A0A089X9D3_RAT Loading...

IL18Ralpha2

AlphaFold DB , UniProt , Accession A0A089X9D3, Species RAT (Rattus norvegicus, Rat), Gene Il18r1, Length 73 aa.

						>A0A089X9D3_RAT|A0A089X9D3|Il18r1
NEEATDTKSFILVRKETPDIQGHVFMRGITMVVLTSVAAVCVVILCIIYKVDLVLFYRRVAERDETLTGNLPL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	N	41.8	Very low	48.1	Very low	202 Å²	202	137.9 Å²	137.9	100%	1.08	74%	0.736	S	S	*	*				0	101.4	0	-71	11.8	0	0	0	107.7	E3	N1-E3 PolarHBondContact O-N 2.84Å
2	E	45.1	Very low	48.4	Very low	177 Å²	177	140.3 Å²	140.3	83%	0.827	75%	0.747	S	S	*	*			trans	-55.5	114.5	-172.8	-65.5	99.7	141.9	0	0	111.7	A4	E2-A4 PolarHBondContact O-N 3.26Å
3	E	49.2	Very low	48.1	Very low	184 Å²	184	137.4 Å²	137.4	86%	0.86	74%	0.738	S	S	*	*			trans	-65.6	84.9	155.9	-76.9	-169.5	135.9	0	0	107.5	N1 T5	N1-E3 PolarHBondContact O-N 2.84Å; E3-T5 PolarHBondContact O-N 2.73Å
4	A	54.2	Low	48.1	Very low	92 Å²	92	143.5 Å²	143.5	76%	0.76	75%	0.745	S	S	*	*			trans	-62.4	84	166.7	0	0	0	0	0	107.8	E2 D6	E2-A4 PolarHBondContact O-N 3.26Å; A4-D6 PolarHBondContact O-N 2.94Å
5	T	44.3	Very low	47.9	Very low	114 Å²	114	144.7 Å²	144.7	70%	0.699	74%	0.743	S	S	*	*			trans	-48.3	109.8	162.5	42.9	0	0	0	0	107.5	E3 T7	E3-T5 PolarHBondContact O-N 2.73Å; T5-T7 PolarHBondContact O-N 2.92Å
6	D	52.8	Low	48	Very low	123 Å²	123	147.3 Å²	147.3	66%	0.658	75%	0.751	S	S	*	*			trans	-67.6	54.6	167.2	-169	-114.5	0	0	0	108.7	A4 K8	A4-D6 PolarHBondContact O-N 2.94Å; D6-K8 PolarHBondContact O-N 2.99Å; D6-K8 IonicContact OD1-NZ 2.92Å; D6-K8 PolarHBondContact OD1-NZ 2.72Å; D6-K8 IonicContact OD2-NZ 2.73Å; D6-K8 PolarHBondContact OD2-NZ 2.79Å
7	T	46.3	Very low	48.2	Very low	102 Å²	102	143.9 Å²	143.9	63%	0.626	74%	0.739	S	S	*	*			trans	-76.6	79.3	160.9	-49.8	0	0	0	0	104.1	T5 S9	T5-T7 PolarHBondContact O-N 2.92Å; T7-S9 PolarHBondContact O-N 2.81Å
8	K	49.8	Very low	48.2	Very low	138 Å²	138	139.9 Å²	139.9	60%	0.6	72%	0.723	S	S	*	*			trans	-61.6	77.3	155.8	-74.6	-171.4	-174.2	66.8	0	106.5	D6 F10	D6-K8 PolarHBondContact O-N 2.99Å; D6-K8 IonicContact OD1-NZ 2.92Å; D6-K8 PolarHBondContact OD1-NZ 2.72Å; D6-K8 IonicContact OD2-NZ 2.73Å; D6-K8 PolarHBondContact OD2-NZ 2.79Å; K8-F10 HydrophobicContact CB-CD2 4.17Å; K8-F10 HydrophobicContact CB-CE2 4.06Å; K8-F10 HydrophobicContact CD-CE2 4.21Å; K8-F10 PolarHBondContact O-N 2.68Å
9	S	46.7	Very low	48.5	Very low	80 Å²	80	141.2 Å²	141.2	56%	0.559	73%	0.732	S	S	*	*			trans	-63.1	88.8	160.2	52.4	0	0	0	0	104.4	T7 I11	T7-S9 PolarHBondContact O-N 2.81Å; S9-I11 PolarHBondContact O-N 2.76Å
10	F	51.6	Low	48.8	Very low	180 Å²	180	139.9 Å²	139.9	79%	0.789	72%	0.724	S	S	*	*			trans	-64	77.6	147.9	-74.8	-90.1	0	0	0	104.7	K8 L12	K8-F10 HydrophobicContact CB-CD2 4.17Å; K8-F10 HydrophobicContact CB-CE2 4.06Å; K8-F10 HydrophobicContact CD-CE2 4.21Å; K8-F10 PolarHBondContact O-N 2.68Å; F10-L12 PolarHBondContact O-N 2.67Å
11	I	47.6	Very low	49	Very low	125 Å²	125	139.7 Å²	139.7	64%	0.641	72%	0.72	S	S	*	*			trans	-52.6	108.6	155.2	-58.8	178.6	0	0	0	101.4	S9 V13	S9-I11 PolarHBondContact O-N 2.76Å; I11-V13 HydrophobicContact CB-CG2 4Å; I11-V13 HydrophobicContact CG2-CB 4.44Å; I11-V13 HydrophobicContact CG2-CG2 3.47Å; I11-V13 VanDerWaalsContact CG2-CG2 3.47Å; I11-V13 PolarHBondContact O-N 2.87Å
12	L	51.2	Low	49.8	Very low	166 Å²	166	132.4 Å²	132.4	87%	0.869	69%	0.693	S	S	*	*			trans	-66.9	69.1	162.9	-141.4	146.8	0	0	0	103.7	F10 R14	F10-L12 PolarHBondContact O-N 2.67Å; L12-R14 PolarHBondContact O-N 3.28Å
13	V	45.1	Very low	50.6	Low	103 Å²	103	129.9 Å²	129.9	62%	0.624	68%	0.681	S	S	*	*			trans	-55.1	106.8	160.7	175.8	0	0	0	0	99.3	I11 K15	I11-V13 HydrophobicContact CB-CG2 4Å; I11-V13 HydrophobicContact CG2-CB 4.44Å; I11-V13 HydrophobicContact CG2-CG2 3.47Å; I11-V13 VanDerWaalsContact CG2-CG2 3.47Å; I11-V13 PolarHBondContact O-N 2.87Å; V13-K15 PolarHBondContact O-N 2.56Å
14	R	47.4	Very low	51.3	Low	223 Å²	223	125.4 Å²	125.4	84%	0.842	67%	0.666	S	S	*	*			trans	-54.4	79.2	155.7	-177.2	180	-177.1	-172.9	-1.3	103.7	L12 E16	L12-R14 PolarHBondContact O-N 3.28Å; R14-E16 PolarHBondContact O-N 3.02Å
15	K	44.8	Very low	51.9	Low	162 Å²	162	128.2 Å²	128.2	70%	0.704	66%	0.661	S	S	*	*			trans	-47.2	119.8	162.6	176.2	177.3	177.6	177.4	0	100.7	V13 T17	V13-K15 PolarHBondContact O-N 2.56Å; K15-T17 PolarHBondContact O-N 2.61Å; K15-T17 PolarHBondContact O-OG1 2.82Å
16	E	49.5	Very low	53.2	Low	186 Å²	186	128.9 Å²	128.9	87%	0.869	66%	0.658	S	S	*	*			trans	-46.7	83.3	165.8	-71.6	171.8	110.9	0	0	107	R14	R14-E16 PolarHBondContact O-N 3.02Å
17	T	51.6	Low	54.4	Low	90 Å²	90	131 Å²	131	55%	0.552	66%	0.656	S	S	*	*			trans	-82.1	115.4	163.5	37.9	0	0	0	0	99.8	K15 D19	K15-T17 PolarHBondContact O-N 2.61Å; K15-T17 PolarHBondContact O-OG1 2.82Å; T17-D19 PolarHBondContact O-N 2.93Å
18	P	48.3	Very low	56.2	Low	71 Å²	71	127.8 Å²	127.8	46%	0.461	64%	0.644	S	S	.	*			trans	-57.6	146.4	-146.6	27.3	-35.7	0	0	0	108.4	I20 Q21	P18-I20 HydrophobicContact CB-CB 3.93Å; P18-I20 HydrophobicContact CB-CD1 3.94Å; P18-I20 HydrophobicContact CB-CG1 4.11Å; P18-I20 HydrophobicContact CG-CB 3.95Å; P18-I20 HydrophobicContact CG-CD1 4.4Å; P18-I20 PolarHBondContact O-N 3.21Å; P18-Q21 PolarHBondContact O-N 2.9Å
19	D	53.6	Low	58.1	Low	164 Å²	164	125.2 Å²	125.2	88%	0.877	64%	0.636	S	S	*	*	T	Hydrogen-bonded Turn	trans	-42.2	-16.8	167.2	-152.3	53.5	0	0	0	113.4	T17	T17-D19 PolarHBondContact O-N 2.93Å
20	I	55.4	Low	60.1	Low	115 Å²	115	124.8 Å²	124.8	59%	0.59	63%	0.63	S	S	*	*	H	α-helix	trans	-64.1	-35.7	172.5	-62.9	163.8	0	0	0	114.7	P18 H23 V24	P18-I20 HydrophobicContact CB-CB 3.93Å; P18-I20 HydrophobicContact CB-CD1 3.94Å; P18-I20 HydrophobicContact CB-CG1 4.11Å; P18-I20 HydrophobicContact CG-CB 3.95Å; P18-I20 HydrophobicContact CG-CD1 4.4Å; P18-I20 PolarHBondContact O-N 3.21Å; I20-H23 PolarHBondContact O-N 3.31Å; I20-V24 HydrophobicContact CG2-CG2 4.21Å; I20-V24 WeakPolarHBondContact O-CG2 3.03Å; I20-V24 PolarHBondContact O-N 3.48Å
21	Q	53	Low	62	Low	137 Å²	137	121.5 Å²	121.5	64%	0.64	62%	0.618	S	S	*	*	H	α-helix	trans	-70.6	-35.3	-176.3	-170.1	172.4	-16.6	0	0	112.3	P18 F25	P18-Q21 PolarHBondContact O-N 2.9Å; Q21-F25 VanDerWaalsContact O-CB 3.27Å; Q21-F25 WeakPolarHBondContact O-CB 3.27Å; Q21-F25 PolarHBondContact O-N 3.19Å
22	G	57.9	Low	64.1	Low	48 Å²	48	120.5 Å²	120.5	50%	0.495	62%	0.618	S	S	.	*	H	α-helix	trans	-64.6	-40.2	172.7	0	0	0	0	0	112.1	F25 M26	G22-F25 PolarHBondContact O-N 3.02Å; G22-M26 VanDerWaalsContact O-CB 3.23Å; G22-M26 WeakPolarHBondContact O-CB 3.25Å; G22-M26 PolarHBondContact O-N 2.98Å
23	H	62.4	Low	66.2	Low	125 Å²	125	116.5 Å²	116.5	58%	0.579	60%	0.6	S	S	*	*	H	α-helix	trans	-66.7	-42.8	-178	-171.5	-100	0	0	0	113	I20 R27	I20-H23 PolarHBondContact O-N 3.31Å; H23-R27 VanDerWaalsContact O-CB 3.25Å; H23-R27 WeakPolarHBondContact O-CB 3.25Å; H23-R27 PolarHBondContact O-N 2.7Å
24	V	64.1	Low	68.5	Low	90 Å²	90	116.4 Å²	116.4	55%	0.545	60%	0.596	S	S	.	*	H	α-helix	trans	-73.1	-35.1	177.7	-135.9	0	0	0	0	112	I20 G28	I20-V24 HydrophobicContact CG2-CG2 4.21Å; I20-V24 WeakPolarHBondContact O-CG2 3.03Å; I20-V24 PolarHBondContact O-N 3.48Å; V24-G28 PolarHBondContact O-N 3.46Å
25	F	65.6	Low	70.8	Confident	150 Å²	150	110.3 Å²	110.3	66%	0.658	58%	0.583	S	S	*	*	H	α-helix	trans	-66.1	-44.4	175.5	-176.5	-106.6	0	0	0	111.7	Q21 G22 G28 I29	Q21-F25 VanDerWaalsContact O-CB 3.27Å; Q21-F25 WeakPolarHBondContact O-CB 3.27Å; Q21-F25 PolarHBondContact O-N 3.19Å; G22-F25 PolarHBondContact O-N 3.02Å; F25-G28 PolarHBondContact O-N 3.21Å; F25-I29 HydrophobicContact CD1-CD1 3.7Å; F25-I29 HydrophobicContact CE1-CD1 3.31Å; F25-I29 HydrophobicContact CE1-CG1 4.46Å; F25-I29 HydrophobicContact CE2-CD1 4.33Å; F25-I29 HydrophobicContact CG-CD1 4.38Å; F25-I29 HydrophobicContact CZ-CD1 3.67Å; F25-I29 WeakPolarHBondContact O-CG1 3.23Å; F25-I29 PolarHBondContact O-N 3.49Å
26	M	73.6	Confident	73.2	Confident	128 Å²	128	106 Å²	106	63%	0.631	57%	0.574	S	S	*	*	H	α-helix	trans	-65.4	-42.3	176.6	-161.9	164.2	86.1	0	0	111.2	G22 G28 I29 T30	G22-M26 VanDerWaalsContact O-CB 3.23Å; G22-M26 WeakPolarHBondContact O-CB 3.25Å; G22-M26 PolarHBondContact O-N 2.98Å; M26-G28 VanDerWaalsContact C-N 3.31Å; M26-G28 PolarHBondContact O-N 3.03Å; M26-I29 PolarHBondContact O-N 3.37Å; M26-T30 PolarHBondContact O-N 3.46Å; M26-T30 PolarHBondContact O-OG1 2.68Å
27	R	77.4	Confident	75.5	Confident	167 Å²	167	101 Å²	101	63%	0.63	56%	0.555	S	S	*	*	H	α-helix	trans	-61.5	-38.7	174.7	-169.7	177.4	177.6	-176	0.5	112.2	H23 M31	H23-R27 VanDerWaalsContact O-CB 3.25Å; H23-R27 WeakPolarHBondContact O-CB 3.25Å; H23-R27 PolarHBondContact O-N 2.7Å; R27-M31 VanDerWaalsContact O-CG 3.23Å; R27-M31 WeakPolarHBondContact O-CG 3.33Å; R27-M31 PolarHBondContact O-N 2.88Å
28	G	84.4	Confident	77.6	Confident	35 Å²	35	99.2 Å²	99.2	36%	0.361	55%	0.55	S	S	.	.	H	α-helix	trans	-63	-48.7	174.9	0	0	0	0	0	112.5	V24 F25 M26 T30 M31 V32	V24-G28 PolarHBondContact O-N 3.46Å; F25-G28 PolarHBondContact O-N 3.21Å; M26-G28 VanDerWaalsContact C-N 3.31Å; M26-G28 PolarHBondContact O-N 3.03Å; G28-T30 PolarHBondContact O-N 2.93Å; G28-M31 PolarHBondContact O-N 2.95Å; G28-V32 WeakPolarHBondContact O-CG2 3.23Å; G28-V32 PolarHBondContact O-N 3.4Å
29	I	88.8	Confident	79.9	Confident	84 Å²	84	98.4 Å²	98.4	43%	0.431	55%	0.549	S	S	.	.	H	α-helix	trans	-60.1	-46.9	177.3	-67.3	167.3	0	0	0	110.6	F25 M26 M31 V32 V33	F25-I29 HydrophobicContact CD1-CD1 3.7Å; F25-I29 HydrophobicContact CE1-CD1 3.31Å; F25-I29 HydrophobicContact CE1-CG1 4.46Å; F25-I29 HydrophobicContact CE2-CD1 4.33Å; F25-I29 HydrophobicContact CG-CD1 4.38Å; F25-I29 HydrophobicContact CZ-CD1 3.67Å; F25-I29 WeakPolarHBondContact O-CG1 3.23Å; F25-I29 PolarHBondContact O-N 3.49Å; M26-I29 PolarHBondContact O-N 3.37Å; I29-M31 VanDerWaalsContact C-N 3.31Å; I29-M31 PolarHBondContact O-N 3.31Å; I29-V32 PolarHBondContact O-N 3.27Å; I29-V33 HydrophobicContact CG2-CG2 4.29Å; I29-V33 WeakPolarHBondContact O-CG2 3.41Å; I29-V33 PolarHBondContact O-N 3.23Å
30	T	88.8	Confident	82	Confident	72 Å²	72	94.4 Å²	94.4	44%	0.442	53%	0.53	S	S	.	.	H	α-helix	trans	-58.3	-43.1	177.4	-58.6	0	0	0	0	111.5	M26 G28 V32 V33 L34	M26-T30 PolarHBondContact O-N 3.46Å; M26-T30 PolarHBondContact O-OG1 2.68Å; G28-T30 PolarHBondContact O-N 2.93Å; T30-V32 PolarHBondContact O-N 3.02Å; T30-V33 PolarHBondContact O-N 2.87Å; T30-L34 HydrophobicContact CG2-CD1 3.8Å; T30-L34 HydrophobicContact CG2-CG 4.21Å; T30-L34 WeakPolarHBondContact O-CB 3.24Å; T30-L34 WeakPolarHBondContact O-CG 3.32Å; T30-L34 PolarHBondContact O-N 2.88Å
31	M	91	Very high	83.9	Confident	111 Å²	111	92 Å²	92	55%	0.547	52%	0.523	S	S	.	.	H	α-helix	trans	-63.7	-40.9	177.8	-73.9	-73.2	-103.7	0	0	112.6	R27 G28 I29 T35	R27-M31 VanDerWaalsContact O-CG 3.23Å; R27-M31 WeakPolarHBondContact O-CG 3.33Å; R27-M31 PolarHBondContact O-N 2.88Å; G28-M31 PolarHBondContact O-N 2.95Å; I29-M31 VanDerWaalsContact C-N 3.31Å; I29-M31 PolarHBondContact O-N 3.31Å; M31-T35 VanDerWaalsContact O-CB 3.25Å; M31-T35 WeakPolarHBondContact O-CB 3.29Å; M31-T35 PolarHBondContact O-N 3.01Å; M31-T35 PolarHBondContact O-OG1 2.88Å
32	V	93.2	Very high	86	Confident	103 Å²	103	89.4 Å²	89.4	62%	0.624	52%	0.516	S	S	*	.	H	α-helix	trans	-65.7	-44.9	177.6	173.9	0	0	0	0	110.9	G28 I29 T30 T35 S36	G28-V32 WeakPolarHBondContact O-CG2 3.23Å; G28-V32 PolarHBondContact O-N 3.4Å; I29-V32 PolarHBondContact O-N 3.27Å; T30-V32 PolarHBondContact O-N 3.02Å; V32-T35 PolarHBondContact O-N 3.22Å; V32-S36 WeakPolarHBondContact O-CB 3.41Å; V32-S36 PolarHBondContact O-N 3.25Å
33	V	93.6	Very high	87.8	Confident	82 Å²	82	91.4 Å²	91.4	50%	0.497	52%	0.519	S	S	.	.	H	α-helix	trans	-62.7	-47.7	177.4	175.2	0	0	0	0	110.5	I29 T30 T35 S36 V37	I29-V33 HydrophobicContact CG2-CG2 4.29Å; I29-V33 WeakPolarHBondContact O-CG2 3.41Å; I29-V33 PolarHBondContact O-N 3.23Å; T30-V33 PolarHBondContact O-N 2.87Å; V33-T35 VanDerWaalsContact C-N 3.31Å; V33-T35 PolarHBondContact O-N 3.43Å; V33-S36 PolarHBondContact O-N 2.89Å; V33-V37 HydrophobicContact CG1-CG2 4.4Å; V33-V37 VanDerWaalsContact O-CG2 3.29Å; V33-V37 WeakPolarHBondContact O-CG2 3.39Å; V33-V37 PolarHBondContact O-N 3.35Å
34	L	94.6	Very high	89.3	Confident	102 Å²	102	89.8 Å²	89.8	53%	0.534	51%	0.514	S	S	.	.	H	α-helix	trans	-60.8	-41	177.4	-73.7	174.1	0	0	0	112	T30 V37 A38	T30-L34 HydrophobicContact CG2-CD1 3.8Å; T30-L34 HydrophobicContact CG2-CG 4.21Å; T30-L34 WeakPolarHBondContact O-CB 3.24Å; T30-L34 WeakPolarHBondContact O-CG 3.32Å; T30-L34 PolarHBondContact O-N 2.88Å; L34-V37 PolarHBondContact O-N 2.81Å; L34-A38 VanDerWaalsContact O-CB 3.24Å; L34-A38 WeakPolarHBondContact O-CB 3.21Å; L34-A38 PolarHBondContact O-N 3.44Å
35	T	95	Very high	90.7	Very high	95 Å²	95	90.8 Å²	90.8	58%	0.583	52%	0.515	S	S	*	.	H	α-helix	trans	-67	-40.3	178.4	-57.7	0	0	0	0	111.1	M31 V32 V33 A38 A39	M31-T35 VanDerWaalsContact O-CB 3.25Å; M31-T35 WeakPolarHBondContact O-CB 3.29Å; M31-T35 PolarHBondContact O-N 3.01Å; M31-T35 PolarHBondContact O-OG1 2.88Å; V32-T35 PolarHBondContact O-N 3.22Å; V33-T35 VanDerWaalsContact C-N 3.31Å; V33-T35 PolarHBondContact O-N 3.43Å; T35-A38 PolarHBondContact O-N 3.42Å; T35-A39 WeakPolarHBondContact O-CB 3.39Å; T35-A39 PolarHBondContact O-N 3.31Å
36	S	96.4	Very high	91.9	Very high	72 Å²	72	87 Å²	87	50%	0.503	51%	0.506	S	S	.	.	H	α-helix	trans	-62.9	-47.3	174.3	-175.9	0	0	0	0	111.6	V32 V33 A38 A39 V40	V32-S36 WeakPolarHBondContact O-CB 3.41Å; V32-S36 PolarHBondContact O-N 3.25Å; V33-S36 PolarHBondContact O-N 2.89Å; S36-A38 PolarHBondContact O-N 2.95Å; S36-A39 PolarHBondContact O-N 3.45Å; S36-V40 WeakPolarHBondContact O-CG2 3.38Å; S36-V40 PolarHBondContact O-N 3.4Å
37	V	96.6	Very high	92.7	Very high	80 Å²	80	86 Å²	86	49%	0.485	50%	0.503	S	S	.	.	H	α-helix	trans	-60.8	-45.1	175.9	172.7	0	0	0	0	110.8	V33 L34 A39 V40 C41	V33-V37 HydrophobicContact CG1-CG2 4.4Å; V33-V37 VanDerWaalsContact O-CG2 3.29Å; V33-V37 WeakPolarHBondContact O-CG2 3.39Å; V33-V37 PolarHBondContact O-N 3.35Å; L34-V37 PolarHBondContact O-N 2.81Å; V37-A39 VanDerWaalsContact C-N 3.33Å; V37-A39 PolarHBondContact O-N 3.2Å; V37-V40 PolarHBondContact O-N 2.87Å; V37-C41 WeakPolarHBondContact O-CB 3.44Å; V37-C41 PolarHBondContact O-N 3.46Å; V37-C41 PolarHBondContact O-SG 3.41Å; V37-C41 VanDerWaalsContact O-SG 3.38Å
38	A	96.3	Very high	93.4	Very high	52 Å²	52	82.6 Å²	82.6	43%	0.43	50%	0.496	S	S	.	.	H	α-helix	trans	-60.2	-43.3	176.4	0	0	0	0	0	111.5	L34 T35 S36 C41 V42	L34-A38 VanDerWaalsContact O-CB 3.24Å; L34-A38 WeakPolarHBondContact O-CB 3.21Å; L34-A38 PolarHBondContact O-N 3.44Å; T35-A38 PolarHBondContact O-N 3.42Å; S36-A38 PolarHBondContact O-N 2.95Å; A38-C41 PolarHBondContact O-N 2.89Å; A38-V42 WeakPolarHBondContact O-CB 3.25Å; A38-V42 VanDerWaalsContact O-CG2 3.26Å; A38-V42 WeakPolarHBondContact O-CG2 3.37Å; A38-V42 PolarHBondContact O-N 3.27Å
39	A	96.6	Very high	93.6	Very high	54 Å²	54	88.1 Å²	88.1	45%	0.446	51%	0.507	S	S	.	.	H	α-helix	trans	-61.4	-46	176.3	0	0	0	0	0	111.8	T35 S36 V37 C41 V42 V43	T35-A39 WeakPolarHBondContact O-CB 3.39Å; T35-A39 PolarHBondContact O-N 3.31Å; S36-A39 PolarHBondContact O-N 3.45Å; V37-A39 VanDerWaalsContact C-N 3.33Å; V37-A39 PolarHBondContact O-N 3.2Å; A39-C41 PolarHBondContact O-N 2.77Å; A39-V42 PolarHBondContact O-N 3.48Å; A39-V43 VanDerWaalsContact O-CG2 3.32Å; A39-V43 WeakPolarHBondContact O-CG2 3.26Å; A39-V43 PolarHBondContact O-N 3.29Å
40	V	96.7	Very high	93.6	Very high	80 Å²	80	91.1 Å²	91.1	49%	0.485	52%	0.517	S	S	.	.	H	α-helix	trans	-61.6	-44.6	176.1	175	0	0	0	0	110.9	S36 V37 V42 V43 I44	S36-V40 WeakPolarHBondContact O-CG2 3.38Å; S36-V40 PolarHBondContact O-N 3.4Å; V37-V40 PolarHBondContact O-N 2.87Å; V40-V42 PolarHBondContact O-N 2.83Å; V40-V43 PolarHBondContact O-N 3.49Å; V40-I44 HydrophobicContact CG1-CD1 3.85Å; V40-I44 HydrophobicContact CG1-CG1 4.48Å; V40-I44 VanDerWaalsContact O-CG1 3.3Å; V40-I44 WeakPolarHBondContact O-CG1 3.19Å; V40-I44 PolarHBondContact O-N 2.86Å
41	C	96.1	Very high	93.5	Very high	64 Å²	64	91.7 Å²	91.7	43%	0.432	52%	0.52	S	S	.	.	H	α-helix	trans	-59.3	-45.7	174.7	-75.1	0	0	0	0	111.9	V37 A38 A39 V43 I44 L45	V37-C41 WeakPolarHBondContact O-CB 3.44Å; V37-C41 PolarHBondContact O-N 3.46Å; V37-C41 PolarHBondContact O-SG 3.41Å; V37-C41 VanDerWaalsContact O-SG 3.38Å; A38-C41 PolarHBondContact O-N 2.89Å; A39-C41 PolarHBondContact O-N 2.77Å; C41-V43 VanDerWaalsContact C-N 3.33Å; C41-V43 PolarHBondContact O-N 3.33Å; C41-I44 PolarHBondContact O-N 3.26Å; C41-L45 WeakPolarHBondContact O-CB 3.27Å; C41-L45 VanDerWaalsContact O-CG 3.25Å; C41-L45 WeakPolarHBondContact O-CG 3.47Å; C41-L45 PolarHBondContact O-N 3.4Å
42	V	96.1	Very high	93.3	Very high	83 Å²	83	90.8 Å²	90.8	50%	0.503	52%	0.518	S	S	.	.	H	α-helix	trans	-61.8	-41.8	177.1	169.4	0	0	0	0	110.9	A38 A39 V40 L45 C46	A38-V42 WeakPolarHBondContact O-CB 3.25Å; A38-V42 VanDerWaalsContact O-CG2 3.26Å; A38-V42 WeakPolarHBondContact O-CG2 3.37Å; A38-V42 PolarHBondContact O-N 3.27Å; A39-V42 PolarHBondContact O-N 3.48Å; V40-V42 PolarHBondContact O-N 2.83Å; V42-L45 PolarHBondContact O-N 2.84Å; V42-C46 VanDerWaalsContact O-CB 3.27Å; V42-C46 WeakPolarHBondContact O-CB 3.44Å; V42-C46 PolarHBondContact O-N 3.38Å; V42-C46 PolarHBondContact O-SG 3.22Å
43	V	95.8	Very high	92.9	Very high	91 Å²	91	89.5 Å²	89.5	55%	0.552	51%	0.507	S	S	*	.	H	α-helix	trans	-61.5	-48.4	176	171.4	0	0	0	0	110.7	A39 V40 C41 L45 C46 I47	A39-V43 VanDerWaalsContact O-CG2 3.32Å; A39-V43 WeakPolarHBondContact O-CG2 3.26Å; A39-V43 PolarHBondContact O-N 3.29Å; V40-V43 PolarHBondContact O-N 3.49Å; C41-V43 VanDerWaalsContact C-N 3.33Å; C41-V43 PolarHBondContact O-N 3.33Å; V43-L45 PolarHBondContact O-N 3.46Å; V43-C46 WeakPolarHBondContact O-CB 3.37Å; V43-C46 PolarHBondContact O-N 3.28Å; V43-I47 WeakPolarHBondContact O-CG1 3.3Å; V43-I47 PolarHBondContact O-N 3.05Å
44	I	94.6	Very high	92.4	Very high	91 Å²	91	90.2 Å²	90.2	47%	0.467	51%	0.511	S	S	.	.	H	α-helix	trans	-59.7	-47.4	178	-66.7	165.9	0	0	0	110.5	V40 C41 C46 I47 I48	V40-I44 HydrophobicContact CG1-CD1 3.85Å; V40-I44 HydrophobicContact CG1-CG1 4.48Å; V40-I44 VanDerWaalsContact O-CG1 3.3Å; V40-I44 WeakPolarHBondContact O-CG1 3.19Å; V40-I44 PolarHBondContact O-N 2.86Å; C41-I44 PolarHBondContact O-N 3.26Å; I44-C46 VanDerWaalsContact C-N 3.34Å; I44-C46 PolarHBondContact O-N 2.94Å; I44-I47 PolarHBondContact O-N 2.99Å; I44-I48 HydrophobicContact CG2-CD1 3.77Å; I44-I48 HydrophobicContact CG2-CG1 4.42Å; I44-I48 WeakPolarHBondContact O-CG1 3.32Å; I44-I48 PolarHBondContact O-N 3.22Å
45	L	93.6	Very high	91.9	Very high	111 Å²	111	90.1 Å²	90.1	58%	0.581	51%	0.511	S	S	*	.	H	α-helix	trans	-62.6	-39.2	177	-71.2	175.7	0	0	0	111.8	C41 V42 V43 I47 I48 Y49	C41-L45 WeakPolarHBondContact O-CB 3.27Å; C41-L45 VanDerWaalsContact O-CG 3.25Å; C41-L45 WeakPolarHBondContact O-CG 3.47Å; C41-L45 PolarHBondContact O-N 3.4Å; V42-L45 PolarHBondContact O-N 2.84Å; V43-L45 PolarHBondContact O-N 3.46Å; L45-I47 VanDerWaalsContact C-N 3.32Å; L45-I47 PolarHBondContact O-N 3.48Å; L45-I48 PolarHBondContact O-N 2.85Å; L45-Y49 WeakPolarHBondContact O-CA 2.94Å; L45-Y49 WeakPolarHBondContact O-CB 3.02Å; L45-Y49 PolarHBondContact O-N 2.68Å
46	C	90.8	Very high	91.2	Very high	69 Å²	69	91.5 Å²	91.5	47%	0.466	51%	0.509	S	S	.	.	H	α-helix	trans	-61.9	-39.8	174.7	-83.2	0	0	0	0	111.9	V42 V43 I44 K50	V42-C46 VanDerWaalsContact O-CB 3.27Å; V42-C46 WeakPolarHBondContact O-CB 3.44Å; V42-C46 PolarHBondContact O-N 3.38Å; V42-C46 PolarHBondContact O-SG 3.22Å; V43-C46 WeakPolarHBondContact O-CB 3.37Å; V43-C46 PolarHBondContact O-N 3.28Å; I44-C46 VanDerWaalsContact C-N 3.34Å; I44-C46 PolarHBondContact O-N 2.94Å; C46-K50 VanDerWaalsContact O-CB 3.28Å; C46-K50 WeakPolarHBondContact O-CB 3.2Å; C46-K50 WeakPolarHBondContact O-CG 3.28Å; C46-K50 PolarHBondContact O-N 3.44Å
47	I	91.3	Very high	90.3	Very high	109 Å²	109	96.3 Å²	96.3	56%	0.559	52%	0.517	S	S	*	.	H	α-helix	trans	-67.4	-50.7	176.4	-63.8	-61	0	0	0	110.6	V43 I44 L45 Y49 K50 V51	V43-I47 WeakPolarHBondContact O-CG1 3.3Å; V43-I47 PolarHBondContact O-N 3.05Å; I44-I47 PolarHBondContact O-N 2.99Å; L45-I47 VanDerWaalsContact C-N 3.32Å; L45-I47 PolarHBondContact O-N 3.48Å; I47-Y49 VanDerWaalsContact C-N 3.31Å; I47-Y49 PolarHBondContact O-N 2.72Å; I47-K50 PolarHBondContact O-N 2.92Å; I47-V51 WeakPolarHBondContact O-CG2 3.41Å; I47-V51 PolarHBondContact O-N 2.98Å
48	I	90.9	Very high	89.5	Confident	95 Å²	95	100.6 Å²	100.6	49%	0.487	52%	0.524	S	S	.	.	H	α-helix	trans	-60.6	-44.6	178.3	-64.6	170.8	0	0	0	109.8	I44 L45 K50 V51 D52	I44-I48 HydrophobicContact CG2-CD1 3.77Å; I44-I48 HydrophobicContact CG2-CG1 4.42Å; I44-I48 WeakPolarHBondContact O-CG1 3.32Å; I44-I48 PolarHBondContact O-N 3.22Å; L45-I48 PolarHBondContact O-N 2.85Å; I48-K50 PolarHBondContact O-N 3.46Å; I48-V51 PolarHBondContact O-N 3.45Å; I48-D52 VanDerWaalsContact O-CB 3.24Å; I48-D52 WeakPolarHBondContact O-CB 3.08Å; I48-D52 PolarHBondContact O-N 3.43Å
49	Y	89	Confident	88.6	Confident	150 Å²	150	106.9 Å²	106.9	59%	0.588	54%	0.537	S	S	*	.	H	α-helix	trans	-65.9	-36.4	178.1	-174.5	-97	0	0	0	112.1	L45 I47 V51 L53	L45-Y49 WeakPolarHBondContact O-CA 2.94Å; L45-Y49 WeakPolarHBondContact O-CB 3.02Å; L45-Y49 PolarHBondContact O-N 2.68Å; I47-Y49 VanDerWaalsContact C-N 3.31Å; I47-Y49 PolarHBondContact O-N 2.72Å; Y49-V51 VanDerWaalsContact C-N 3.33Å; Y49-L53 HydrophobicContact CD1-CB 4.36Å; Y49-L53 HydrophobicContact CE1-CB 4.18Å; Y49-L53 HydrophobicContact CE1-CD1 4.26Å; Y49-L53 HydrophobicContact CE1-CD2 4.1Å; Y49-L53 HydrophobicContact CE1-CG 4.42Å; Y49-L53 WeakPolarHBondContact O-CA 2.95Å; Y49-L53 WeakPolarHBondContact O-CB 3.4Å; Y49-L53 PolarHBondContact O-N 3.43Å
50	K	89.1	Confident	87.5	Confident	147 Å²	147	107.5 Å²	107.5	64%	0.639	54%	0.535	S	S	*	.	H	α-helix	trans	-61.8	-44.6	172.9	-83.3	-87.8	-177.8	163.9	0	111.1	C46 I47 I48 V54	C46-K50 VanDerWaalsContact O-CB 3.28Å; C46-K50 WeakPolarHBondContact O-CB 3.2Å; C46-K50 WeakPolarHBondContact O-CG 3.28Å; C46-K50 PolarHBondContact O-N 3.44Å; I47-K50 PolarHBondContact O-N 2.92Å; I48-K50 PolarHBondContact O-N 3.46Å; K50-V54 WeakPolarHBondContact O-CB 3.43Å; K50-V54 WeakPolarHBondContact O-CG2 3.37Å; K50-V54 PolarHBondContact O-N 3.2Å
51	V	87.2	Confident	86.3	Confident	85 Å²	85	105.5 Å²	105.5	52%	0.515	53%	0.527	S	S	.	.	H	α-helix	trans	-68	-44.9	178.6	175.6	0	0	0	0	110.8	I47 I48 Y49 V54 L55	I47-V51 WeakPolarHBondContact O-CG2 3.41Å; I47-V51 PolarHBondContact O-N 2.98Å; I48-V51 PolarHBondContact O-N 3.45Å; Y49-V51 VanDerWaalsContact C-N 3.33Å; V51-V54 WeakPolarHBondContact O-CB 3.02Å; V51-V54 PolarHBondContact O-N 2.77Å; V51-L55 HydrophobicContact CG1-CD1 4.05Å; V51-L55 HydrophobicContact CG1-CG 4.48Å; V51-L55 WeakPolarHBondContact O-CB 3.43Å; V51-L55 WeakPolarHBondContact O-CG 3.39Å; V51-L55 PolarHBondContact O-N 3.45Å
52	D	85.9	Confident	84.7	Confident	92 Å²	92	107.9 Å²	107.9	49%	0.492	53%	0.532	S	S	.	.	H	α-helix	trans	-70.1	-38.4	179.7	-164	14.4	0	0	0	111.1	I48 V54 L55 F56	I48-D52 VanDerWaalsContact O-CB 3.24Å; I48-D52 WeakPolarHBondContact O-CB 3.08Å; I48-D52 PolarHBondContact O-N 3.43Å; D52-V54 VanDerWaalsContact C-N 3.3Å; D52-V54 PolarHBondContact O-N 2.84Å; D52-L55 CarbonylContact O-C 3.58Å; D52-L55 PolarHBondContact O-N 3.38Å; D52-F56 WeakPolarHBondContact O-CA 3.24Å; D52-F56 WeakPolarHBondContact O-CB 3.5Å; D52-F56 PolarHBondContact O-N 2.73Å
53	L	84.1	Confident	83	Confident	75 Å²	75	113 Å²	113	39%	0.393	54%	0.542	S	S	.	.	H	α-helix	trans	-61	-40.7	170.5	-176	73.1	0	0	0	110.3	Y49 Y57	Y49-L53 HydrophobicContact CD1-CB 4.36Å; Y49-L53 HydrophobicContact CE1-CB 4.18Å; Y49-L53 HydrophobicContact CE1-CD1 4.26Å; Y49-L53 HydrophobicContact CE1-CD2 4.1Å; Y49-L53 HydrophobicContact CE1-CG 4.42Å; Y49-L53 WeakPolarHBondContact O-CA 2.95Å; Y49-L53 WeakPolarHBondContact O-CB 3.4Å; Y49-L53 PolarHBondContact O-N 3.43Å; L53-Y57 WeakPolarHBondContact O-CA 3.24Å; L53-Y57 WeakPolarHBondContact O-CB 3.33Å; L53-Y57 PolarHBondContact O-N 2.67Å
54	V	84.4	Confident	81.2	Confident	98 Å²	98	113.3 Å²	113.3	59%	0.594	54%	0.541	S	S	*	.	H	α-helix	trans	-66.6	-42.9	174.9	166.7	0	0	0	0	111.3	K50 V51 D52 R58	K50-V54 WeakPolarHBondContact O-CB 3.43Å; K50-V54 WeakPolarHBondContact O-CG2 3.37Å; K50-V54 PolarHBondContact O-N 3.2Å; V51-V54 WeakPolarHBondContact O-CB 3.02Å; V51-V54 PolarHBondContact O-N 2.77Å; D52-V54 VanDerWaalsContact C-N 3.3Å; D52-V54 PolarHBondContact O-N 2.84Å; V54-R58 VanDerWaalsContact O-CB 3.24Å; V54-R58 WeakPolarHBondContact O-CB 3.41Å; V54-R58 PolarHBondContact O-N 2.83Å
55	L	82.6	Confident	79.4	Confident	100 Å²	100	115.2 Å²	115.2	52%	0.524	55%	0.548	S	S	.	.	H	α-helix	trans	-68.2	-40	177.8	-73.3	172.2	0	0	0	112.2	V51 D52 R58 R59	V51-L55 HydrophobicContact CG1-CD1 4.05Å; V51-L55 HydrophobicContact CG1-CG 4.48Å; V51-L55 WeakPolarHBondContact O-CB 3.43Å; V51-L55 WeakPolarHBondContact O-CG 3.39Å; V51-L55 PolarHBondContact O-N 3.45Å; D52-L55 CarbonylContact O-C 3.58Å; D52-L55 PolarHBondContact O-N 3.38Å; L55-R58 PolarHBondContact O-N 3.23Å; L55-R59 VanDerWaalsContact O-CB 3.31Å; L55-R59 WeakPolarHBondContact O-CB 3.49Å; L55-R59 PolarHBondContact O-N 2.94Å
56	F	80.5	Confident	77.6	Confident	124 Å²	124	114.5 Å²	114.5	54%	0.544	55%	0.548	S	S	.	.	H	α-helix	trans	-69.8	-46.5	176.9	-174.3	-96.8	0	0	0	110	D52 R58 R59 V60	D52-F56 WeakPolarHBondContact O-CA 3.24Å; D52-F56 WeakPolarHBondContact O-CB 3.5Å; D52-F56 PolarHBondContact O-N 2.73Å; F56-R58 VanDerWaalsContact C-N 3.26Å; F56-R58 PolarHBondContact O-N 2.73Å; F56-R59 PolarHBondContact O-N 2.75Å; F56-V60 HydrophobicContact CD1-CG2 3.83Å; F56-V60 HydrophobicContact CD2-CG2 4.43Å; F56-V60 HydrophobicContact CE1-CG2 3.48Å; F56-V60 VanDerWaalsContact CE1-CG2 3.48Å; F56-V60 HydrophobicContact CE2-CG2 4.12Å; F56-V60 HydrophobicContact CG-CG2 4.3Å; F56-V60 HydrophobicContact CZ-CG2 3.63Å; F56-V60 VanDerWaalsContact O-CB 3.3Å; F56-V60 WeakPolarHBondContact O-CB 3.42Å; F56-V60 VanDerWaalsContact O-CG2 3.25Å; F56-V60 WeakPolarHBondContact O-CG2 3.25Å; F56-V60 PolarHBondContact O-N 3.17Å
57	Y	78.2	Confident	75.8	Confident	172 Å²	172	117.6 Å²	117.6	68%	0.675	56%	0.559	S	S	*	*	H	α-helix	trans	-56.7	-44.3	172.3	-176.6	-93.7	0	0	0	110.3	L53 V60 A61	L53-Y57 WeakPolarHBondContact O-CA 3.24Å; L53-Y57 WeakPolarHBondContact O-CB 3.33Å; L53-Y57 PolarHBondContact O-N 2.67Å; Y57-V60 PolarHBondContact O-N 3.22Å; Y57-A61 HydrophobicContact CE1-CB 4.49Å; Y57-A61 WeakPolarHBondContact O-CB 3.27Å; Y57-A61 PolarHBondContact O-N 3.41Å
58	R	79.6	Confident	74.1	Confident	170 Å²	170	117.6 Å²	117.6	64%	0.642	56%	0.564	S	S	*	*	H	α-helix	trans	-62.3	-47.5	175	-171.4	177.7	-176	-168.8	1	111.9	V54 L55 F56 V60 A61 E62	V54-R58 VanDerWaalsContact O-CB 3.24Å; V54-R58 WeakPolarHBondContact O-CB 3.41Å; V54-R58 PolarHBondContact O-N 2.83Å; L55-R58 PolarHBondContact O-N 3.23Å; F56-R58 VanDerWaalsContact C-N 3.26Å; F56-R58 PolarHBondContact O-N 2.73Å; R58-V60 VanDerWaalsContact C-N 3.33Å; R58-V60 PolarHBondContact O-N 2.96Å; R58-A61 PolarHBondContact O-N 3.25Å; R58-E62 WeakPolarHBondContact O-CB 3.13Å; R58-E62 PolarHBondContact O-N 3.12Å
59	R	77.3	Confident	72.4	Confident	185 Å²	185	116 Å²	116	70%	0.698	57%	0.572	S	S	*	*	H	α-helix	trans	-65.6	-34.3	179.4	-175.8	-179.6	-71.3	176	-1.3	112.8	L55 F56 R63	L55-R59 VanDerWaalsContact O-CB 3.31Å; L55-R59 WeakPolarHBondContact O-CB 3.49Å; L55-R59 PolarHBondContact O-N 2.94Å; F56-R59 PolarHBondContact O-N 2.75Å; R59-R63 PolarHBondContact O-N 2.94Å
60	V	73.8	Confident	70.8	Confident	66 Å²	66	115.9 Å²	115.9	40%	0.4	58%	0.581	S	S	.	*	H	α-helix	trans	-75.9	-46.5	176.7	171.1	0	0	0	0	110.4	F56 Y57 R58 E62 R63 D64	F56-V60 HydrophobicContact CD1-CG2 3.83Å; F56-V60 HydrophobicContact CD2-CG2 4.43Å; F56-V60 HydrophobicContact CE1-CG2 3.48Å; F56-V60 VanDerWaalsContact CE1-CG2 3.48Å; F56-V60 HydrophobicContact CE2-CG2 4.12Å; F56-V60 HydrophobicContact CG-CG2 4.3Å; F56-V60 HydrophobicContact CZ-CG2 3.63Å; F56-V60 VanDerWaalsContact O-CB 3.3Å; F56-V60 WeakPolarHBondContact O-CB 3.42Å; F56-V60 VanDerWaalsContact O-CG2 3.25Å; F56-V60 WeakPolarHBondContact O-CG2 3.25Å; F56-V60 PolarHBondContact O-N 3.17Å; Y57-V60 PolarHBondContact O-N 3.22Å; R58-V60 VanDerWaalsContact C-N 3.33Å; R58-V60 PolarHBondContact O-N 2.96Å; V60-E62 VanDerWaalsContact C-N 3.27Å; V60-E62 PolarHBondContact O-N 3.38Å; V60-R63 WeakPolarHBondContact O-CA 3.48Å; V60-R63 WeakPolarHBondContact O-CB 3.3Å; V60-R63 PolarHBondContact O-N 3.24Å; V60-D64 PolarHBondContact O-N 3.03Å
61	A	70.7	Confident	69.2	Low	39 Å²	39	115.6 Å²	115.6	32%	0.322	59%	0.586	S	S	.	*	H	α-helix	trans	-58.8	-40.8	174.3	0	0	0	0	0	111.3	Y57 R58 R63 D64 E65	Y57-A61 HydrophobicContact CE1-CB 4.49Å; Y57-A61 WeakPolarHBondContact O-CB 3.27Å; Y57-A61 PolarHBondContact O-N 3.41Å; R58-A61 PolarHBondContact O-N 3.25Å; A61-R63 VanDerWaalsContact C-N 3.25Å; A61-R63 PolarHBondContact O-N 3.48Å; A61-D64 PolarHBondContact O-N 3.39Å; A61-D64 VanDerWaalsContact O-N 3.12Å; A61-E65 PolarHBondContact O-N 2.83Å
62	E	63.6	Low	67.5	Low	114 Å²	114	117.1 Å²	117.1	53%	0.533	60%	0.598	S	S	.	*	H	α-helix	trans	-67.2	-24.4	175.7	-166.3	173.7	177.8	0	0	113	R58 V60 E65	R58-E62 WeakPolarHBondContact O-CB 3.13Å; R58-E62 PolarHBondContact O-N 3.12Å; V60-E62 VanDerWaalsContact C-N 3.27Å; V60-E62 PolarHBondContact O-N 3.38Å; E62-E65 VanDerWaalsContact CA-OE1 3.27Å; E62-E65 WeakPolarHBondContact CA-OE1 3.31Å; E62-E65 WeakPolarHBondContact O-CG 3.13Å
63	R	60.1	Low	66.1	Low	189 Å²	189	124.1 Å²	124.1	71%	0.713	63%	0.634	S	S	*	*	H	α-helix	trans	-79.2	-35.9	168.6	-95.5	-152.2	166.8	-173.5	-2.8	113.1	R59 V60 A61 E65 T66 L67	R59-R63 PolarHBondContact O-N 2.94Å; V60-R63 WeakPolarHBondContact O-CA 3.48Å; V60-R63 WeakPolarHBondContact O-CB 3.3Å; V60-R63 PolarHBondContact O-N 3.24Å; A61-R63 VanDerWaalsContact C-N 3.25Å; A61-R63 PolarHBondContact O-N 3.48Å; R63-E65 VanDerWaalsContact C-N 3.26Å; R63-E65 PolarHBondContact O-N 3.46Å; R63-T66 PolarHBondContact O-N 3.44Å; R63-T66 VanDerWaalsContact O-N 3.08Å; R63-T66 PolarHBondContact O-OG1 2.81Å; R63-L67 PolarHBondContact O-N 3.28Å
64	D	58.4	Low	65.2	Low	99 Å²	99	126.6 Å²	126.6	53%	0.529	65%	0.646	S	S	.	*	H	α-helix	trans	-66.2	-30.8	-177.7	-125	26.2	0	0	0	112	V60 A61 T66 L67 T68	V60-D64 PolarHBondContact O-N 3.03Å; A61-D64 PolarHBondContact O-N 3.39Å; A61-D64 VanDerWaalsContact O-N 3.12Å; D64-T66 VanDerWaalsContact C-N 3.34Å; D64-T66 PolarHBondContact O-N 3.37Å; D64-L67 PolarHBondContact O-N 3.22Å; D64-T68 PolarHBondContact O-N 3.34Å; D64-T68 PolarHBondContact O-OG1 3.01Å
65	E	55.8	Low	64.2	Low	131 Å²	131	128.1 Å²	128.1	61%	0.612	65%	0.649	S	S	*	*	H	α-helix	trans	-68.1	-28.5	172	51.3	-174.7	126.3	0	0	113.4	A61 E62 R63 G69	A61-E65 PolarHBondContact O-N 2.83Å; E62-E65 VanDerWaalsContact CA-OE1 3.27Å; E62-E65 WeakPolarHBondContact CA-OE1 3.31Å; E62-E65 WeakPolarHBondContact O-CG 3.13Å; R63-E65 VanDerWaalsContact C-N 3.26Å; R63-E65 PolarHBondContact O-N 3.46Å; E65-G69 PolarHBondContact O-N 3.27Å
66	T	56.6	Low	63.2	Low	96 Å²	96	129.7 Å²	129.7	59%	0.589	66%	0.656	S	S	*	*	H	α-helix	trans	-77.2	-22	172	67.2	0	0	0	0	114	R63 D64	R63-T66 PolarHBondContact O-N 3.44Å; R63-T66 VanDerWaalsContact O-N 3.08Å; R63-T66 PolarHBondContact O-OG1 2.81Å; D64-T66 VanDerWaalsContact C-N 3.34Å; D64-T66 PolarHBondContact O-N 3.37Å
67	L	53.1	Low	62.2	Low	134 Å²	134	130 Å²	130	70%	0.702	66%	0.662	S	S	*	*	H	α-helix	trans	-83.8	-33.9	174.2	-103.6	144.2	0	0	0	111.8	R63 D64	R63-L67 PolarHBondContact O-N 3.28Å; D64-L67 PolarHBondContact O-N 3.22Å
68	T	55.5	Low	61.2	Low	108 Å²	108	127.4 Å²	127.4	66%	0.663	66%	0.662	S	S	*	*	H	α-helix	trans	-82.7	-25.9	178.3	-48.1	0	0	0	0	112.5	D64 N70	D64-T68 PolarHBondContact O-N 3.34Å; D64-T68 PolarHBondContact O-OG1 3.01Å; T68-N70 VanDerWaalsContact C-N 3.29Å; T68-N70 PolarHBondContact O-N 2.69Å
69	G	54.9	Low	59.9	Low	63 Å²	63	124.5 Å²	124.5	65%	0.649	66%	0.663	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.8	1	178.9	0	0	0	0	0	116.3	E65	E65-G69 PolarHBondContact O-N 3.27Å
70	N	55.3	Low	58.7	Low	146 Å²	146	120.2 Å²	120.2	78%	0.781	66%	0.661	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103	14.7	179.4	-121	14.3	0	0	0	113.5	T68 P72	T68-N70 VanDerWaalsContact C-N 3.29Å; T68-N70 PolarHBondContact O-N 2.69Å; N70-P72 VanDerWaalsContact O-CD 3.28Å; N70-P72 WeakPolarHBondContact O-CD 3.28Å
71	L	55	Low	57.5	Low	142 Å²	142	124.4 Å²	124.4	74%	0.743	68%	0.681	S	S	*	*			trans	-84.9	108.5	169.5	-167	68.9	0	0	0	108.8	L73	L71-L73 PolarHBondContact O-N 3.08Å
72	P	51.9	Low	56.5	Low	117 Å²	117	131.5 Å²	131.5	76%	0.76	71%	0.71	S	S	*	*			trans	-73.8	116.7	176.4	31.6	-29.7	0	0	0	107.9	N70	N70-P72 VanDerWaalsContact O-CD 3.28Å; N70-P72 WeakPolarHBondContact O-CD 3.28Å
73	L	57.4	Low	55.8	Low	239 Å²	239	133.1 Å²	133.1	100%	1.251	73%	0.727	S	S	*	*			trans	-98.1	0	155.6	-90.6	165.9	0	0	0	108.4	L71	L71-L73 PolarHBondContact O-N 3.08Å

Retrieved 73 of 73 residues in 47.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).