A0A089VQK7_RAT Loading...

IL18Ralpha2

AlphaFold DB , UniProt , Accession A0A089VQK7, Species RAT (Rattus norvegicus, Rat), Gene Il18r1, Length 71 aa.

						>A0A089VQK7_RAT|A0A089VQK7|Il18r1
EATDTKSFILVRKETPDIQGHVFMRGITMVVLTSVAAVCVVILCIIYKVDLVLFYRRVAERDETLTGNLPL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	E	41.7	Very low	47.9	Very low	246 Å²	246	132.4 Å²	132.4	100%	1.15	72%	0.722	S	S	*	*				0	88.9	0	-153.9	160.9	99.6	0	0	107.5	T3	E1-T3 PolarHBondContact O-N 2.61Å
2	A	48.4	Very low	47.6	Very low	100 Å²	100	140.2 Å²	140.2	83%	0.826	73%	0.732	S	S	*	*			trans	-79.4	110.4	-175.1	0	0	0	0	0	107.9	D4	A2-D4 VanDerWaalsContact C-N 3.3Å; A2-D4 PolarHBondContact O-N 2.87Å
3	T	44.1	Very low	47.5	Very low	126 Å²	126	140.8 Å²	140.8	77%	0.773	73%	0.726	S	S	*	*			trans	-62.2	94.3	170.9	48.8	0	0	0	0	108.3	E1 T5	E1-T3 PolarHBondContact O-N 2.61Å; T3-T5 PolarHBondContact O-N 3.34Å
4	D	55.9	Low	47.6	Very low	114 Å²	114	143.3 Å²	143.3	61%	0.61	73%	0.733	S	S	*	*			trans	-67.2	67.1	163.9	-179.1	-108.5	0	0	0	107.5	A2 K6	A2-D4 VanDerWaalsContact C-N 3.3Å; A2-D4 PolarHBondContact O-N 2.87Å; D4-K6 PolarHBondContact O-N 2.7Å; D4-K6 WeakPolarHBondContact OD1-CG 3.4Å; D4-K6 IonicContact OD1-NZ 2.61Å; D4-K6 PolarHBondContact OD1-NZ 2.79Å; D4-K6 IonicContact OD2-NZ 2.87Å; D4-K6 PolarHBondContact OD2-NZ 2.86Å
5	T	48.8	Very low	47.9	Very low	109 Å²	109	139.8 Å²	139.8	67%	0.669	72%	0.721	S	S	*	*			trans	-70.9	80	160.4	-50	0	0	0	0	104.5	T3 S7	T3-T5 PolarHBondContact O-N 3.34Å; T5-S7 PolarHBondContact O-N 2.84Å
6	K	51.1	Low	47.9	Very low	136 Å²	136	135.1 Å²	135.1	59%	0.591	70%	0.702	S	S	*	*			trans	-58.8	80.4	154.1	-80.6	178.8	179.3	68.8	0	105.6	D4 F8	D4-K6 PolarHBondContact O-N 2.7Å; D4-K6 WeakPolarHBondContact OD1-CG 3.4Å; D4-K6 IonicContact OD1-NZ 2.61Å; D4-K6 PolarHBondContact OD1-NZ 2.79Å; D4-K6 IonicContact OD2-NZ 2.87Å; D4-K6 PolarHBondContact OD2-NZ 2.86Å; K6-F8 HydrophobicContact CB-CD2 4.39Å; K6-F8 PolarHBondContact O-N 2.7Å
7	S	49.1	Very low	48.3	Very low	80 Å²	80	136.7 Å²	136.7	56%	0.559	71%	0.712	S	S	*	*			trans	-56	89	149.7	50	0	0	0	0	104.1	T5 I9	T5-S7 PolarHBondContact O-N 2.84Å; S7-I9 PolarHBondContact O-N 2.74Å
8	F	49.1	Very low	48.7	Very low	181 Å²	181	135.6 Å²	135.6	79%	0.794	71%	0.706	S	S	*	*			trans	-53	82.9	132.9	-78.1	-95.6	0	0	0	103.7	K6 L10	K6-F8 HydrophobicContact CB-CD2 4.39Å; K6-F8 PolarHBondContact O-N 2.7Å; F8-L10 PolarHBondContact O-N 2.66Å
9	I	45.4	Very low	48.9	Very low	123 Å²	123	135.2 Å²	135.2	63%	0.631	70%	0.7	S	S	*	*			trans	-46.7	91.6	138.9	-55.9	175.4	0	0	0	100.1	S7 V11	S7-I9 PolarHBondContact O-N 2.74Å; I9-V11 HydrophobicContact CB-CG2 3.95Å; I9-V11 HydrophobicContact CG2-CB 4.23Å; I9-V11 HydrophobicContact CG2-CG2 3.35Å; I9-V11 WeakPolarHBondContact O-CG2 3.49Å; I9-V11 PolarHBondContact O-N 2.7Å
10	L	48.8	Very low	49.4	Very low	153 Å²	153	130.9 Å²	130.9	80%	0.801	69%	0.69	S	S	*	*			trans	-57.9	83.1	149.8	-158.5	155.3	0	0	0	99.5	F8 R12	F8-L10 PolarHBondContact O-N 2.66Å; L10-R12 PolarHBondContact O-N 2.63Å
11	V	44.4	Very low	49.9	Very low	88 Å²	88	131 Å²	131	53%	0.533	69%	0.687	S	S	.	*			trans	-57.4	88	167.2	166.5	0	0	0	0	98.3	I9 K13	I9-V11 HydrophobicContact CB-CG2 3.95Å; I9-V11 HydrophobicContact CG2-CB 4.23Å; I9-V11 HydrophobicContact CG2-CG2 3.35Å; I9-V11 WeakPolarHBondContact O-CG2 3.49Å; I9-V11 PolarHBondContact O-N 2.7Å; V11-K13 HydrophobicContact CG1-CB 3.48Å; V11-K13 VanDerWaalsContact CG1-CB 3.48Å; V11-K13 HydrophobicContact CG1-CD 4.15Å; V11-K13 HydrophobicContact CG1-CG 3.51Å; V11-K13 PolarHBondContact O-N 2.66Å
12	R	44.3	Very low	51	Low	226 Å²	226	123.6 Å²	123.6	85%	0.853	66%	0.658	S	S	*	*				-46.1	55.9	124.9	-163.1	-178.7	-171.2	-170.3	1.9	107.4	L10 E14	L10-R12 PolarHBondContact O-N 2.63Å; R12-E14 PolarHBondContact O-N 2.98Å
13	K	46.6	Very low	51.8	Low	148 Å²	148	126 Å²	126	64%	0.643	65%	0.65	S	S	*	*				-45.1	105.2	128.3	-112.9	176.1	158.7	179.2	0	99.3	V11 T15	V11-K13 HydrophobicContact CG1-CB 3.48Å; V11-K13 VanDerWaalsContact CG1-CB 3.48Å; V11-K13 HydrophobicContact CG1-CD 4.15Å; V11-K13 HydrophobicContact CG1-CG 3.51Å; V11-K13 PolarHBondContact O-N 2.66Å; K13-T15 HydrophobicContact CB-CG2 4.4Å; K13-T15 PolarHBondContact O-N 2.76Å
14	E	48.4	Very low	53.1	Low	176 Å²	176	126.5 Å²	126.5	82%	0.822	65%	0.645	S	S	*	*				0.4	60.7	95.7	-71.1	176.7	102.3	0	0	112.3	R12 P16	R12-E14 PolarHBondContact O-N 2.98Å; E14-P16 VanDerWaalsContact C-N 3.32Å
15	T	52.1	Low	54.2	Low	91 Å²	91	129 Å²	129	56%	0.558	65%	0.646	S	S	*	*			trans	-67	112.5	142.4	44	0	0	0	0	100.1	K13 D17	K13-T15 HydrophobicContact CB-CG2 4.4Å; K13-T15 PolarHBondContact O-N 2.76Å; T15-D17 PolarHBondContact O-N 3.24Å
16	P	48.3	Very low	55.8	Low	65 Å²	65	125.5 Å²	125.5	42%	0.422	63%	0.632	S	S	.	*			trans	-57.1	146.2	-155.7	26.4	-35.1	0	0	0	107.5	E14 I18 Q19	E14-P16 VanDerWaalsContact C-N 3.32Å; P16-I18 HydrophobicContact CB-CB 3.91Å; P16-I18 HydrophobicContact CB-CD1 3.96Å; P16-I18 HydrophobicContact CB-CG1 4.21Å; P16-I18 HydrophobicContact CG-CB 3.94Å; P16-I18 HydrophobicContact CG-CD1 4.48Å; P16-I18 CarbonylContact O-C 3.56Å; P16-I18 PolarHBondContact O-N 3.31Å; P16-Q19 PolarHBondContact O-N 3.42Å
17	D	53.8	Low	57.6	Low	162 Å²	162	123 Å²	123	87%	0.866	62%	0.624	S	S	*	*	T	Hydrogen-bonded Turn	trans	-42.2	-18.5	167.8	-158.4	64.1	0	0	0	113.1	T15	T15-D17 PolarHBondContact O-N 3.24Å
18	I	55.5	Low	59.5	Low	117 Å²	117	122.6 Å²	122.6	60%	0.6	62%	0.618	S	S	*	*	H	α-helix	trans	-62.4	-35.1	170.6	-64.8	158.3	0	0	0	115.1	P16 H21 V22	P16-I18 HydrophobicContact CB-CB 3.91Å; P16-I18 HydrophobicContact CB-CD1 3.96Å; P16-I18 HydrophobicContact CB-CG1 4.21Å; P16-I18 HydrophobicContact CG-CB 3.94Å; P16-I18 HydrophobicContact CG-CD1 4.48Å; P16-I18 CarbonylContact O-C 3.56Å; P16-I18 PolarHBondContact O-N 3.31Å; I18-H21 PolarHBondContact O-N 2.81Å; I18-V22 HydrophobicContact CG2-CG2 4.28Å; I18-V22 WeakPolarHBondContact O-CG2 3.14Å; I18-V22 PolarHBondContact O-N 2.71Å
19	Q	52.9	Low	61.5	Low	127 Å²	127	119.2 Å²	119.2	59%	0.593	61%	0.606	S	S	*	*	H	α-helix	trans	-71.3	-33.6	-175.8	-168.6	172.7	-22.6	0	0	112.3	P16 F23	P16-Q19 PolarHBondContact O-N 3.42Å; Q19-F23 VanDerWaalsContact O-CB 3.25Å; Q19-F23 WeakPolarHBondContact O-CB 3.25Å; Q19-F23 PolarHBondContact O-N 3.13Å; Q19-F23 VanDerWaalsContact O-N 3.13Å
20	G	58.5	Low	63.8	Low	49 Å²	49	118.2 Å²	118.2	51%	0.505	61%	0.605	S	S	.	*	H	α-helix	trans	-63.6	-41.1	172.3	0	0	0	0	0	112.1	F23 M24	G20-F23 PolarHBondContact O-N 2.97Å; G20-M24 VanDerWaalsContact O-CB 3.23Å; G20-M24 WeakPolarHBondContact O-CB 3.36Å; G20-M24 PolarHBondContact O-N 3.03Å
21	H	61.8	Low	66	Low	135 Å²	135	114.8 Å²	114.8	63%	0.625	59%	0.591	S	S	*	*	H	α-helix	trans	-66.6	-42.2	-178.5	-171.5	-102.5	0	0	0	112.9	I18 R25	I18-H21 PolarHBondContact O-N 2.81Å; H21-R25 WeakPolarHBondContact O-CB 3.22Å; H21-R25 PolarHBondContact O-N 3.01Å
22	V	63.7	Low	68.4	Low	90 Å²	90	115.7 Å²	115.7	55%	0.545	59%	0.592	S	S	.	*	H	α-helix	trans	-72.8	-34.8	177.4	-145.2	0	0	0	0	111.8	I18 G26	I18-V22 HydrophobicContact CG2-CG2 4.28Å; I18-V22 WeakPolarHBondContact O-CG2 3.14Å; I18-V22 PolarHBondContact O-N 2.71Å; V22-G26 PolarHBondContact O-N 2.93Å
23	F	64.6	Low	70.8	Confident	150 Å²	150	109.3 Å²	109.3	66%	0.658	58%	0.578	S	S	*	*	H	α-helix	trans	-66.2	-44.9	175.7	-173.5	-105.4	0	0	0	111.7	Q19 G20 G26 I27	Q19-F23 VanDerWaalsContact O-CB 3.25Å; Q19-F23 WeakPolarHBondContact O-CB 3.25Å; Q19-F23 PolarHBondContact O-N 3.13Å; Q19-F23 VanDerWaalsContact O-N 3.13Å; G20-F23 PolarHBondContact O-N 2.97Å; F23-G26 PolarHBondContact O-N 3.5Å; F23-I27 HydrophobicContact CD1-CD1 3.65Å; F23-I27 HydrophobicContact CE1-CD1 3.32Å; F23-I27 HydrophobicContact CE1-CG1 4.45Å; F23-I27 HydrophobicContact CE2-CD1 4.5Å; F23-I27 HydrophobicContact CG-CD1 4.38Å; F23-I27 HydrophobicContact CZ-CD1 3.8Å; F23-I27 WeakPolarHBondContact O-CG1 3.47Å; F23-I27 PolarHBondContact O-N 2.87Å
24	M	72.4	Confident	73.2	Confident	137 Å²	137	105.6 Å²	105.6	68%	0.675	57%	0.571	S	S	*	*	H	α-helix	trans	-65.7	-42.4	177	-160.8	169.6	-173.1	0	0	111.2	G20 G26 I27 T28	G20-M24 VanDerWaalsContact O-CB 3.23Å; G20-M24 WeakPolarHBondContact O-CB 3.36Å; G20-M24 PolarHBondContact O-N 3.03Å; M24-G26 VanDerWaalsContact C-N 3.32Å; M24-G26 PolarHBondContact O-N 3Å; M24-I27 PolarHBondContact O-N 3.42Å; M24-T28 WeakPolarHBondContact O-CB 3.23Å; M24-T28 PolarHBondContact O-N 2.86Å; M24-T28 PolarHBondContact O-OG1 3.42Å
25	R	77.7	Confident	75.5	Confident	167 Å²	167	101 Å²	101	63%	0.63	56%	0.555	S	S	*	*	H	α-helix	trans	-61.5	-38.4	174.3	-174	177.7	173.1	-173.2	-2.1	112.5	H21 M29	H21-R25 WeakPolarHBondContact O-CB 3.22Å; H21-R25 PolarHBondContact O-N 3.01Å; R25-M29 WeakPolarHBondContact O-CB 3.28Å; R25-M29 WeakPolarHBondContact O-CG 3.38Å; R25-M29 PolarHBondContact O-N 3.27Å
26	G	83.8	Confident	77.6	Confident	35 Å²	35	99.1 Å²	99.1	36%	0.361	55%	0.549	S	S	.	.	H	α-helix	trans	-64.2	-47.3	175	0	0	0	0	0	112.3	V22 F23 M24 T28 M29 V30	V22-G26 PolarHBondContact O-N 2.93Å; F23-G26 PolarHBondContact O-N 3.5Å; M24-G26 VanDerWaalsContact C-N 3.32Å; M24-G26 PolarHBondContact O-N 3Å; G26-T28 PolarHBondContact O-N 3.29Å; G26-M29 PolarHBondContact O-N 3.28Å; G26-V30 WeakPolarHBondContact O-CG2 3.21Å; G26-V30 PolarHBondContact O-N 3.41Å
27	I	88.8	Confident	79.9	Confident	83 Å²	83	98.6 Å²	98.6	43%	0.426	55%	0.549	S	S	.	.	H	α-helix	trans	-61.1	-46.9	176.7	-67.2	167.1	0	0	0	110.6	F23 M24 M29 V30 V31	F23-I27 HydrophobicContact CD1-CD1 3.65Å; F23-I27 HydrophobicContact CE1-CD1 3.32Å; F23-I27 HydrophobicContact CE1-CG1 4.45Å; F23-I27 HydrophobicContact CE2-CD1 4.5Å; F23-I27 HydrophobicContact CG-CD1 4.38Å; F23-I27 HydrophobicContact CZ-CD1 3.8Å; F23-I27 WeakPolarHBondContact O-CG1 3.47Å; F23-I27 PolarHBondContact O-N 2.87Å; M24-I27 PolarHBondContact O-N 3.42Å; I27-M29 VanDerWaalsContact C-N 3.32Å; I27-M29 PolarHBondContact O-N 2.89Å; I27-V30 PolarHBondContact O-N 2.67Å; I27-V31 HydrophobicContact CG2-CG2 4.25Å; I27-V31 VanDerWaalsContact O-CG2 3.31Å; I27-V31 WeakPolarHBondContact O-CG2 3.38Å; I27-V31 PolarHBondContact O-N 2.86Å
28	T	88.9	Confident	82	Confident	71 Å²	71	94.8 Å²	94.8	44%	0.436	53%	0.532	S	S	.	.	H	α-helix	trans	-58.5	-43.5	177.3	-59.6	0	0	0	0	111.5	M24 G26 V30 V31 L32	M24-T28 WeakPolarHBondContact O-CB 3.23Å; M24-T28 PolarHBondContact O-N 2.86Å; M24-T28 PolarHBondContact O-OG1 3.42Å; G26-T28 PolarHBondContact O-N 3.29Å; T28-V30 PolarHBondContact O-N 3.38Å; T28-V31 PolarHBondContact O-N 3.42Å; T28-L32 HydrophobicContact CG2-CD1 3.8Å; T28-L32 HydrophobicContact CG2-CG 4.2Å; T28-L32 WeakPolarHBondContact O-CB 3.38Å; T28-L32 WeakPolarHBondContact O-CG 3.5Å; T28-L32 PolarHBondContact O-N 2.87Å
29	M	91.6	Very high	83.9	Confident	111 Å²	111	92.3 Å²	92.3	55%	0.547	52%	0.524	S	S	.	.	H	α-helix	trans	-60.6	-44	176	-81.5	-81.4	-120.7	0	0	112.5	R25 G26 I27 L32 T33	R25-M29 WeakPolarHBondContact O-CB 3.28Å; R25-M29 WeakPolarHBondContact O-CG 3.38Å; R25-M29 PolarHBondContact O-N 3.27Å; G26-M29 PolarHBondContact O-N 3.28Å; I27-M29 VanDerWaalsContact C-N 3.32Å; I27-M29 PolarHBondContact O-N 2.89Å; M29-L32 PolarHBondContact O-N 3.25Å; M29-T33 VanDerWaalsContact O-CB 3.28Å; M29-T33 WeakPolarHBondContact O-CB 3.31Å; M29-T33 PolarHBondContact O-N 2.93Å; M29-T33 PolarHBondContact O-OG1 2.9Å
30	V	93.2	Very high	86	Confident	101 Å²	101	90.2 Å²	90.2	61%	0.612	52%	0.52	S	S	*	.	H	α-helix	trans	-65.3	-44.2	179.3	172.3	0	0	0	0	111	G26 I27 T28 T33 S34	G26-V30 WeakPolarHBondContact O-CG2 3.21Å; G26-V30 PolarHBondContact O-N 3.41Å; I27-V30 PolarHBondContact O-N 2.67Å; T28-V30 PolarHBondContact O-N 3.38Å; V30-T33 PolarHBondContact O-N 3.48Å; V30-S34 WeakPolarHBondContact O-CB 3.37Å; V30-S34 PolarHBondContact O-N 3.32Å
31	V	93.9	Very high	87.8	Confident	82 Å²	82	92.2 Å²	92.2	50%	0.497	52%	0.522	S	S	.	.	H	α-helix	trans	-63.1	-48	177.1	175.1	0	0	0	0	110.6	I27 T28 T33 S34 V35	I27-V31 HydrophobicContact CG2-CG2 4.25Å; I27-V31 VanDerWaalsContact O-CG2 3.31Å; I27-V31 WeakPolarHBondContact O-CG2 3.38Å; I27-V31 PolarHBondContact O-N 2.86Å; T28-V31 PolarHBondContact O-N 3.42Å; V31-T33 VanDerWaalsContact C-N 3.33Å; V31-T33 PolarHBondContact O-N 3.19Å; V31-S34 PolarHBondContact O-N 2.82Å; V31-V35 HydrophobicContact CG1-CG2 4.44Å; V31-V35 VanDerWaalsContact O-CG2 3.3Å; V31-V35 WeakPolarHBondContact O-CG2 3.33Å; V31-V35 PolarHBondContact O-N 3.48Å
32	L	94.8	Very high	89.4	Confident	106 Å²	106	90 Å²	90	56%	0.555	51%	0.514	S	S	*	.	H	α-helix	trans	-60.7	-41.9	177.2	-73	174.2	0	0	0	111.9	T28 M29 V35 A36	T28-L32 HydrophobicContact CG2-CD1 3.8Å; T28-L32 HydrophobicContact CG2-CG 4.2Å; T28-L32 WeakPolarHBondContact O-CB 3.38Å; T28-L32 WeakPolarHBondContact O-CG 3.5Å; T28-L32 PolarHBondContact O-N 2.87Å; M29-L32 PolarHBondContact O-N 3.25Å; L32-V35 PolarHBondContact O-N 3.41Å; L32-A36 VanDerWaalsContact O-CB 3.26Å; L32-A36 WeakPolarHBondContact O-CB 3.23Å; L32-A36 PolarHBondContact O-N 3.22Å
33	T	95.4	Very high	90.9	Very high	92 Å²	92	91.2 Å²	91.2	56%	0.564	52%	0.517	S	S	*	.	H	α-helix	trans	-65.4	-40.8	178	-55.5	0	0	0	0	111.1	M29 V30 V31 A36 A37	M29-T33 VanDerWaalsContact O-CB 3.28Å; M29-T33 WeakPolarHBondContact O-CB 3.31Å; M29-T33 PolarHBondContact O-N 2.93Å; M29-T33 PolarHBondContact O-OG1 2.9Å; V30-T33 PolarHBondContact O-N 3.48Å; V31-T33 VanDerWaalsContact C-N 3.33Å; V31-T33 PolarHBondContact O-N 3.19Å; T33-A36 PolarHBondContact O-N 3.38Å; T33-A37 WeakPolarHBondContact O-CB 3.5Å; T33-A37 PolarHBondContact O-N 3.02Å
34	S	96.4	Very high	92.2	Very high	70 Å²	70	87.3 Å²	87.3	49%	0.49	51%	0.508	S	S	.	.	H	α-helix	trans	-63.6	-46.8	175.6	-175.2	0	0	0	0	111.6	V30 V31 A36 A37 V38	V30-S34 WeakPolarHBondContact O-CB 3.37Å; V30-S34 PolarHBondContact O-N 3.32Å; V31-S34 PolarHBondContact O-N 2.82Å; S34-A36 VanDerWaalsContact C-N 3.35Å; S34-A36 PolarHBondContact O-N 3.29Å; S34-A37 WeakPolarHBondContact O-CB 3.26Å; S34-A37 PolarHBondContact O-N 2.87Å; S34-V38 WeakPolarHBondContact O-CG2 3.48Å; S34-V38 PolarHBondContact O-N 3.46Å
35	V	96.8	Very high	93.2	Very high	81 Å²	81	86 Å²	86	49%	0.491	50%	0.502	S	S	.	.	H	α-helix	trans	-60.4	-45.8	175.5	172.6	0	0	0	0	110.7	V31 L32 A37 V38 C39	V31-V35 HydrophobicContact CG1-CG2 4.44Å; V31-V35 VanDerWaalsContact O-CG2 3.3Å; V31-V35 WeakPolarHBondContact O-CG2 3.33Å; V31-V35 PolarHBondContact O-N 3.48Å; L32-V35 PolarHBondContact O-N 3.41Å; V35-A37 VanDerWaalsContact C-N 3.33Å; V35-A37 PolarHBondContact O-N 3.27Å; V35-V38 PolarHBondContact O-N 3.48Å; V35-C39 WeakPolarHBondContact O-CB 3.5Å; V35-C39 PolarHBondContact O-N 3.27Å; V35-C39 PolarHBondContact O-SG 3.44Å
36	A	96.8	Very high	93.9	Very high	51 Å²	51	82.8 Å²	82.8	42%	0.421	50%	0.496	S	S	.	.	H	α-helix	trans	-59.6	-44	176.3	0	0	0	0	0	111.4	L32 T33 S34 V38 C39 V40	L32-A36 VanDerWaalsContact O-CB 3.26Å; L32-A36 WeakPolarHBondContact O-CB 3.23Å; L32-A36 PolarHBondContact O-N 3.22Å; T33-A36 PolarHBondContact O-N 3.38Å; S34-A36 VanDerWaalsContact C-N 3.35Å; S34-A36 PolarHBondContact O-N 3.29Å; A36-V38 PolarHBondContact O-N 3.49Å; A36-C39 WeakPolarHBondContact O-CB 3.48Å; A36-C39 PolarHBondContact O-N 3.43Å; A36-V40 WeakPolarHBondContact O-CB 3.3Å; A36-V40 VanDerWaalsContact O-CG2 3.23Å; A36-V40 WeakPolarHBondContact O-CG2 3.29Å; A36-V40 PolarHBondContact O-N 3.27Å
37	A	97	Very high	94.2	Very high	53 Å²	53	88.1 Å²	88.1	44%	0.438	51%	0.506	S	S	.	.	H	α-helix	trans	-60.8	-45.4	176.6	0	0	0	0	0	111.9	T33 S34 V35 C39 V40 V41	T33-A37 WeakPolarHBondContact O-CB 3.5Å; T33-A37 PolarHBondContact O-N 3.02Å; S34-A37 WeakPolarHBondContact O-CB 3.26Å; S34-A37 PolarHBondContact O-N 2.87Å; V35-A37 VanDerWaalsContact C-N 3.33Å; V35-A37 PolarHBondContact O-N 3.27Å; A37-C39 PolarHBondContact O-N 2.83Å; A37-V40 PolarHBondContact O-N 2.89Å; A37-V41 VanDerWaalsContact O-CG2 3.29Å; A37-V41 WeakPolarHBondContact O-CG2 3.4Å; A37-V41 PolarHBondContact O-N 3.5Å
38	V	97	Very high	94.3	Very high	82 Å²	82	91 Å²	91	50%	0.497	52%	0.516	S	S	.	.	H	α-helix	trans	-62.2	-44.2	176	175.1	0	0	0	0	111	S34 V35 A36 V40 V41 I42	S34-V38 WeakPolarHBondContact O-CG2 3.48Å; S34-V38 PolarHBondContact O-N 3.46Å; V35-V38 PolarHBondContact O-N 3.48Å; A36-V38 PolarHBondContact O-N 3.49Å; V38-V40 PolarHBondContact O-N 2.95Å; V38-V41 PolarHBondContact O-N 3.45Å; V38-I42 HydrophobicContact CG1-CD1 3.84Å; V38-I42 HydrophobicContact CG1-CG1 4.46Å; V38-I42 VanDerWaalsContact O-CG1 3.28Å; V38-I42 WeakPolarHBondContact O-CG1 3.2Å; V38-I42 PolarHBondContact O-N 3.23Å
39	C	96.5	Very high	94.4	Very high	65 Å²	65	91.6 Å²	91.6	44%	0.439	52%	0.519	S	S	.	.	H	α-helix	trans	-58.9	-46	174.3	-75.9	0	0	0	0	111.9	V35 A36 A37 V41 I42 L43	V35-C39 WeakPolarHBondContact O-CB 3.5Å; V35-C39 PolarHBondContact O-N 3.27Å; V35-C39 PolarHBondContact O-SG 3.44Å; A36-C39 WeakPolarHBondContact O-CB 3.48Å; A36-C39 PolarHBondContact O-N 3.43Å; A37-C39 PolarHBondContact O-N 2.83Å; C39-V41 VanDerWaalsContact C-N 3.34Å; C39-V41 PolarHBondContact O-N 3.41Å; C39-I42 PolarHBondContact O-N 2.89Å; C39-L43 WeakPolarHBondContact O-CB 3.27Å; C39-L43 VanDerWaalsContact O-CG 3.26Å; C39-L43 WeakPolarHBondContact O-CG 3.34Å; C39-L43 PolarHBondContact O-N 3.44Å
40	V	96.6	Very high	94.2	Very high	83 Å²	83	90.7 Å²	90.7	50%	0.503	52%	0.517	S	S	.	.	H	α-helix	trans	-60.9	-43.6	177.1	170.6	0	0	0	0	110.6	A36 A37 V38 L43 C44	A36-V40 WeakPolarHBondContact O-CB 3.3Å; A36-V40 VanDerWaalsContact O-CG2 3.23Å; A36-V40 WeakPolarHBondContact O-CG2 3.29Å; A36-V40 PolarHBondContact O-N 3.27Å; A37-V40 PolarHBondContact O-N 2.89Å; V38-V40 PolarHBondContact O-N 2.95Å; V40-L43 PolarHBondContact O-N 3.2Å; V40-C44 WeakPolarHBondContact O-CB 3.47Å; V40-C44 PolarHBondContact O-N 3.35Å; V40-C44 PolarHBondContact O-SG 3.31Å; V40-C44 VanDerWaalsContact O-SG 3.32Å
41	V	96.4	Very high	93.9	Very high	91 Å²	91	89.4 Å²	89.4	55%	0.552	51%	0.506	S	S	*	.	H	α-helix	trans	-61.1	-47.8	177	171.3	0	0	0	0	110.8	A37 V38 C39 L43 C44 I45	A37-V41 VanDerWaalsContact O-CG2 3.29Å; A37-V41 WeakPolarHBondContact O-CG2 3.4Å; A37-V41 PolarHBondContact O-N 3.5Å; V38-V41 PolarHBondContact O-N 3.45Å; C39-V41 VanDerWaalsContact C-N 3.34Å; C39-V41 PolarHBondContact O-N 3.41Å; V41-L43 VanDerWaalsContact C-N 3.35Å; V41-L43 PolarHBondContact O-N 2.76Å; V41-C44 WeakPolarHBondContact O-CB 3.26Å; V41-C44 PolarHBondContact O-N 2.87Å; V41-I45 WeakPolarHBondContact O-CG1 3.28Å; V41-I45 PolarHBondContact O-N 3.47Å
42	I	95.4	Very high	93.5	Very high	90 Å²	90	90 Å²	90	46%	0.462	51%	0.51	S	S	.	.	H	α-helix	trans	-59.4	-47.6	177.6	-66.7	165.2	0	0	0	110.4	V38 C39 C44 I45 I46	V38-I42 HydrophobicContact CG1-CD1 3.84Å; V38-I42 HydrophobicContact CG1-CG1 4.46Å; V38-I42 VanDerWaalsContact O-CG1 3.28Å; V38-I42 WeakPolarHBondContact O-CG1 3.2Å; V38-I42 PolarHBondContact O-N 3.23Å; C39-I42 PolarHBondContact O-N 2.89Å; I42-C44 VanDerWaalsContact C-N 3.33Å; I42-C44 PolarHBondContact O-N 3.45Å; I42-I45 PolarHBondContact O-N 3.2Å; I42-I46 HydrophobicContact CG2-CD1 3.78Å; I42-I46 HydrophobicContact CG2-CG1 4.44Å; I42-I46 WeakPolarHBondContact O-CG1 3.05Å; I42-I46 PolarHBondContact O-N 2.85Å
43	L	94.9	Very high	93	Very high	114 Å²	114	89.7 Å²	89.7	60%	0.597	51%	0.508	S	S	*	.	H	α-helix	trans	-62.6	-38.8	177.1	-71	175.6	0	0	0	111.8	C39 V40 V41 I45 I46 Y47	C39-L43 WeakPolarHBondContact O-CB 3.27Å; C39-L43 VanDerWaalsContact O-CG 3.26Å; C39-L43 WeakPolarHBondContact O-CG 3.34Å; C39-L43 PolarHBondContact O-N 3.44Å; V40-L43 PolarHBondContact O-N 3.2Å; V41-L43 VanDerWaalsContact C-N 3.35Å; V41-L43 PolarHBondContact O-N 2.76Å; L43-I45 VanDerWaalsContact C-N 3.33Å; L43-I45 PolarHBondContact O-N 2.74Å; L43-I46 PolarHBondContact O-N 3.44Å; L43-Y47 WeakPolarHBondContact O-CA 3.46Å; L43-Y47 WeakPolarHBondContact O-CB 3.38Å; L43-Y47 PolarHBondContact O-N 3.47Å
44	C	92.6	Very high	92.4	Very high	69 Å²	69	91.1 Å²	91.1	47%	0.466	51%	0.507	S	S	.	.	H	α-helix	trans	-62.5	-40	174.9	-80.4	0	0	0	0	111.9	V40 V41 I42 K48	V40-C44 WeakPolarHBondContact O-CB 3.47Å; V40-C44 PolarHBondContact O-N 3.35Å; V40-C44 PolarHBondContact O-SG 3.31Å; V40-C44 VanDerWaalsContact O-SG 3.32Å; V41-C44 WeakPolarHBondContact O-CB 3.26Å; V41-C44 PolarHBondContact O-N 2.87Å; I42-C44 VanDerWaalsContact C-N 3.33Å; I42-C44 PolarHBondContact O-N 3.45Å; C44-K48 VanDerWaalsContact O-CB 3.27Å; C44-K48 WeakPolarHBondContact O-CB 3.39Å; C44-K48 WeakPolarHBondContact O-CG 3.37Å; C44-K48 PolarHBondContact O-N 3.45Å
45	I	92.5	Very high	91.7	Very high	109 Å²	109	96 Å²	96	56%	0.559	52%	0.515	S	S	*	.	H	α-helix	trans	-67	-50	176.4	-64	-61.1	0	0	0	110.6	V41 I42 L43 Y47 K48 V49	V41-I45 WeakPolarHBondContact O-CG1 3.28Å; V41-I45 PolarHBondContact O-N 3.47Å; I42-I45 PolarHBondContact O-N 3.2Å; L43-I45 VanDerWaalsContact C-N 3.33Å; L43-I45 PolarHBondContact O-N 2.74Å; I45-Y47 VanDerWaalsContact C-N 3.32Å; I45-Y47 PolarHBondContact O-N 2.93Å; I45-K48 PolarHBondContact O-N 3.23Å; I45-V49 WeakPolarHBondContact O-CG2 3.45Å; I45-V49 PolarHBondContact O-N 2.74Å
46	I	92.4	Very high	91	Very high	99 Å²	99	100.5 Å²	100.5	51%	0.508	52%	0.524	S	S	.	.	H	α-helix	trans	-60.2	-46	178.2	-64.7	169.9	0	0	0	109.8	I42 L43 K48 V49 D50	I42-I46 HydrophobicContact CG2-CD1 3.78Å; I42-I46 HydrophobicContact CG2-CG1 4.44Å; I42-I46 WeakPolarHBondContact O-CG1 3.05Å; I42-I46 PolarHBondContact O-N 2.85Å; L43-I46 PolarHBondContact O-N 3.44Å; I46-K48 PolarHBondContact O-N 2.96Å; I46-V49 PolarHBondContact O-N 2.97Å; I46-D50 VanDerWaalsContact O-CB 3.28Å; I46-D50 WeakPolarHBondContact O-CB 2.99Å; I46-D50 PolarHBondContact O-N 2.71Å
47	Y	90.7	Very high	90.2	Very high	147 Å²	147	106.8 Å²	106.8	58%	0.576	54%	0.537	S	S	*	.	H	α-helix	trans	-64.1	-38.3	178.3	-175.3	-97.5	0	0	0	112	L43 I45 V49 D50 L51	L43-Y47 WeakPolarHBondContact O-CA 3.46Å; L43-Y47 WeakPolarHBondContact O-CB 3.38Å; L43-Y47 PolarHBondContact O-N 3.47Å; I45-Y47 VanDerWaalsContact C-N 3.32Å; I45-Y47 PolarHBondContact O-N 2.93Å; Y47-V49 VanDerWaalsContact C-N 3.34Å; Y47-V49 PolarHBondContact O-N 2.94Å; Y47-D50 PolarHBondContact O-N 3.45Å; Y47-L51 HydrophobicContact CD1-CB 4.44Å; Y47-L51 HydrophobicContact CE1-CB 4.25Å; Y47-L51 HydrophobicContact CE1-CD1 4.26Å; Y47-L51 HydrophobicContact CE1-CD2 4.17Å; Y47-L51 HydrophobicContact CE1-CG 4.48Å; Y47-L51 WeakPolarHBondContact O-CA 3.42Å; Y47-L51 WeakPolarHBondContact O-CB 3.28Å; Y47-L51 PolarHBondContact O-N 2.76Å
48	K	91.1	Very high	89.2	Confident	144 Å²	144	107.5 Å²	107.5	63%	0.626	54%	0.535	S	S	*	.	H	α-helix	trans	-60.8	-45.4	173.7	-83.9	-81.6	-173.3	166.4	0	111.2	C44 I45 I46 V52	C44-K48 VanDerWaalsContact O-CB 3.27Å; C44-K48 WeakPolarHBondContact O-CB 3.39Å; C44-K48 WeakPolarHBondContact O-CG 3.37Å; C44-K48 PolarHBondContact O-N 3.45Å; I45-K48 PolarHBondContact O-N 3.23Å; I46-K48 PolarHBondContact O-N 2.96Å; K48-V52 WeakPolarHBondContact O-CB 3.19Å; K48-V52 WeakPolarHBondContact O-CG2 3.42Å; K48-V52 PolarHBondContact O-N 3.43Å
49	V	89.4	Confident	88.1	Confident	83 Å²	83	105.5 Å²	105.5	50%	0.503	53%	0.527	S	S	.	.	H	α-helix	trans	-66.5	-45.4	178.3	175.4	0	0	0	0	110.7	I45 I46 Y47 V52 L53	I45-V49 WeakPolarHBondContact O-CG2 3.45Å; I45-V49 PolarHBondContact O-N 2.74Å; I46-V49 PolarHBondContact O-N 2.97Å; Y47-V49 VanDerWaalsContact C-N 3.34Å; Y47-V49 PolarHBondContact O-N 2.94Å; V49-V52 PolarHBondContact O-N 3.21Å; V49-L53 HydrophobicContact CG1-CD1 4.03Å; V49-L53 HydrophobicContact CG1-CG 4.46Å; V49-L53 WeakPolarHBondContact O-CB 3.4Å; V49-L53 WeakPolarHBondContact O-CG 3.03Å; V49-L53 PolarHBondContact O-N 2.93Å
50	D	88.1	Confident	86.6	Confident	92 Å²	92	107.6 Å²	107.6	49%	0.492	53%	0.531	S	S	.	.	H	α-helix	trans	-66.7	-40.9	179.7	-160	-99.6	0	0	0	111.3	I46 Y47 V52 L53 F54	I46-D50 VanDerWaalsContact O-CB 3.28Å; I46-D50 WeakPolarHBondContact O-CB 2.99Å; I46-D50 PolarHBondContact O-N 2.71Å; Y47-D50 PolarHBondContact O-N 3.45Å; D50-V52 VanDerWaalsContact C-N 3.33Å; D50-V52 PolarHBondContact O-N 3.03Å; D50-L53 CarbonylContact O-C 3.6Å; D50-L53 PolarHBondContact O-N 3.2Å; D50-F54 WeakPolarHBondContact O-CA 3.32Å; D50-F54 WeakPolarHBondContact O-CB 3.38Å; D50-F54 PolarHBondContact O-N 3.08Å
51	L	86.3	Confident	85	Confident	74 Å²	74	112.7 Å²	112.7	39%	0.387	54%	0.541	S	S	.	.	H	α-helix	trans	-61.3	-41.6	172.3	-175.1	75.8	0	0	0	110.8	Y47 Y55	Y47-L51 HydrophobicContact CD1-CB 4.44Å; Y47-L51 HydrophobicContact CE1-CB 4.25Å; Y47-L51 HydrophobicContact CE1-CD1 4.26Å; Y47-L51 HydrophobicContact CE1-CD2 4.17Å; Y47-L51 HydrophobicContact CE1-CG 4.48Å; Y47-L51 WeakPolarHBondContact O-CA 3.42Å; Y47-L51 WeakPolarHBondContact O-CB 3.28Å; Y47-L51 PolarHBondContact O-N 2.76Å; L51-Y55 WeakPolarHBondContact O-CA 3.28Å; L51-Y55 WeakPolarHBondContact O-CB 3.11Å; L51-Y55 PolarHBondContact O-N 3.5Å
52	V	86.4	Confident	83.2	Confident	95 Å²	95	113 Å²	113	58%	0.576	54%	0.54	S	S	*	.	H	α-helix	trans	-65.9	-43.2	175.6	166.7	0	0	0	0	111	K48 V49 D50 R56	K48-V52 WeakPolarHBondContact O-CB 3.19Å; K48-V52 WeakPolarHBondContact O-CG2 3.42Å; K48-V52 PolarHBondContact O-N 3.43Å; V49-V52 PolarHBondContact O-N 3.21Å; D50-V52 VanDerWaalsContact C-N 3.33Å; D50-V52 PolarHBondContact O-N 3.03Å; V52-R56 VanDerWaalsContact O-CB 3.26Å; V52-R56 WeakPolarHBondContact O-CB 3.15Å; V52-R56 PolarHBondContact O-N 2.77Å
53	L	84.9	Confident	81.3	Confident	99 Å²	99	115 Å²	115	52%	0.518	55%	0.547	S	S	.	.	H	α-helix	trans	-66.1	-41.3	176.9	-73.5	171.9	0	0	0	111.9	V49 D50 R56 R57	V49-L53 HydrophobicContact CG1-CD1 4.03Å; V49-L53 HydrophobicContact CG1-CG 4.46Å; V49-L53 WeakPolarHBondContact O-CB 3.4Å; V49-L53 WeakPolarHBondContact O-CG 3.03Å; V49-L53 PolarHBondContact O-N 2.93Å; D50-L53 CarbonylContact O-C 3.6Å; D50-L53 PolarHBondContact O-N 3.2Å; L53-R56 PolarHBondContact O-N 3.11Å; L53-R57 WeakPolarHBondContact O-CB 3.32Å; L53-R57 PolarHBondContact O-N 3.43Å
54	F	83.3	Confident	79.5	Confident	123 Å²	123	114.1 Å²	114.1	54%	0.539	55%	0.546	S	S	.	.	H	α-helix	trans	-68.1	-47.3	177.5	-174.3	-96.7	0	0	0	110.4	D50 R56 R57 V58	D50-F54 WeakPolarHBondContact O-CA 3.32Å; D50-F54 WeakPolarHBondContact O-CB 3.38Å; D50-F54 PolarHBondContact O-N 3.08Å; F54-R56 VanDerWaalsContact C-N 3.27Å; F54-R56 PolarHBondContact O-N 3.38Å; F54-R57 PolarHBondContact O-N 3.4Å; F54-R57 VanDerWaalsContact O-N 3.15Å; F54-V58 HydrophobicContact CD1-CG2 3.86Å; F54-V58 HydrophobicContact CE1-CG2 3.5Å; F54-V58 VanDerWaalsContact CE1-CG2 3.5Å; F54-V58 HydrophobicContact CE2-CG2 4.22Å; F54-V58 HydrophobicContact CG-CG2 4.38Å; F54-V58 HydrophobicContact CZ-CG2 3.69Å; F54-V58 WeakPolarHBondContact O-CB 3.26Å; F54-V58 VanDerWaalsContact O-CG2 3.28Å; F54-V58 WeakPolarHBondContact O-CG2 3.35Å; F54-V58 PolarHBondContact O-N 2.99Å
55	Y	80.6	Confident	77.7	Confident	171 Å²	171	117.6 Å²	117.6	67%	0.671	56%	0.559	S	S	*	*	H	α-helix	trans	-56.7	-44.4	173.5	-176.5	-92.9	0	0	0	110.6	L51 V58 A59	L51-Y55 WeakPolarHBondContact O-CA 3.28Å; L51-Y55 WeakPolarHBondContact O-CB 3.11Å; L51-Y55 PolarHBondContact O-N 3.5Å; Y55-V58 PolarHBondContact O-N 3.44Å; Y55-A59 HydrophobicContact CE1-CB 4.47Å; Y55-A59 WeakPolarHBondContact O-CB 3.48Å; Y55-A59 PolarHBondContact O-N 2.85Å
56	R	81.6	Confident	75.9	Confident	176 Å²	176	117.4 Å²	117.4	66%	0.664	56%	0.564	S	S	*	*	H	α-helix	trans	-62	-46.9	175.3	-171.8	177.9	-174.7	-170.3	1.7	111.8	V52 L53 F54 V58 A59 E60	V52-R56 VanDerWaalsContact O-CB 3.26Å; V52-R56 WeakPolarHBondContact O-CB 3.15Å; V52-R56 PolarHBondContact O-N 2.77Å; L53-R56 PolarHBondContact O-N 3.11Å; F54-R56 VanDerWaalsContact C-N 3.27Å; F54-R56 PolarHBondContact O-N 3.38Å; R56-V58 VanDerWaalsContact C-N 3.32Å; R56-V58 PolarHBondContact O-N 3.39Å; R56-A59 PolarHBondContact O-N 2.85Å; R56-E60 WeakPolarHBondContact O-CB 3.21Å; R56-E60 PolarHBondContact O-N 2.85Å
57	R	79.9	Confident	74.1	Confident	184 Å²	184	115.8 Å²	115.8	69%	0.694	57%	0.571	S	S	*	*	H	α-helix	trans	-64.6	-35.3	178.6	-174.7	-177.7	-70.9	176.8	-1.1	112.6	L53 F54 R61	L53-R57 WeakPolarHBondContact O-CB 3.32Å; L53-R57 PolarHBondContact O-N 3.43Å; F54-R57 PolarHBondContact O-N 3.4Å; F54-R57 VanDerWaalsContact O-N 3.15Å; R57-R61 WeakPolarHBondContact O-CG 3.47Å; R57-R61 PolarHBondContact O-N 3.24Å
58	V	77.6	Confident	72.4	Confident	67 Å²	67	115.5 Å²	115.5	41%	0.406	58%	0.58	S	S	.	*	H	α-helix	trans	-74.5	-44.3	176.6	171.5	0	0	0	0	110.7	F54 Y55 R56 E60 R61 D62	F54-V58 HydrophobicContact CD1-CG2 3.86Å; F54-V58 HydrophobicContact CE1-CG2 3.5Å; F54-V58 VanDerWaalsContact CE1-CG2 3.5Å; F54-V58 HydrophobicContact CE2-CG2 4.22Å; F54-V58 HydrophobicContact CG-CG2 4.38Å; F54-V58 HydrophobicContact CZ-CG2 3.69Å; F54-V58 WeakPolarHBondContact O-CB 3.26Å; F54-V58 VanDerWaalsContact O-CG2 3.28Å; F54-V58 WeakPolarHBondContact O-CG2 3.35Å; F54-V58 PolarHBondContact O-N 2.99Å; Y55-V58 PolarHBondContact O-N 3.44Å; R56-V58 VanDerWaalsContact C-N 3.32Å; R56-V58 PolarHBondContact O-N 3.39Å; V58-E60 VanDerWaalsContact C-N 3.3Å; V58-E60 PolarHBondContact O-N 2.78Å; V58-R61 WeakPolarHBondContact O-CB 3.48Å; V58-R61 PolarHBondContact O-N 3.15Å; V58-R61 VanDerWaalsContact O-N 3.11Å; V58-D62 PolarHBondContact O-N 3.37Å
59	A	73.9	Confident	70.6	Confident	40 Å²	40	115.5 Å²	115.5	33%	0.331	59%	0.586	S	S	.	*	H	α-helix	trans	-60	-41.5	174.3	0	0	0	0	0	111.3	Y55 R56 R61 D62 E63	Y55-A59 HydrophobicContact CE1-CB 4.47Å; Y55-A59 WeakPolarHBondContact O-CB 3.48Å; Y55-A59 PolarHBondContact O-N 2.85Å; R56-A59 PolarHBondContact O-N 2.85Å; A59-R61 VanDerWaalsContact C-N 3.27Å; A59-R61 PolarHBondContact O-N 3.43Å; A59-D62 PolarHBondContact O-N 2.86Å; A59-D62 VanDerWaalsContact O-N 3.08Å; A59-E63 PolarHBondContact O-N 2.7Å
60	E	64.9	Low	68.8	Low	110 Å²	110	117.1 Å²	117.1	51%	0.514	60%	0.598	S	S	.	*	H	α-helix	trans	-65.8	-28.3	175.7	-164.4	175.8	167.2	0	0	112.9	R56 V58 E63	R56-E60 WeakPolarHBondContact O-CB 3.21Å; R56-E60 PolarHBondContact O-N 2.85Å; V58-E60 VanDerWaalsContact C-N 3.3Å; V58-E60 PolarHBondContact O-N 2.78Å; E60-E63 VanDerWaalsContact CA-OE1 3.28Å; E60-E63 WeakPolarHBondContact CA-OE1 3.28Å; E60-E63 WeakPolarHBondContact O-CG 3.49Å
61	R	61.4	Low	67.2	Low	190 Å²	190	124 Å²	124	72%	0.717	63%	0.634	S	S	*	*	H	α-helix	trans	-72.8	-37.9	170	-88.5	-95.7	179.7	149.2	-3.9	112	R57 V58 A59 E63 T64 L65	R57-R61 WeakPolarHBondContact O-CG 3.47Å; R57-R61 PolarHBondContact O-N 3.24Å; V58-R61 WeakPolarHBondContact O-CB 3.48Å; V58-R61 PolarHBondContact O-N 3.15Å; V58-R61 VanDerWaalsContact O-N 3.11Å; A59-R61 VanDerWaalsContact C-N 3.27Å; A59-R61 PolarHBondContact O-N 3.43Å; R61-E63 VanDerWaalsContact C-N 3.34Å; R61-E63 PolarHBondContact O-N 3.4Å; R61-T64 PolarHBondContact O-N 2.95Å; R61-T64 PolarHBondContact O-OG1 2.94Å; R61-L65 PolarHBondContact O-N 3.25Å
62	D	58.6	Low	66.2	Low	98 Å²	98	126.6 Å²	126.6	52%	0.524	65%	0.646	S	S	.	*	H	α-helix	trans	-69.8	-32	-175.5	-134.3	19.3	0	0	0	112.3	V58 A59 L65 T66	V58-D62 PolarHBondContact O-N 3.37Å; A59-D62 PolarHBondContact O-N 2.86Å; A59-D62 VanDerWaalsContact O-N 3.08Å; D62-L65 PolarHBondContact O-N 3.2Å; D62-T66 WeakPolarHBondContact O-CB 3.13Å; D62-T66 PolarHBondContact O-N 3.21Å; D62-T66 PolarHBondContact O-OG1 2.71Å
63	E	56.7	Low	65.1	Low	131 Å²	131	128.2 Å²	128.2	61%	0.612	65%	0.65	S	S	*	*	H	α-helix	trans	-68.4	-31.1	172.3	52	-173.7	120	0	0	113	A59 E60 R61 G67	A59-E63 PolarHBondContact O-N 2.7Å; E60-E63 VanDerWaalsContact CA-OE1 3.28Å; E60-E63 WeakPolarHBondContact CA-OE1 3.28Å; E60-E63 WeakPolarHBondContact O-CG 3.49Å; R61-E63 VanDerWaalsContact C-N 3.34Å; R61-E63 PolarHBondContact O-N 3.4Å; E63-G67 PolarHBondContact O-N 3.17Å
64	T	57	Low	64	Low	96 Å²	96	129.8 Å²	129.8	59%	0.589	66%	0.657	S	S	*	*	H	α-helix	trans	-75.1	-23.6	171.6	65.5	0	0	0	0	113.7	R61	R61-T64 PolarHBondContact O-N 2.95Å; R61-T64 PolarHBondContact O-OG1 2.94Å
65	L	53.4	Low	62.9	Low	141 Å²	141	130.2 Å²	130.2	74%	0.738	66%	0.664	S	S	*	*	H	α-helix	trans	-82.9	-35.3	176.4	-144	81.6	0	0	0	111.6	R61 D62	R61-L65 PolarHBondContact O-N 3.25Å; D62-L65 PolarHBondContact O-N 3.2Å
66	T	55	Low	61.8	Low	106 Å²	106	127.7 Å²	127.7	65%	0.65	66%	0.664	S	S	*	*	H	α-helix	trans	-83.6	-29.4	179.2	-48.8	0	0	0	0	112.4	D62 N68	D62-T66 WeakPolarHBondContact O-CB 3.13Å; D62-T66 PolarHBondContact O-N 3.21Å; D62-T66 PolarHBondContact O-OG1 2.71Å; T66-N68 VanDerWaalsContact C-N 3.31Å; T66-N68 PolarHBondContact O-N 3.48Å
67	G	55.8	Low	60.5	Low	65 Å²	65	124.5 Å²	124.5	67%	0.67	66%	0.664	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.4	-3	179.5	0	0	0	0	0	115.9	E63	E63-G67 PolarHBondContact O-N 3.17Å
68	N	54.1	Low	59.1	Low	141 Å²	141	120.2 Å²	120.2	75%	0.754	66%	0.661	S	S	*	*	T	Hydrogen-bonded Turn	trans	-107.3	16	-179.5	-137.3	42	0	0	0	113.3	T66 P70	T66-N68 VanDerWaalsContact C-N 3.31Å; T66-N68 PolarHBondContact O-N 3.48Å; N68-P70 VanDerWaalsContact O-CD 3.25Å; N68-P70 WeakPolarHBondContact O-CD 3.25Å
69	L	54.6	Low	57.7	Low	143 Å²	143	124.3 Å²	124.3	75%	0.749	68%	0.681	S	S	*	*			trans	-84.6	106.1	168.6	-164	73.3	0	0	0	108.2	L71	L69-L71 PolarHBondContact O-N 3.17Å
70	P	50.3	Low	56.3	Low	117 Å²	117	131.3 Å²	131.3	76%	0.76	71%	0.71	S	S	*	*			trans	-71.9	112.4	176.6	31.2	-30.5	0	0	0	107.7	N68	N68-P70 VanDerWaalsContact O-CD 3.25Å; N68-P70 WeakPolarHBondContact O-CD 3.25Å
71	L	54	Low	55.5	Low	238 Å²	238	133.3 Å²	133.3	100%	1.246	73%	0.728	S	S	*	*			trans	-92.3	0	153.2	-88.4	172.7	0	0	0	108.7	L69	L69-L71 PolarHBondContact O-N 3.17Å

Retrieved 71 of 71 residues in 19.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).