Å²	101.8	83%	0.825	60%	0.601	S	S	*	*			trans	-68.2	85.2	175.7	51	0	0	0	0	108.1	G2 S6	G2-S4 PolarHBondContact O-N 3.27Å; S4-S6 PolarHBondContact O-N 3.24Å
5	K	62.4	Low	68.4	Low	98 Å²	98	101.9 Å²	101.9	43%	0.426	59%	0.594	S	S	.	*			trans	-59	125	179.2	-144.9	109.6	-178.5	-156.8	0	109.3	E3 E9 E13	E3-K5 PolarHBondContact O-N 2.72Å; K5-E9 HydrophobicContact CD-CG 4.37Å; K5-E9 WeakPolarHBondContact CE-OE1 3.38Å; K5-E9 WeakPolarHBondContact CE-OE2 3.32Å; K5-E9 HydrophobicContact CG-CB 3.86Å; K5-E9 HydrophobicContact CG-CG 3.74Å; K5-E9 IonicContact NZ-OE1 3.41Å; K5-E9 PolarHBondContact NZ-OE1 3.41Å; K5-E13 WeakPolarHBondContact CD-OE1 3.3Å; K5-E13 WeakPolarHBondContact CE-OE1 3.27Å; K5-E13 IonicContact NZ-OE1 2.72Å; K5-E13 PolarHBondContact NZ-OE1 2.93Å
6	S	60.6	Low	69.7	Low	71 Å²	71	98.9 Å²	98.9	50%	0.497	58%	0.577	S	S	.	*			trans	-48.9	146.9	-177.3	-41.9	0	0	0	0	112.2	S4 Q8 E9 S10	S4-S6 PolarHBondContact O-N 3.24Å; S6-Q8 PolarHBondContact O-N 3.11Å; S6-E9 CarbonylContact O-C 3.28Å; S6-E9 WeakPolarHBondContact O-CA 3.4Å; S6-E9 PolarHBondContact O-N 3.14Å; S6-S10 PolarHBondContact O-N 3.16Å
7	P	65.9	Low	71	Confident	107 Å²	107	100.1 Å²	100.1	70%	0.695	57%	0.574	S	S	*	*	H	α-helix	trans	-56.3	-29	-176.4	-24.5	32.1	0	0	0	115	S10 S11	P7-S10 WeakPolarHBondContact CA-OG 3.49Å; P7-S10 PolarHBondContact O-OG 3.35Å; P7-S11 PolarHBondContact O-N 2.72Å; P7-S11 PolarHBondContact O-OG 3.22Å
8	Q	63.2	Low	72.1	Confident	173 Å²	173	104.1 Å²	104.1	81%	0.808	58%	0.578	S	S	*	*	H	α-helix	trans	-73.1	-37.5	176.3	-173	170.3	-22.6	0	0	111.7	S6 S12	S6-Q8 PolarHBondContact O-N 3.11Å; Q8-S12 PolarHBondContact O-N 2.93Å
9	E	63.1	Low	73.2	Confident	90 Å²	90	105.4 Å²	105.4	42%	0.421	58%	0.577	S	S	.	*	H	α-helix	trans	-76	-32.9	175.7	-165.2	160.3	-175.9	0	0	111.2	K5 S6 S11 S12 E13	K5-E9 HydrophobicContact CD-CG 4.37Å; K5-E9 WeakPolarHBondContact CE-OE1 3.38Å; K5-E9 WeakPolarHBondContact CE-OE2 3.32Å; K5-E9 HydrophobicContact CG-CB 3.86Å; K5-E9 HydrophobicContact CG-CG 3.74Å; K5-E9 IonicContact NZ-OE1 3.41Å; K5-E9 PolarHBondContact NZ-OE1 3.41Å; S6-E9 CarbonylContact O-C 3.28Å; S6-E9 WeakPolarHBondContact O-CA 3.4Å; S6-E9 PolarHBondContact O-N 3.14Å; E9-S11 PolarHBondContact O-N 3.04Å; E9-S12 PolarHBondContact O-N 3.34Å; E9-E13 HydrophobicContact CG-CG 4.12Å; E9-E13 WeakPolarHBondContact O-CB 3.48Å; E9-E13 VanDerWaalsContact O-CG 3.26Å; E9-E13 WeakPolarHBondContact O-CG 3.39Å; E9-E13 PolarHBondContact O-N 2.86Å
10	S	68	Low	74.3	Confident	60 Å²	60	107.7 Å²	107.7	42%	0.42	58%	0.581	S	S	.	*	H	α-helix	trans	-61.3	-32.1	173.9	70.7	0	0	0	0	113	S6 P7 G14	S6-S10 PolarHBondContact O-N 3.16Å; P7-S10 WeakPolarHBondContact CA-OG 3.49Å; P7-S10 PolarHBondContact O-OG 3.35Å; S10-G14 PolarHBondContact O-N 3.16Å
11	S	74.9	Confident	75.2	Confident	76 Å²	76	110.6 Å²	110.6	53%	0.531	58%	0.584	S	S	.	*	H	α-helix	trans	-68.9	-50.2	174.3	-59.9	0	0	0	0	111.7	P7 E9 E13 G14 E15	P7-S11 PolarHBondContact O-N 2.72Å; P7-S11 PolarHBondContact O-OG 3.22Å; E9-S11 PolarHBondContact O-N 3.04Å; S11-E13 VanDerWaalsContact C-N 3.33Å; S11-E13 PolarHBondContact O-N 2.78Å; S11-G14 PolarHBondContact O-N 2.91Å; S11-G14 VanDerWaalsContact O-N 3.12Å; S11-E15 PolarHBondContact O-N 3.32Å
12	S	79.5	Confident	77.4	Confident	67 Å²	67	103.7 Å²	103.7	47%	0.469	55%	0.549	S	S	.	.	H	α-helix	trans	-61.8	-40.3	174.7	-179.7	0	0	0	0	111.9	Q8 E9 G14 E15 T16	Q8-S12 PolarHBondContact O-N 2.93Å; E9-S12 PolarHBondContact O-N 3.34Å; S12-G14 VanDerWaalsContact C-N 3.33Å; S12-G14 PolarHBondContact O-N 2.93Å; S12-E15 PolarHBondContact O-N 2.95Å; S12-T16 WeakPolarHBondContact O-CB 3.37Å; S12-T16 WeakPolarHBondContact O-CG2 3.34Å; S12-T16 PolarHBondContact O-N 2.83Å; S12-T16 PolarHBondContact O-OG1 3.05Å
13	E	82.5	Confident	78.8	Confident	41 Å²	41	102.3 Å²	102.3	19%	0.192	53%	0.53	C	S	.	.	H	α-helix	trans	-63.7	-38	172.8	-78.4	-162.9	166.7	0	0	112	K5 E9 S11 T16 K17	K5-E13 WeakPolarHBondContact CD-OE1 3.3Å; K5-E13 WeakPolarHBondContact CE-OE1 3.27Å; K5-E13 IonicContact NZ-OE1 2.72Å; K5-E13 PolarHBondContact NZ-OE1 2.93Å; E9-E13 HydrophobicContact CG-CG 4.12Å; E9-E13 WeakPolarHBondContact O-CB 3.48Å; E9-E13 VanDerWaalsContact O-CG 3.26Å; E9-E13 WeakPolarHBondContact O-CG 3.39Å; E9-E13 PolarHBondContact O-N 2.86Å; S11-E13 VanDerWaalsContact C-N 3.33Å; S11-E13 PolarHBondContact O-N 2.78Å; E13-T16 WeakPolarHBondContact CA-OG1 3.31Å; E13-T16 PolarHBondContact O-OG1 3.5Å; E13-K17 WeakPolarHBondContact O-CB 3.39Å; E13-K17 WeakPolarHBondContact O-CD 3.48Å; E13-K17 WeakPolarHBondContact O-CG 3.47Å; E13-K17 PolarHBondContact O-N 3.44Å; E13-K17 IonicContact OE2-NZ 2.66Å; E13-K17 PolarHBondContact OE2-NZ 3.26Å
14	G	88.9	Confident	80.4	Confident	33 Å²	33	98.2 Å²	98.2	34%	0.34	51%	0.513	S	S	.	.	H	α-helix	trans	-61.6	-45.5	174.8	0	0	0	0	0	111.7	S10 S11 S12 R18	S10-G14 PolarHBondContact O-N 3.16Å; S11-G14 PolarHBondContact O-N 2.91Å; S11-G14 VanDerWaalsContact O-N 3.12Å; S12-G14 VanDerWaalsContact C-N 3.33Å; S12-G14 PolarHBondContact O-N 2.93Å; G14-R18 WeakPolarHBondContact O-CB 3.47Å; G14-R18 PolarHBondContact O-N 2.9Å
15	E	88.2	Confident	82	Confident	104 Å²	104	97.4 Å²	97.4	49%	0.486	50%	0.5	S	S	.	.	H	α-helix	trans	-65.9	-45.1	175.8	-69.5	-178.4	-170	0	0	112.8	S11 S12 R18 K19	S11-E15 PolarHBondContact O-N 3.32Å; S12-E15 PolarHBondContact O-N 2.95Å; E15-R18 WeakPolarHBondContact O-CB 3.38Å; E15-R18 PolarHBondContact O-N 3.49Å; E15-K19 WeakPolarHBondContact O-CG 3.22Å; E15-K19 PolarHBondContact O-N 2.85Å
16	T	89.4	Confident	83.2	Confident	54 Å²	54	100 Å²	100	33%	0.331	51%	0.507	S	S	.	.	H	α-helix	trans	-64.4	-46.1	177	52	0	0	0	0	110.8	S12 E13 R18 K19 F20	S12-T16 WeakPolarHBondContact O-CB 3.37Å; S12-T16 WeakPolarHBondContact O-CG2 3.34Å; S12-T16 PolarHBondContact O-N 2.83Å; S12-T16 PolarHBondContact O-OG1 3.05Å; E13-T16 WeakPolarHBondContact CA-OG1 3.31Å; E13-T16 PolarHBondContact O-OG1 3.5Å; T16-R18 VanDerWaalsContact C-N 3.28Å; T16-R18 PolarHBondContact O-N 2.88Å; T16-K19 PolarHBondContact O-N 3.23Å; T16-K19 VanDerWaalsContact O-N 3.14Å; T16-F20 WeakPolarHBondContact O-CD2 3.49Å; T16-F20 PolarHBondContact O-N 3.19Å
17	K	90.7	Very high	84.7	Confident	118 Å²	118	103.4 Å²	103.4	51%	0.513	51%	0.513	S	S	.	.	H	α-helix	trans	-57.7	-40.2	173.5	-73.8	165.6	-175.1	157.9	0	111.2	E13 F20 R21	E13-K17 WeakPolarHBondContact O-CB 3.39Å; E13-K17 WeakPolarHBondContact O-CD 3.48Å; E13-K17 WeakPolarHBondContact O-CG 3.47Å; E13-K17 PolarHBondContact O-N 3.44Å; E13-K17 IonicContact OE2-NZ 2.66Å; E13-K17 PolarHBondContact OE2-NZ 3.26Å; K17-F20 PolarHBondContact O-N 3.47Å; K17-R21 WeakPolarHBondContact O-CB 3.33Å; K17-R21 WeakPolarHBondContact O-CG 3.37Å; K17-R21 PolarHBondContact O-N 2.84Å
18	R	92.3	Very high	85.6	Confident	173 Å²	173	103.1 Å²	103.1	65%	0.653	50%	0.503	S	S	*	.	H	α-helix	trans	-61	-48.2	174.3	-169.9	-173.8	-67.2	139.3	-1.7	111.6	G14 E15 T16 R21 E22	G14-R18 WeakPolarHBondContact O-CB 3.47Å; G14-R18 PolarHBondContact O-N 2.9Å; E15-R18 WeakPolarHBondContact O-CB 3.38Å; E15-R18 PolarHBondContact O-N 3.49Å; T16-R18 VanDerWaalsContact C-N 3.28Å; T16-R18 PolarHBondContact O-N 2.88Å; R18-R21 PolarHBondContact O-N 3.42Å; R18-E22 WeakPolarHBondContact O-CB 3.36Å; R18-E22 PolarHBondContact O-N 3.48Å
19	K	92.6	Very high	86.4	Confident	128 Å²	128	98.2 Å²	98.2	56%	0.557	49%	0.492	S	S	*	.	H	α-helix	trans	-63	-40.1	176.7	-70	170.4	-176.2	170.2	0	112.5	E15 T16 E22 A23	E15-K19 WeakPolarHBondContact O-CG 3.22Å; E15-K19 PolarHBondContact O-N 2.85Å; T16-K19 PolarHBondContact O-N 3.23Å; T16-K19 VanDerWaalsContact O-N 3.14Å; K19-E22 PolarHBondContact O-N 2.95Å; K19-A23 WeakPolarHBondContact O-CB 3.09Å; K19-A23 PolarHBondContact O-N 3.48Å
20	F	94.6	Very high	87.1	Confident	151 Å²	151	101 Å²	101	66%	0.662	51%	0.505	S	S	*	.	H	α-helix	trans	-64.1	-43.1	176.1	-80.2	-64.7	0	0	0	111.5	T16 K17 A23 L24	T16-F20 WeakPolarHBondContact O-CD2 3.49Å; T16-F20 PolarHBondContact O-N 3.19Å; K17-F20 PolarHBondContact O-N 3.47Å; F20-A23 PolarHBondContact O-N 3.17Å; F20-L24 VanDerWaalsContact O-CB 3.31Å; F20-L24 WeakPolarHBondContact O-CB 3.13Å; F20-L24 PolarHBondContact O-N 2.97Å
21	R	93.2	Very high	87.2	Confident	170 Å²	170	101.3 Å²	101.3	64%	0.642	51%	0.508	S	S	*	.	H	α-helix	trans	-61	-48.6	174.9	-70.8	175.6	69.2	76.7	9.2	111.3	K17 R18 A23 L24 D25	K17-R21 WeakPolarHBondContact O-CB 3.33Å; K17-R21 WeakPolarHBondContact O-CG 3.37Å; K17-R21 PolarHBondContact O-N 2.84Å; R18-R21 PolarHBondContact O-N 3.42Å; R21-A23 VanDerWaalsContact C-N 3.34Å; R21-A23 PolarHBondContact O-N 3.4Å; R21-L24 WeakPolarHBondContact O-CB 3.48Å; R21-L24 PolarHBondContact O-N 3.01Å; R21-D25 WeakPolarHBondContact O-CB 3.34Å; R21-D25 VanDerWaalsContact O-CG 3.23Å; R21-D25 PolarHBondContact O-N 3.45Å
22	E	93.5	Very high	86.8	Confident	84 Å²	84	102.4 Å²	102.4	39%	0.393	52%	0.515	S	S	.	.	H	α-helix	trans	-57.9	-43.7	176.3	-175.8	-170	165.4	0	0	112.4	R18 K19 D25 R26	R18-E22 WeakPolarHBondContact O-CB 3.36Å; R18-E22 PolarHBondContact O-N 3.48Å; K19-E22 PolarHBondContact O-N 2.95Å; E22-D25 PolarHBondContact O-N 2.94Å; E22-R26 WeakPolarHBondContact O-CB 3.44Å; E22-R26 WeakPolarHBondContact O-CG 3.03Å; E22-R26 PolarHBondContact O-N 2.85Å; E22-R26 IonicContact OE1-CZ 2.99Å; E22-R26 IonicContact OE1-NH1 2.85Å; E22-R26 PolarHBondContact OE1-NH1 3.37Å; E22-R26 IonicContact OE1-NH2 2.78Å; E22-R26 PolarHBondContact OE1-NH2 2.85Å
23	A	94.1	Very high	86.1	Confident	51 Å²	51	102.1 Å²	102.1	42%	0.421	51%	0.513	S	S	.	.	H	α-helix	trans	-67.3	-37.6	177.3	0	0	0	0	0	112.4	K19 F20 R21 K27	K19-A23 WeakPolarHBondContact O-CB 3.09Å; K19-A23 PolarHBondContact O-N 3.48Å; F20-A23 PolarHBondContact O-N 3.17Å; R21-A23 VanDerWaalsContact C-N 3.34Å; R21-A23 PolarHBondContact O-N 3.4Å; A23-K27 WeakPolarHBondContact O-CB 3.21Å; A23-K27 PolarHBondContact O-N 2.97Å
24	L	92.7	Very high	85	Confident	95 Å²	95	102.1 Å²	102.1	50%	0.497	53%	0.525	S	S	.	.	H	α-helix	trans	-64.8	-47.8	175.8	-151.1	-179.8	0	0	0	109.7	F20 R21 R26 K27 M28	F20-L24 VanDerWaalsContact O-CB 3.31Å; F20-L24 WeakPolarHBondContact O-CB 3.13Å; F20-L24 PolarHBondContact O-N 2.97Å; R21-L24 WeakPolarHBondContact O-CB 3.48Å; R21-L24 PolarHBondContact O-N 3.01Å; L24-R26 PolarHBondContact O-N 3.47Å; L24-K27 PolarHBondContact O-N 3.43Å; L24-M28 HydrophobicContact CD2-CE 3.64Å; L24-M28 HydrophobicContact CD2-CG 3.41Å; L24-M28 VanDerWaalsContact CD2-CG 3.41Å; L24-M28 HydrophobicContact CD2-SD 4.31Å; L24-M28 VanDerWaalsContact O-CG 3.3Å; L24-M28 WeakPolarHBondContact O-CG 3.32Å; L24-M28 PolarHBondContact O-N 3.38Å
25	D	91	Very high	83.5	Confident	101 Å²	101	104 Å²	104	54%	0.54	53%	0.532	S	S	.	.	H	α-helix	trans	-60.7	-44.4	178	-67.6	-18.6	0	0	0	111.1	R21 E22 K27 M28 A29	R21-D25 WeakPolarHBondContact O-CB 3.34Å; R21-D25 VanDerWaalsContact O-CG 3.23Å; R21-D25 PolarHBondContact O-N 3.45Å; E22-D25 PolarHBondContact O-N 2.94Å; D25-K27 PolarHBondContact O-N 3.17Å; D25-M28 PolarHBondContact O-N 3.32Å; D25-A29 WeakPolarHBondContact O-CB 3.5Å; D25-A29 PolarHBondContact O-N 2.96Å
26	R	89.3	Confident	82.1	Confident	154 Å²	154	104.2 Å²	104.2	58%	0.581	54%	0.537	S	S	*	.	H	α-helix	trans	-57.3	-48.1	172.7	-79.7	-176.8	174.4	129.6	9.4	112.3	E22 L24 A29 Q30	E22-R26 WeakPolarHBondContact O-CB 3.44Å; E22-R26 WeakPolarHBondContact O-CG 3.03Å; E22-R26 PolarHBondContact O-N 2.85Å; E22-R26 IonicContact OE1-CZ 2.99Å; E22-R26 IonicContact OE1-NH1 2.85Å; E22-R26 PolarHBondContact OE1-NH1 3.37Å; E22-R26 IonicContact OE1-NH2 2.78Å; E22-R26 PolarHBondContact OE1-NH2 2.85Å; L24-R26 PolarHBondContact O-N 3.47Å; R26-A29 PolarHBondContact O-N 2.89Å; R26-Q30 WeakPolarHBondContact O-CB 2.89Å; R26-Q30 VanDerWaalsContact O-CG 3.27Å; R26-Q30 WeakPolarHBondContact O-CG 3.17Å; R26-Q30 PolarHBondContact O-N 2.88Å
27	K	90.7	Very high	80.7	Confident	141 Å²	141	107.9 Å²	107.9	61%	0.613	55%	0.55	S	S	*	.	H	α-helix	trans	-64.8	-41.1	-179.4	-175.5	178.1	-179.1	-179.2	0	111.5	A23 L24 D25 Q30 S31	A23-K27 WeakPolarHBondContact O-CB 3.21Å; A23-K27 PolarHBondContact O-N 2.97Å; L24-K27 PolarHBondContact O-N 3.43Å; D25-K27 PolarHBondContact O-N 3.17Å; K27-Q30 PolarHBondContact O-N 2.66Å; K27-S31 WeakPolarHBondContact O-CB 3.06Å; K27-S31 PolarHBondContact O-N 2.91Å; K27-S31 PolarHBondContact O-OG 3.28Å
28	M	85.7	Confident	79.1	Confident	102 Å²	102	110.7 Å²	110.7	50%	0.502	56%	0.562	S	S	.	*	H	α-helix	trans	-66.4	-44.9	179.3	-69.3	-61.9	145.4	0	0	111.2	L24 D25 Q30 S31 S32	L24-M28 HydrophobicContact CD2-CE 3.64Å; L24-M28 HydrophobicContact CD2-CG 3.41Å; L24-M28 VanDerWaalsContact CD2-CG 3.41Å; L24-M28 HydrophobicContact CD2-SD 4.31Å; L24-M28 VanDerWaalsContact O-CG 3.3Å; L24-M28 WeakPolarHBondContact O-CG 3.32Å; L24-M28 PolarHBondContact O-N 3.38Å; D25-M28 PolarHBondContact O-N 3.32Å; M28-Q30 VanDerWaalsContact C-N 3.34Å; M28-Q30 PolarHBondContact O-N 2.78Å; M28-S31 WeakPolarHBondContact CA-OG 3.33Å; M28-S31 PolarHBondContact O-N 3.34Å; M28-S31 PolarHBondContact O-OG 3.42Å; M28-S32 WeakPolarHBondContact O-CB 2.92Å; M28-S32 PolarHBondContact O-N 2.81Å
29	A	80.6	Confident	77.6	Confident	70 Å²	70	109.5 Å²	109.5	58%	0.579	57%	0.569	S	S	*	*	H	α-helix	trans	-57.8	-45	173.8	0	0	0	0	0	112	D25 R26 S32 S33	D25-A29 WeakPolarHBondContact O-CB 3.5Å; D25-A29 PolarHBondContact O-N 2.96Å; R26-A29 PolarHBondContact O-N 2.89Å; A29-S32 PolarHBondContact O-N 3.38Å; A29-S33 PolarHBondContact O-N 3.14Å
30	Q	76.2	Confident	75.6	Confident	147 Å²	147	105.5 Å²	105.5	69%	0.687	56%	0.564	S	S	*	*	H	α-helix	trans	-65.5	-39.1	175.9	-71.5	176.1	-47.4	0	0	112.8	R26 K27 M28 S33	R26-Q30 WeakPolarHBondContact O-CB 2.89Å; R26-Q30 VanDerWaalsContact O-CG 3.27Å; R26-Q30 WeakPolarHBondContact O-CG 3.17Å; R26-Q30 PolarHBondContact O-N 2.88Å; K27-Q30 PolarHBondContact O-N 2.66Å; M28-Q30 VanDerWaalsContact C-N 3.34Å; M28-Q30 PolarHBondContact O-N 2.78Å; Q30-S33 PolarHBondContact O-N 2.79Å
31	S	69.9	Low	73.8	Confident	68 Å²	68	101.8 Å²	101.8	48%	0.476	57%	0.569	S	S	.	*	H	α-helix	trans	-72.9	-30.2	179.6	68.3	0	0	0	0	113.4	K27 M28 S33 G34	K27-S31 WeakPolarHBondContact O-CB 3.06Å; K27-S31 PolarHBondContact O-N 2.91Å; K27-S31 PolarHBondContact O-OG 3.28Å; M28-S31 WeakPolarHBondContact CA-OG 3.33Å; M28-S31 PolarHBondContact O-N 3.34Å; M28-S31 PolarHBondContact O-OG 3.42Å; S31-S33 VanDerWaalsContact C-N 3.26Å; S31-S33 PolarHBondContact O-N 3.03Å; S31-G34 WeakPolarHBondContact O-CA 3.26Å; S31-G34 PolarHBondContact O-N 3.33Å
32	S	66.9	Low	72.1	Confident	98 Å²	98	96.9 Å²	96.9	69%	0.685	57%	0.57	S	S	*	*	H	α-helix	trans	-69.9	-25.6	177.2	-167.3	0	0	0	0	112	M28 A29 G34	M28-S32 WeakPolarHBondContact O-CB 2.92Å; M28-S32 PolarHBondContact O-N 2.81Å; A29-S32 PolarHBondContact O-N 3.38Å; S32-G34 PolarHBondContact O-N 2.94Å
33	S	64.6	Low	70.5	Confident	61 Å²	61	102 Å²	102	43%	0.427	59%	0.592	S	S	.	*	T	Hydrogen-bonded Turn	trans	-73	2.3	167	178.9	0	0	0	0	112.4	A29 Q30 S31 S35 D36	A29-S33 PolarHBondContact O-N 3.14Å; Q30-S33 PolarHBondContact O-N 2.79Å; S31-S33 VanDerWaalsContact C-N 3.26Å; S31-S33 PolarHBondContact O-N 3.03Å; S33-S35 PolarHBondContact O-N 2.85Å; S33-D36 WeakPolarHBondContact O-CB 3.41Å; S33-D36 PolarHBondContact O-N 2.98Å; S33-D36 PolarHBondContact OG-OD2 2.85Å
34	G	59.1	Low	68.9	Low	42 Å²	42	108.2 Å²	108.2	43%	0.433	61%	0.612	S	S	.	*	T	Hydrogen-bonded Turn	trans	-60.9	-12.9	174.2	0	0	0	0	0	114.7	S31 S32 D36	S31-G34 WeakPolarHBondContact O-CA 3.26Å; S31-G34 PolarHBondContact O-N 3.33Å; S32-G34 PolarHBondContact O-N 2.94Å; G34-D36 VanDerWaalsContact C-N 3.32Å
35	S	57.9	Low	67.3	Low	72 Å²	72	108.8 Å²	108.8	50%	0.503	62%	0.624	S	S	.	*	H	α-helix	trans	-70.3	-27.8	168.9	71.4	0	0	0	0	112.7	S33 H37 K38 D39	S33-S35 PolarHBondContact O-N 2.85Å; S35-H37 PolarHBondContact O-N 3.48Å; S35-H37 VanDerWaalsContact O-N 3.16Å; S35-K38 PolarHBondContact O-N 3.12Å; S35-D39 PolarHBondContact O-N 2.83Å
36	D	60.1	Low	65.8	Low	108 Å²	108	114.3 Å²	114.3	58%	0.578	64%	0.637	S	S	*	*	H	α-helix	trans	-61	-26.4	177.8	-75.6	-82.1	0	0	0	112.6	S33 G34 G40	S33-D36 WeakPolarHBondContact O-CB 3.41Å; S33-D36 PolarHBondContact O-N 2.98Å; S33-D36 PolarHBondContact OG-OD2 2.85Å; G34-D36 VanDerWaalsContact C-N 3.32Å; D36-G40 WeakPolarHBondContact O-CA 3.47Å; D36-G40 PolarHBondContact O-N 2.97Å
37	H	58.7	Low	64.7	Low	131 Å²	131	111.4 Å²	111.4	61%	0.606	65%	0.646	S	S	*	*	H	α-helix	trans	-77.4	-29.5	173.6	-178.6	-55.1	0	0	0	112.2	S35 D39 G40	S35-H37 PolarHBondContact O-N 3.48Å; S35-H37 VanDerWaalsContact O-N 3.16Å; H37-D39 VanDerWaalsContact C-N 3.34Å; H37-G40 PolarHBondContact O-N 2.71Å
38	K	56.9	Low	63.3	Low	177 Å²	177	111.8 Å²	111.8	77%	0.77	65%	0.65	S	S	*	*	H	α-helix	trans	-69.8	-36.2	179.8	-64.7	-63.3	-177.9	178.9	0	111.1	S35	S35-K38 PolarHBondContact O-N 3.12Å
39	D	61.2	Low	62.2	Low	148 Å²	148	109 Å²	109	79%	0.791	65%	0.647	S	S	*	*	H	α-helix	trans	-82.2	-24	171.2	-65	-51.1	0	0	0	112.8	S35 H37 G41	S35-D39 PolarHBondContact O-N 2.83Å; H37-D39 VanDerWaalsContact C-N 3.34Å; D39-G41 PolarHBondContact O-N 3.46Å; D39-G41 VanDerWaalsContact O-N 3.16Å
40	G	51.9	Low	61.5	Low	45 Å²	45	112 Å²	112	46%	0.464	66%	0.661	S	S	.	*	T	Hydrogen-bonded Turn	trans	-78.3	17.2	178.5	0	0	0	0	0	116.2	D36 H37 G42	D36-G40 WeakPolarHBondContact O-CA 3.47Å; D36-G40 PolarHBondContact O-N 2.97Å; H37-G40 PolarHBondContact O-N 2.71Å; G40-G42 PolarHBondContact O-N 2.72Å
41	G	55.3	Low	61	Low	73 Å²	73	110.6 Å²	110.6	75%	0.753	66%	0.662	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.2	23.1	-178.4	0	0	0	0	0	117	D39	D39-G41 PolarHBondContact O-N 3.46Å; D39-G41 VanDerWaalsContact O-N 3.16Å
42	G	58.9	Low	60.8	Low	66 Å²	66	112.1 Å²	112.1	68%	0.68	68%	0.679	S	S	*	*	T	Hydrogen-bonded Turn	trans	-120.7	-17.7	-174.4	0	0	0	0	0	118.2	G40	G40-G42 PolarHBondContact O-N 2.72Å
43	K	58.6	Low	60.8	Low	192 Å²	192	111.5 Å²	111.5	84%	0.835	67%	0.674	S	S	*	*			trans	-137.7	10.3	-155.8	-50.2	-165.1	-173.1	-164.1	0	119.9	S45	K43-S45 PolarHBondContact O-N 2.95Å
44	Q	61.1	Low	61.2	Low	182 Å²	182	118.7 Å²	118.7	85%	0.85	69%	0.692	S	S	*	*			trans	-84.8	68.7	157.1	-68.3	-174	-49.3	0	0	108.5	R46	Q44-R46 PolarHBondContact O-N 3.18Å
45	S	59.1	Low	62	Low	107 Å²	107	126.2 Å²	126.2	75%	0.748	71%	0.707	S	S	*	*			trans	-48	110.5	156.3	169.6	0	0	0	0	105.6	K43 A47	K43-S45 PolarHBondContact O-N 2.95Å; S45-A47 PolarHBondContact O-N 2.82Å
46	R	60.4	Low	63	Low	217 Å²	217	130.6 Å²	130.6	82%	0.819	72%	0.72	S	S	*	*			trans	-40.7	118.5	169.5	-76.3	174.5	171	124.8	-3.1	106.4	Q44 H48 G49	Q44-R46 PolarHBondContact O-N 3.18Å; R46-H48 CarbonylContact O-C 3.59Å; R46-H48 VanDerWaalsContact O-C 3.28Å; R46-H48 PolarHBondContact O-N 3.41Å; R46-G49 PolarHBondContact O-N 3.38Å
47	A	65.1	Low	64.3	Low	93 Å²	93	134 Å²	134	77%	0.769	73%	0.73	S	S	*	*	S	Bend	trans	-54.6	-16.1	-178.8	0	0	0	0	0	112.1	S45	S45-A47 PolarHBondContact O-N 2.82Å
48	H	62.3	Low	65.5	Low	148 Å²	148	139.7 Å²	139.7	69%	0.685	75%	0.746	S	S	*	*	S	Bend	trans	-115.2	96.7	167	-46.1	-59.5	0	0	0	107.6	R46 V51	R46-H48 CarbonylContact O-C 3.59Å; R46-H48 VanDerWaalsContact O-C 3.28Å; R46-H48 PolarHBondContact O-N 3.41Å; H48-V51 HydrophobicContact CB-CG2 4.37Å
49	G	62.6	Low	66.6	Low	43 Å²	43	142.6 Å²	142.6	44%	0.443	75%	0.752	S	S	.	*			trans	-53.8	164.1	157.1	0	0	0	0	0	109.5	R46 V51	R46-G49 PolarHBondContact O-N 3.38Å; G49-V51 PolarHBondContact O-N 3.28Å
50	P	64.4	Low	67.9	Low	134 Å²	134	144.9 Å²	144.9	87%	0.87	76%	0.755	S	S	*	*			trans	-50.3	110.4	178.8	20.9	-30.6	0	0	0	108.1	A52	P50-A52 PolarHBondContact O-N 2.84Å
51	V	66.1	Low	69.2	Low	117 Å²	117	148.6 Å²	148.6	71%	0.709	77%	0.774	S	S	*	*			trans	-65.5	89.7	-173.2	166.7	0	0	0	0	106.6	H48 G49 S53	H48-V51 HydrophobicContact CB-CG2 4.37Å; G49-V51 PolarHBondContact O-N 3.28Å; V51-S53 PolarHBondContact O-N 3.26Å
52	A	65.2	Low	69.9	Low	101 Å²	101	151.5 Å²	151.5	84%	0.835	80%	0.804	S	S	*	*			trans	-83.9	19	-179.9	0	0	0	0	0	112	P50 R54	P50-A52 PolarHBondContact O-N 2.84Å; A52-R54 VanDerWaalsContact C-N 3.32Å; A52-R54 PolarHBondContact O-N 3.39Å
53	S	68.2	Low	70.4	Confident	84 Å²	84	155.8 Å²	155.8	59%	0.587	81%	0.81	S	S	*	*			trans	-94.7	65.1	176.2	-159.7	0	0	0	0	110.6	V51 R55	V51-S53 PolarHBondContact O-N 3.26Å; S53-R55 VanDerWaalsContact C-N 3.32Å; S53-R55 PolarHBondContact O-N 3.05Å; S53-R55 VanDerWaalsContact O-N 3.11Å
54	R	72.2	Confident	71.1	Confident	213 Å²	213	153.8 Å²	153.8	80%	0.804	81%	0.808	S	S	*	*			trans	-73.1	96.3	158.3	-173.1	169.5	-69.1	164.3	0.8	106.5	A52 E56	A52-R54 VanDerWaalsContact C-N 3.32Å; A52-R54 PolarHBondContact O-N 3.39Å; R54-E56 HydrophobicContact CG-CG 4.15Å; R54-E56 PolarHBondContact O-N 2.9Å; R54-E56 VanDerWaalsContact O-N 3.14Å
55	R	76	Confident	71.6	Confident	199 Å²	199	152.3 Å²	152.3	75%	0.751	81%	0.806	S	S	*	*			trans	-70.1	103.7	170.4	-80.8	175.6	-77.8	173.1	-2.8	107.9	S53	S53-R55 VanDerWaalsContact C-N 3.32Å; S53-R55 PolarHBondContact O-N 3.05Å; S53-R55 VanDerWaalsContact O-N 3.11Å
56	E	78.8	Confident	72.3	Confident	164 Å²	164	154.9 Å²	154.9	77%	0.766	81%	0.809	S	S	*	*	P	Polyproline II helix	trans	-87.5	126.8	169.7	-68.5	-177.8	-173.3	0	0	109.7	R54	R54-E56 HydrophobicContact CG-CG 4.15Å; R54-E56 PolarHBondContact O-N 2.9Å; R54-E56 VanDerWaalsContact O-N 3.14Å
57	F	86.4	Confident	73.1	Confident	181 Å²	181	151.1 Å²	151.1	79%	0.794	81%	0.809	S	S	*	*	P	Polyproline II helix	trans	-85	124.8	176.8	-62	-85.9	0	0	0	109.1	R59	F57-R59 PolarHBondContact O-N 3.32Å
58	R	84.1	Confident	73.6	Confident	249 Å²	249	154.9 Å²	154.9	94%	0.94	81%	0.812	S	S	*	*	P	Polyproline II helix	trans	-59.7	122.9	167.9	-84.2	-169.7	173	115.4	-1.3	108.8	K60	R58-K60 PolarHBondContact O-N 2.88Å
59	R	81.6	Confident	74.4	Confident	239 Å²	239	155.4 Å²	155.4	90%	0.902	82%	0.821	S	S	*	*	P	Polyproline II helix	trans	-74.2	120.8	168.2	-59.3	-169.7	160.3	-137.5	-7.9	107.5	F57 S61	F57-R59 PolarHBondContact O-N 3.32Å; R59-S61 PolarHBondContact O-N 3.17Å
60	K	87.7	Confident	75.3	Confident	196 Å²	196	164.1 Å²	164.1	85%	0.852	85%	0.85	S	S	*	*	P	Polyproline II helix	trans	-62.3	117.7	172.4	-176.3	179.6	174.9	-174.5	0	107.8	R58	R58-K60 PolarHBondContact O-N 2.88Å
61	S	78.9	Confident	76.3	Confident	122 Å²	122	166.6 Å²	166.6	85%	0.853	85%	0.848	S	S	*	*	P	Polyproline II helix	trans	-96.9	135.1	168.2	174.5	0	0	0	0	108	R59	R59-S61 PolarHBondContact O-N 3.17Å
62	G	69.8	Low	77.2	Confident	134 Å²	134	171.1 Å²	171.1	100%	1.381	86%	0.86	S	S	*	*			trans	118.3	0	-172.6	0	0	0	0	0	111.3

Retrieved 62 of 62 residues in 47.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).