A0A090N8E7_HUMAN Loading...

Similar to 60S ribosomal protein L32

AlphaFold DB , UniProt , Accession A0A090N8E7, Species HUMAN (Homo sapiens, Human), Gene LOC402318, Length 132 aa.

						>A0A090N8E7_HUMAN|A0A090N8E7|LOC402318
MADLRPLMKPKIVKKRTKKFIWHQSDRCVKIKCNWWKPSSIGNRVWRTFKGQILMPNTGYGNKKTKHMPPSGFWKFLVHNVKELEVPLTCSKSPCAEIAHSVSSKNHKAIWKGQPSCPQSHQPQCQAAQQRK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43	Very low	66.9	Low	202 Å²	202	133.5 Å²	133.5	100%	0.995	67%	0.671	S	S	*	*				0	114	0	-75.3	-75.2	-177.6	0	0	106.6	D3	M1-D3 PolarHBondContact O-N 3.47Å
2	A	40.8	Very low	68.9	Low	92 Å²	92	126.6 Å²	126.6	76%	0.76	64%	0.636	S	S	*	*			trans	-72.1	110.6	179.5	0	0	0	0	0	108.6	L4	A2-L4 PolarHBondContact O-N 3.1Å
3	D	55	Low	70.6	Confident	136 Å²	136	123.6 Å²	123.6	73%	0.727	63%	0.628	S	S	*	*			trans	-67.5	99.1	173.2	-70.4	-33.9	0	0	0	108.4	M1 R5	M1-D3 PolarHBondContact O-N 3.47Å; D3-R5 WeakPolarHBondContact O-CG 3.47Å; D3-R5 PolarHBondContact O-N 3.41Å
4	L	63.4	Low	72.1	Confident	83 Å²	83	123.3 Å²	123.3	44%	0.435	62%	0.62	S	S	.	*			trans	-64.8	111.2	174.2	-67.1	168.6	0	0	0	108.3	A2 F73 S116 P118	A2-L4 PolarHBondContact O-N 3.1Å; L4-F73 WeakPolarHBondContact O-CZ 3.38Å; L4-S116 WeakPolarHBondContact CD1-O 3.5Å; L4-P118 HydrophobicContact CB-CB 3.8Å; L4-P118 HydrophobicContact CB-CG 3.66Å; L4-P118 HydrophobicContact CD1-CB 4.27Å; L4-P118 HydrophobicContact CD1-CG 4.13Å
5	R	65.3	Low	73.5	Confident	220 Å²	220	122.9 Å²	122.9	83%	0.83	61%	0.613	S	S	*	*			trans	-87.8	134.4	-179.5	-61.4	-179	-173.8	178.4	1.2	109.1	D3	D3-R5 WeakPolarHBondContact O-CG 3.47Å; D3-R5 PolarHBondContact O-N 3.41Å
6	P	71	Confident	74.7	Confident	29 Å²	29	119.6 Å²	119.6	19%	0.188	59%	0.591	C	S	.	*			trans	-63.2	139.6	173.3	25.8	-32.3	0	0	0	109.9	M8 K9 F73	P6-M8 PolarHBondContact O-N 3.37Å; P6-K9 HydrophobicContact CG-CB 4.19Å; P6-K9 HydrophobicContact CG-CD 4.46Å; P6-K9 HydrophobicContact CG-CG 4.46Å; P6-F73 HydrophobicContact CB-CD1 4.14Å; P6-F73 HydrophobicContact CB-CE1 3.63Å; P6-F73 HydrophobicContact CB-CE2 4.41Å; P6-F73 HydrophobicContact CB-CZ 3.78Å; P6-F73 HydrophobicContact CG-CE1 4.46Å; P6-F73 HydrophobicContact CG-CE2 4.39Å; P6-F73 HydrophobicContact CG-CZ 4.17Å
7	L	70.1	Confident	75.7	Confident	177 Å²	177	120.1 Å²	120.1	93%	0.927	60%	0.603	S	S	*	*	S	Bend	trans	-56.8	-36.2	178.9	-177.5	64.3	0	0	0	112.3
8	M	74.9	Confident	76.7	Confident	159 Å²	159	122.8 Å²	122.8	78%	0.783	61%	0.61	S	S	*	*			trans	-132.1	124.2	173.3	-61.2	-167.5	86	0	0	110.5	P6 P10	P6-M8 PolarHBondContact O-N 3.37Å; M8-P10 WeakPolarHBondContact O-CD 3.05Å
9	K	80.3	Confident	77.6	Confident	130 Å²	130	125.9 Å²	125.9	57%	0.565	62%	0.619	S	S	*	*			trans	-116	92.2	175.2	-166.6	173.6	-177.1	172.2	0	110.4	P6 P70	P6-K9 HydrophobicContact CG-CB 4.19Å; P6-K9 HydrophobicContact CG-CD 4.46Å; P6-K9 HydrophobicContact CG-CG 4.46Å; K9-P70 WeakPolarHBondContact CE-O 3.31Å; K9-P70 PolarHBondContact NZ-O 2.98Å
10	P	84.5	Confident	78.4	Confident	55 Å²	55	122 Å²	122	36%	0.357	60%	0.599	S	S	.	*			trans	-63.4	140.7	176.7	26.3	-32.9	0	0	0	110.6	M8 I12 T65 M68	M8-P10 WeakPolarHBondContact O-CD 3.05Å; P10-I12 PolarHBondContact O-N 3.06Å; P10-T65 HydrophobicContact CB-CG2 4.35Å; P10-T65 HydrophobicContact CG-CG2 4.36Å; P10-M68 HydrophobicContact CG-CE 3.89Å; P10-M68 HydrophobicContact CG-SD 3.76Å
11	K	87.9	Confident	79.2	Confident	186 Å²	186	118.9 Å²	118.9	81%	0.809	58%	0.584	S	S	*	*			trans	-61.6	119.3	176.5	-174.9	176	-178.1	175	0	110	V13	K11-V13 HydrophobicContact CG-CG2 4.35Å; K11-V13 PolarHBondContact O-N 3.19Å
12	I	90.6	Very high	81.6	Confident	50 Å²	50	113.1 Å²	113.1	26%	0.256	55%	0.552	S	S	.	*			trans	-80.7	103.4	179.2	-56.7	174	0	0	0	108.7	P10 K14 T65 M68 P69	P10-I12 PolarHBondContact O-N 3.06Å; I12-K14 HydrophobicContact CG2-CD 4.11Å; I12-K14 HydrophobicContact CG2-CG 4.39Å; I12-T65 HydrophobicContact CG1-CG2 4.5Å; I12-M68 HydrophobicContact CD1-CG 4.17Å; I12-M68 HydrophobicContact CD1-SD 4.35Å; I12-M68 HydrophobicContact CG1-SD 4.4Å; I12-P69 WeakPolarHBondContact CD1-O 3.49Å
13	V	90.8	Very high	84.1	Confident	88 Å²	88	110.3 Å²	110.3	53%	0.533	52%	0.522	S	S	.	.			trans	-97.2	117.4	172.2	-179.8	0	0	0	0	108.9	K11 N62	K11-V13 HydrophobicContact CG-CG2 4.35Å; K11-V13 PolarHBondContact O-N 3.19Å; V13-N62 PolarHBondContact O-ND2 3.22Å
14	K	91.3	Very high	85.9	Confident	119 Å²	119	107 Å²	107	52%	0.517	50%	0.503	S	S	.	.			trans	-96.1	115.3	172.5	-60.6	-60.9	-173.8	-176.5	0	108.9	I12 R16	I12-K14 HydrophobicContact CG2-CD 4.11Å; I12-K14 HydrophobicContact CG2-CG 4.39Å; K14-R16 PolarHBondContact O-N 2.97Å
15	K	92.8	Very high	87.3	Confident	118 Å²	118	103.6 Å²	103.6	51%	0.513	49%	0.486	S	S	.	.	S	Bend	trans	-64.6	-30.3	177.5	-67	176.8	176.2	173.8	0	112.6	G59 G61 N62	K15-G59 VanDerWaalsContact CD-O 3.27Å; K15-G59 WeakPolarHBondContact CD-O 3.13Å; K15-G59 PolarHBondContact NZ-O 2.79Å; K15-G61 PolarHBondContact NZ-O 2.87Å; K15-N62 VanDerWaalsContact CE-OD1 3.3Å; K15-N62 WeakPolarHBondContact CE-OD1 3.12Å
16	R	93.1	Very high	88.5	Confident	69 Å²	69	98.9 Å²	98.9	26%	0.26	48%	0.477	S	S	.	.			trans	-148.3	133.5	176.7	-172.7	-175.8	177.6	105.4	-3.7	109.4	K14 K18 F20 Y60	K14-R16 PolarHBondContact O-N 2.97Å; R16-K18 PolarHBondContact NE-O 3.24Å; R16-F20 VanDerWaalsContact CD-CZ 3.42Å; R16-Y60 HydrophobicContact CB-CD1 4.03Å; R16-Y60 HydrophobicContact CB-CE1 4.42Å
17	T	92.6	Very high	89.6	Confident	129 Å²	129	105.5 Å²	105.5	79%	0.791	50%	0.499	S	S	*	.			trans	-103.2	-31.9	176.3	-47.4	0	0	0	0	111.8
18	K	92.9	Very high	90.5	Very high	168 Å²	168	99.5 Å²	99.5	73%	0.73	47%	0.471	S	S	*	.	S	Bend	trans	-66.3	132.2	178.2	-65.7	-172.3	178.4	-175.6	0	111	R16	R16-K18 PolarHBondContact NE-O 3.24Å
19	K	93.4	Very high	91.4	Very high	182 Å²	182	99.2 Å²	99.2	79%	0.791	48%	0.477	S	S	*	.	P	Polyproline II helix	trans	-61.2	151.4	173.2	-65.2	-177.6	-179.6	178.2	0	110.6
20	F	94.8	Very high	92.1	Very high	48 Å²	48	102.8 Å²	102.8	21%	0.211	49%	0.493	C	S	.	.	P	Polyproline II helix	trans	-82.2	117.3	166.9	-66.6	-79.6	0	0	0	107.4	R16 W35 L54 P56 Y60	R16-F20 VanDerWaalsContact CD-CZ 3.42Å; F20-W35 HydrophobicContact CB-CB 3.99Å; F20-W35 HydrophobicContact CB-CD2 4.01Å; F20-W35 HydrophobicContact CB-CE3 3.8Å; F20-W35 HydrophobicContact CB-CG 4.08Å; F20-L54 VanDerWaalsContact CD1-O 3.26Å; F20-L54 WeakPolarHBondContact CD1-O 2.9Å; F20-L54 WeakPolarHBondContact CE1-O 3.12Å; F20-P56 HydrophobicContact CD1-CB 4.2Å; F20-P56 HydrophobicContact CD2-CB 4.09Å; F20-P56 HydrophobicContact CE1-CB 4.14Å; F20-P56 HydrophobicContact CE2-CB 4.02Å; F20-P56 HydrophobicContact CG-CB 4.18Å; F20-P56 HydrophobicContact CZ-CB 4.04Å; F20-Y60 HydrophobicContact CE1-CE2 4.24Å; F20-Y60 AromaticContact CZ-CD2 3.75Å; F20-Y60 HydrophobicContact CZ-CD2 3.75Å; F20-Y60 AromaticContact CZ-CE2 3.87Å; F20-Y60 HydrophobicContact CZ-CE2 3.87Å; F20-Y60 HydrophobicContact CZ-CG 4.18Å
21	I	94.7	Very high	92.5	Very high	56 Å²	56	102.1 Å²	102.1	29%	0.287	49%	0.486	S	S	.	.			trans	-106.8	152.5	-178.1	62.1	171.9	0	0	0	110.2	H23 C33 W35 I53	I21-H23 PolarHBondContact O-N 2.84Å; I21-C33 WeakPolarHBondContact CA-O 3.34Å; I21-C33 HydrophobicContact CG2-CB 4.25Å; I21-W35 WeakPolarHBondContact O-CZ3 2.99Å; I21-I53 HydrophobicContact CD1-CD1 4.14Å; I21-I53 HydrophobicContact CG1-CD1 4.04Å; I21-I53 HydrophobicContact CG1-CG2 4.33Å
22	W	93.9	Very high	92.7	Very high	82 Å²	82	100.7 Å²	100.7	31%	0.311	48%	0.48	S	S	.	.			trans	-63.3	134.4	171.5	-158.6	-20.1	0	0	0	109.8	Q24 S25 I31 N34 W36	W22-Q24 PolarHBondContact O-N 3.19Å; W22-S25 WeakPolarHBondContact O-CB 3.12Å; W22-S25 PolarHBondContact O-N 3.49Å; W22-S25 VanDerWaalsContact O-N 3.12Å; W22-S25 PolarHBondContact O-OG 3.12Å; W22-S25 VanDerWaalsContact O-OG 3.04Å; W22-I31 HydrophobicContact CB-CG2 3.97Å; W22-I31 HydrophobicContact CD2-CG2 3.51Å; W22-I31 HydrophobicContact CE3-CG2 3.49Å; W22-I31 VanDerWaalsContact CE3-CG2 3.49Å; W22-I31 HydrophobicContact CG-CG2 3.77Å; W22-I31 HydrophobicContact CZ3-CG2 4.1Å; W22-N34 WeakPolarHBondContact CB-O 3.26Å; W22-W36 HydrophobicContact CD2-CB 3.8Å; W22-W36 AromaticContact CE2-CE3 3.91Å; W22-W36 HydrophobicContact CE3-CB 4.22Å; W22-W36 HydrophobicContact CG-CB 4.1Å; W22-W36 HydrophobicContact CZ2-CB 4.26Å; W22-W36 HydrophobicContact CZ2-CD2 4.03Å; W22-W36 AromaticContact CZ2-CE3 3.73Å; W22-W36 HydrophobicContact CZ2-CE3 3.73Å; W22-W36 HydrophobicContact CZ2-CG 4.28Å; W22-W36 HydrophobicContact CZ2-CZ3 4.4Å; W22-W36 AromaticContact NE1-CE3 3.82Å
23	H	93.2	Very high	92.9	Very high	32 Å²	32	101.9 Å²	101.9	15%	0.148	49%	0.492	C	S	.	.	T	Hydrogen-bonded Turn	trans	-46	125.7	165.1	-176.8	-115.3	0	0	0	111.9	I21 S25 N43 V45	I21-H23 PolarHBondContact O-N 2.84Å; H23-S25 VanDerWaalsContact C-N 3.35Å; H23-N43 PolarHBondContact ND1-ND2 3.26Å; H23-V45 HydrophobicContact CB-CG2 4.3Å; H23-V45 WeakPolarHBondContact CD2-CG2 3.22Å
24	Q	91.9	Very high	93.1	Very high	66 Å²	66	103.4 Å²	103.4	31%	0.308	50%	0.497	S	S	.	.	T	Hydrogen-bonded Turn	trans	73.2	7.9	-179.2	-43.2	-178.4	-11	0	0	116.7	W22 D26 R27 C28 I31	W22-Q24 PolarHBondContact O-N 3.19Å; Q24-D26 VanDerWaalsContact CA-OD1 3.29Å; Q24-D26 WeakPolarHBondContact CA-OD1 3.2Å; Q24-D26 PolarHBondContact O-N 3.48Å; Q24-R27 VanDerWaalsContact CG-NH2 3.3Å; Q24-R27 PolarHBondContact O-N 2.79Å; Q24-R27 VanDerWaalsContact O-N 3.07Å; Q24-C28 PolarHBondContact O-N 3.39Å; Q24-C28 VanDerWaalsContact O-N 3.07Å; Q24-I31 HydrophobicContact CB-CD1 4.34Å
25	S	92.9	Very high	93.2	Very high	13 Å²	13	101.1 Å²	101.1	9%	0.091	49%	0.485	C	S	.	.	T	Hydrogen-bonded Turn	trans	-63.7	-20.7	174.2	66.3	0	0	0	0	113.4	W22 H23	W22-S25 WeakPolarHBondContact O-CB 3.12Å; W22-S25 PolarHBondContact O-N 3.49Å; W22-S25 VanDerWaalsContact O-N 3.12Å; W22-S25 PolarHBondContact O-OG 3.12Å; W22-S25 VanDerWaalsContact O-OG 3.04Å; H23-S25 VanDerWaalsContact C-N 3.35Å
26	D	91	Very high	93.2	Very high	120 Å²	120	102.2 Å²	102.2	64%	0.642	49%	0.486	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.4	-29.1	173.8	58.4	-53.4	0	0	0	113.1	Q24	Q24-D26 VanDerWaalsContact CA-OD1 3.29Å; Q24-D26 WeakPolarHBondContact CA-OD1 3.2Å; Q24-D26 PolarHBondContact O-N 3.48Å
27	R	93	Very high	93.2	Very high	169 Å²	169	104.3 Å²	104.3	64%	0.638	50%	0.497	S	S	*	.	T	Hydrogen-bonded Turn	trans	-98	-31.7	-176.6	-61.8	-171.7	-65.3	179.7	4.5	113.4	Q24	Q24-R27 VanDerWaalsContact CG-NH2 3.3Å; Q24-R27 PolarHBondContact O-N 2.79Å; Q24-R27 VanDerWaalsContact O-N 3.07Å
28	C	90.8	Very high	93.3	Very high	50 Å²	50	98.4 Å²	98.4	34%	0.338	46%	0.461	S	S	.	.			trans	-116.3	111.6	-174.1	-63.6	0	0	0	0	111	Q24 K30 I31	Q24-C28 PolarHBondContact O-N 3.39Å; Q24-C28 VanDerWaalsContact O-N 3.07Å; C28-K30 PolarHBondContact O-N 3.43Å; C28-K30 VanDerWaalsContact O-N 3.14Å; C28-I31 HydrophobicContact CB-CB 4.26Å; C28-I31 HydrophobicContact CB-CD1 3.76Å; C28-I31 HydrophobicContact CB-CG1 3.79Å; C28-I31 PolarHBondContact O-N 3.22Å
29	V	92.9	Very high	93.3	Very high	153 Å²	153	94.8 Å²	94.8	93%	0.927	46%	0.457	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.5	-29.9	179.1	-177.4	0	0	0	0	112.9	I31	V29-I31 PolarHBondContact O-N 3.18Å
30	K	94.4	Very high	93.2	Very high	206 Å²	206	89.7 Å²	89.7	90%	0.896	44%	0.444	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66	-26.6	176.4	-63	-178.8	-179	179.3	0	112.7	C28	C28-K30 PolarHBondContact O-N 3.43Å; C28-K30 VanDerWaalsContact O-N 3.14Å
31	I	92.7	Very high	93.1	Very high	40 Å²	40	93.2 Å²	93.2	21%	0.205	46%	0.464	C	S	.	.	S	Bend	trans	-90	112.7	-177.2	-57.1	-178.8	0	0	0	108.6	W22 Q24 C28 V29	W22-I31 HydrophobicContact CB-CG2 3.97Å; W22-I31 HydrophobicContact CD2-CG2 3.51Å; W22-I31 HydrophobicContact CE3-CG2 3.49Å; W22-I31 VanDerWaalsContact CE3-CG2 3.49Å; W22-I31 HydrophobicContact CG-CG2 3.77Å; W22-I31 HydrophobicContact CZ3-CG2 4.1Å; Q24-I31 HydrophobicContact CB-CD1 4.34Å; C28-I31 HydrophobicContact CB-CB 4.26Å; C28-I31 HydrophobicContact CB-CD1 3.76Å; C28-I31 HydrophobicContact CB-CG1 3.79Å; C28-I31 PolarHBondContact O-N 3.22Å; V29-I31 PolarHBondContact O-N 3.18Å
32	K	93.8	Very high	93	Very high	156 Å²	156	93.2 Å²	93.2	68%	0.678	48%	0.477	S	S	*	.			trans	-69.1	149.7	177.3	-62.6	-179.2	-178.6	178.3	0	110.8	N34	K32-N34 PolarHBondContact O-N 3.02Å
33	C	93.8	Very high	92.9	Very high	75 Å²	75	90.5 Å²	90.5	51%	0.507	47%	0.469	S	S	.	.	S	Bend	trans	-71.3	13.1	177.7	-60.6	0	0	0	0	114.8	I21	I21-C33 WeakPolarHBondContact CA-O 3.34Å; I21-C33 HydrophobicContact CG2-CB 4.25Å
34	N	94.3	Very high	93	Very high	120 Å²	120	96.4 Å²	96.4	64%	0.642	49%	0.49	S	S	*	.	S	Bend	trans	-78.2	133.6	178.3	-66.9	22.6	0	0	0	109.3	W22 K32 W36	W22-N34 WeakPolarHBondContact CB-O 3.26Å; K32-N34 PolarHBondContact O-N 3.02Å; N34-W36 PolarHBondContact O-N 3.13Å
35	W	94.4	Very high	93	Very high	71 Å²	71	93.3 Å²	93.3	27%	0.269	48%	0.476	S	S	.	.			trans	-58.7	130.2	-179.2	176.9	-102.8	0	0	0	112.2	F20 I21 V45 I53 M55 P56	F20-W35 HydrophobicContact CB-CB 3.99Å; F20-W35 HydrophobicContact CB-CD2 4.01Å; F20-W35 HydrophobicContact CB-CE3 3.8Å; F20-W35 HydrophobicContact CB-CG 4.08Å; I21-W35 WeakPolarHBondContact O-CZ3 2.99Å; W35-V45 HydrophobicContact CH2-CG1 4.29Å; W35-I53 HydrophobicContact CZ3-CG2 4.31Å; W35-M55 HydrophobicContact CH2-CB 4.1Å; W35-M55 HydrophobicContact CH2-CE 4.48Å; W35-M55 HydrophobicContact CH2-CG 4.03Å; W35-M55 HydrophobicContact CZ2-CB 4.08Å; W35-M55 HydrophobicContact CZ2-CE 4.31Å; W35-M55 HydrophobicContact CZ2-CG 4.27Å; W35-P56 HydrophobicContact CD2-CG 4.05Å; W35-P56 HydrophobicContact CG-CG 4.17Å; W35-P56 HydrophobicContact CZ2-CG 4.02Å
36	W	93.4	Very high	93.1	Very high	141 Å²	141	98 Å²	98	53%	0.534	49%	0.492	S	S	.	.			trans	-134.2	139.5	169.6	-163.3	73.4	0	0	0	109.7	W22 N34 P38	W22-W36 HydrophobicContact CD2-CB 3.8Å; W22-W36 AromaticContact CE2-CE3 3.91Å; W22-W36 HydrophobicContact CE3-CB 4.22Å; W22-W36 HydrophobicContact CG-CB 4.1Å; W22-W36 HydrophobicContact CZ2-CB 4.26Å; W22-W36 HydrophobicContact CZ2-CD2 4.03Å; W22-W36 AromaticContact CZ2-CE3 3.73Å; W22-W36 HydrophobicContact CZ2-CE3 3.73Å; W22-W36 HydrophobicContact CZ2-CG 4.28Å; W22-W36 HydrophobicContact CZ2-CZ3 4.4Å; W22-W36 AromaticContact NE1-CE3 3.82Å; N34-W36 PolarHBondContact O-N 3.13Å; W36-P38 VanDerWaalsContact O-CD 3.24Å; W36-P38 WeakPolarHBondContact O-CD 3.41Å
37	K	93.1	Very high	93.2	Very high	114 Å²	114	98.7 Å²	98.7	50%	0.496	49%	0.485	S	S	.	.			trans	-76	114.4	-179.3	-175.6	81.1	-178.7	-179	0	108.5	M55	K37-M55 HydrophobicContact CD-CE 3.51Å; K37-M55 HydrophobicContact CG-CE 4.47Å; K37-M55 PolarHBondContact NZ-SD 2.72Å
38	P	93.8	Very high	93.2	Very high	5 Å²	5	95.5 Å²	95.5	3%	0.032	48%	0.484	C	S	.	.			trans	-65.2	141.5	174.9	26.7	-33.2	0	0	0	110.2	W36 N43 V45 W46 M55	W36-P38 VanDerWaalsContact O-CD 3.24Å; W36-P38 WeakPolarHBondContact O-CD 3.41Å; P38-N43 HydrophobicContact CB-CB 4.35Å; P38-N43 VanDerWaalsContact CB-ND2 3.33Å; P38-N43 WeakPolarHBondContact CB-ND2 3.06Å; P38-V45 HydrophobicContact CG-CB 4.08Å; P38-V45 HydrophobicContact CG-CG1 3.9Å; P38-W46 HydrophobicContact CB-CB 4.37Å; P38-W46 HydrophobicContact CG-CB 4.18Å; P38-M55 HydrophobicContact CG-CE 3.77Å
39	S	92.7	Very high	93.3	Very high	92 Å²	92	98.2 Å²	98.2	64%	0.643	49%	0.491	S	S	*	.			trans	-115.2	-20.5	-177.3	-166.4	0	0	0	0	113.8
40	S	92.1	Very high	93.3	Very high	74 Å²	74	101 Å²	101	52%	0.517	49%	0.49	S	S	.	.			trans	-66.4	135.5	-174.5	172	0	0	0	0	112.9	G42 N43	S40-G42 PolarHBondContact O-N 3.16Å; S40-G42 PolarHBondContact OG-N 3.43Å; S40-N43 WeakPolarHBondContact O-CB 3.48Å; S40-N43 PolarHBondContact O-N 3.08Å
41	I	91.7	Very high	93.2	Very high	122 Å²	122	95.1 Å²	95.1	63%	0.626	49%	0.489	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.5	-31	178.8	-162.5	159.4	0	0	0	112.7	N43 W46 R47	I41-N43 VanDerWaalsContact C-N 3.27Å; I41-N43 PolarHBondContact O-N 3.31Å; I41-W46 HydrophobicContact CG1-CZ3 4.12Å; I41-R47 PolarHBondContact O-NE 3.25Å; I41-R47 PolarHBondContact O-NH2 2.87Å
42	G	93.4	Very high	93.2	Very high	56 Å²	56	96.3 Å²	96.3	58%	0.577	49%	0.493	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80	-6.1	176.6	0	0	0	0	0	113.9	S40 R44	S40-G42 PolarHBondContact O-N 3.16Å; S40-G42 PolarHBondContact OG-N 3.43Å; G42-R44 PolarHBondContact O-N 3.46Å
43	N	92.9	Very high	93.1	Very high	26 Å²	26	91 Å²	91	14%	0.139	47%	0.472	C	S	.	.			trans	-77.5	124.3	-173.2	-169.4	-50.7	0	0	0	111.7	H23 P38 S40 I41 V45 W46 R47	H23-N43 PolarHBondContact ND1-ND2 3.26Å; P38-N43 HydrophobicContact CB-CB 4.35Å; P38-N43 VanDerWaalsContact CB-ND2 3.33Å; P38-N43 WeakPolarHBondContact CB-ND2 3.06Å; S40-N43 WeakPolarHBondContact O-CB 3.48Å; S40-N43 PolarHBondContact O-N 3.08Å; I41-N43 VanDerWaalsContact C-N 3.27Å; I41-N43 PolarHBondContact O-N 3.31Å; N43-V45 PolarHBondContact O-N 3.42Å; N43-V45 WeakPolarHBondContact OD1-CA 3.43Å; N43-V45 WeakPolarHBondContact OD1-CB 3.36Å; N43-V45 PolarHBondContact OD1-N 3.42Å; N43-W46 HydrophobicContact CB-CB 4Å; N43-W46 PolarHBondContact O-N 3.01Å; N43-W46 PolarHBondContact OD1-N 2.75Å; N43-R47 PolarHBondContact O-N 2.88Å
44	R	93.3	Very high	93	Very high	155 Å²	155	91.5 Å²	91.5	59%	0.585	47%	0.469	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.6	-34.9	-179.3	-69.9	-177.3	154.4	-153.9	-6	113.9	G42 T48 F49 Q52	G42-R44 PolarHBondContact O-N 3.46Å; R44-T48 PolarHBondContact O-N 3.23Å; R44-F49 HydrophobicContact CB-CD2 3.85Å; R44-F49 HydrophobicContact CG-CD2 3.99Å; R44-F49 HydrophobicContact CG-CE2 4.31Å; R44-F49 WeakPolarHBondContact O-CD2 3.31Å; R44-F49 PolarHBondContact O-N 3.36Å; R44-Q52 HydrophobicContact CB-CG 4.1Å
45	V	93.6	Very high	93	Very high	1 Å²	1	86.9 Å²	86.9	1%	0.006	44%	0.444	C	S	.	.	T	Hydrogen-bonded Turn	trans	-70.9	-36.9	177	176.3	0	0	0	0	110.8	H23 W35 P38 N43 R47 T48 Q52 I53 M55	H23-V45 HydrophobicContact CB-CG2 4.3Å; H23-V45 WeakPolarHBondContact CD2-CG2 3.22Å; W35-V45 HydrophobicContact CH2-CG1 4.29Å; P38-V45 HydrophobicContact CG-CB 4.08Å; P38-V45 HydrophobicContact CG-CG1 3.9Å; N43-V45 PolarHBondContact O-N 3.42Å; N43-V45 WeakPolarHBondContact OD1-CA 3.43Å; N43-V45 WeakPolarHBondContact OD1-CB 3.36Å; N43-V45 PolarHBondContact OD1-N 3.42Å; V45-R47 VanDerWaalsContact C-N 3.34Å; V45-R47 PolarHBondContact O-N 3.18Å; V45-T48 PolarHBondContact O-N 3.13Å; V45-T48 VanDerWaalsContact O-N 3.16Å; V45-Q52 HydrophobicContact CG2-CB 4.07Å; V45-I53 WeakPolarHBondContact CG1-O 3.43Å; V45-I53 HydrophobicContact CG2-CB 4.42Å; V45-M55 HydrophobicContact CG1-CE 4.24Å; V45-M55 HydrophobicContact CG1-CG 4.02Å
46	W	93.7	Very high	93.1	Very high	113 Å²	113	86.1 Å²	86.1	43%	0.428	45%	0.448	S	S	.	.	T	Hydrogen-bonded Turn	trans	-61.7	-42.6	175.4	178.9	75.8	0	0	0	111.6	P38 I41 N43 T48	P38-W46 HydrophobicContact CB-CB 4.37Å; P38-W46 HydrophobicContact CG-CB 4.18Å; I41-W46 HydrophobicContact CG1-CZ3 4.12Å; N43-W46 HydrophobicContact CB-CB 4Å; N43-W46 PolarHBondContact O-N 3.01Å; N43-W46 PolarHBondContact OD1-N 2.75Å; W46-T48 PolarHBondContact O-N 3.2Å
47	R	93.9	Very high	93.1	Very high	134 Å²	134	83.9 Å²	83.9	51%	0.506	45%	0.447	S	S	.	.	T	Hydrogen-bonded Turn	trans	-77.1	-1	176	-60	-166.6	-169.6	-170.6	1.6	114.8	I41 N43 V45 F49	I41-R47 PolarHBondContact O-NE 3.25Å; I41-R47 PolarHBondContact O-NH2 2.87Å; N43-R47 PolarHBondContact O-N 2.88Å; V45-R47 VanDerWaalsContact C-N 3.34Å; V45-R47 PolarHBondContact O-N 3.18Å; R47-F49 HydrophobicContact CB-CD2 3.83Å; R47-F49 HydrophobicContact CB-CE2 3.65Å; R47-F49 HydrophobicContact CB-CZ 4.47Å; R47-F49 HydrophobicContact CG-CE2 4.24Å; R47-F49 PolarHBondContact O-N 3.34Å
48	T	92.4	Very high	93.1	Very high	101 Å²	101	85.1 Å²	85.1	62%	0.62	46%	0.464	S	S	*	.	T	Hydrogen-bonded Turn	trans	58.2	41.6	178.5	-44.9	0	0	0	0	113.5	R44 V45 W46	R44-T48 PolarHBondContact O-N 3.23Å; V45-T48 PolarHBondContact O-N 3.13Å; V45-T48 VanDerWaalsContact O-N 3.16Å; W46-T48 PolarHBondContact O-N 3.2Å
49	F	93.3	Very high	93.1	Very high	108 Å²	108	87.2 Å²	87.2	47%	0.474	49%	0.486	S	S	.	.			trans	-63.9	144.8	172.8	-75.2	-79.6	0	0	0	111.8	R44 R47 Q52	R44-F49 HydrophobicContact CB-CD2 3.85Å; R44-F49 HydrophobicContact CG-CD2 3.99Å; R44-F49 HydrophobicContact CG-CE2 4.31Å; R44-F49 WeakPolarHBondContact O-CD2 3.31Å; R44-F49 PolarHBondContact O-N 3.36Å; R47-F49 HydrophobicContact CB-CD2 3.83Å; R47-F49 HydrophobicContact CB-CE2 3.65Å; R47-F49 HydrophobicContact CB-CZ 4.47Å; R47-F49 HydrophobicContact CG-CE2 4.24Å; R47-F49 PolarHBondContact O-N 3.34Å; F49-Q52 HydrophobicContact CB-CG 4.37Å; F49-Q52 PolarHBondContact O-N 3.38Å
50	K	93.1	Very high	93.2	Very high	210 Å²	210	86 Å²	86	91%	0.913	47%	0.468	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.4	148.4	174.7	-65.5	-175.9	179.4	179.5	0	111	Q52	K50-Q52 PolarHBondContact O-N 3.45Å
51	G	91.8	Very high	93.1	Very high	84 Å²	84	84.6 Å²	84.6	87%	0.866	47%	0.465	S	S	*	.	T	Hydrogen-bonded Turn	trans	78.8	-3.8	179.7	0	0	0	0	0	115.3
52	Q	92.6	Very high	93.1	Very high	65 Å²	65	80.9 Å²	80.9	30%	0.304	45%	0.447	S	S	.	.	S	Bend	trans	-93.6	171.8	175.7	-64.7	-60.9	-31.1	0	0	112.6	R44 V45 F49 K50 L54	R44-Q52 HydrophobicContact CB-CG 4.1Å; V45-Q52 HydrophobicContact CG2-CB 4.07Å; F49-Q52 HydrophobicContact CB-CG 4.37Å; F49-Q52 PolarHBondContact O-N 3.38Å; K50-Q52 PolarHBondContact O-N 3.45Å; Q52-L54 PolarHBondContact O-N 2.96Å
53	I	92.3	Very high	92.8	Very high	44 Å²	44	87.8 Å²	87.8	23%	0.226	46%	0.461	C	S	.	.	P	Polyproline II helix	trans	-59.8	123.7	176.3	-58.9	161.4	0	0	0	109.2	I21 W35 V45	I21-I53 HydrophobicContact CD1-CD1 4.14Å; I21-I53 HydrophobicContact CG1-CD1 4.04Å; I21-I53 HydrophobicContact CG1-CG2 4.33Å; W35-I53 HydrophobicContact CZ3-CG2 4.31Å; V45-I53 WeakPolarHBondContact CG1-O 3.43Å; V45-I53 HydrophobicContact CG2-CB 4.42Å
54	L	92.4	Very high	92.5	Very high	86 Å²	86	95.3 Å²	95.3	45%	0.45	49%	0.492	S	S	.	.	P	Polyproline II helix	trans	-69	139.4	178	-64.3	171.9	0	0	0	111.2	F20 Q52	F20-L54 VanDerWaalsContact CD1-O 3.26Å; F20-L54 WeakPolarHBondContact CD1-O 2.9Å; F20-L54 WeakPolarHBondContact CE1-O 3.12Å; Q52-L54 PolarHBondContact O-N 2.96Å
55	M	94	Very high	92.3	Very high	23 Å²	23	88.5 Å²	88.5	11%	0.113	47%	0.468	C	S	.	.	P	Polyproline II helix	trans	-80.5	150	174.6	-50.7	-175.3	109	0	0	111.3	W35 K37 P38 V45 Y60	W35-M55 HydrophobicContact CH2-CB 4.1Å; W35-M55 HydrophobicContact CH2-CE 4.48Å; W35-M55 HydrophobicContact CH2-CG 4.03Å; W35-M55 HydrophobicContact CZ2-CB 4.08Å; W35-M55 HydrophobicContact CZ2-CE 4.31Å; W35-M55 HydrophobicContact CZ2-CG 4.27Å; K37-M55 HydrophobicContact CD-CE 3.51Å; K37-M55 HydrophobicContact CG-CE 4.47Å; K37-M55 PolarHBondContact NZ-SD 2.72Å; P38-M55 HydrophobicContact CG-CE 3.77Å; V45-M55 HydrophobicContact CG1-CE 4.24Å; V45-M55 HydrophobicContact CG1-CG 4.02Å; M55-Y60 WeakPolarHBondContact O-CE2 3.45Å
56	P	95.3	Very high	92.1	Very high	54 Å²	54	94.3 Å²	94.3	35%	0.351	49%	0.493	S	S	.	.	P	Polyproline II helix	trans	-68.5	138.2	170.8	29	-30.9	0	0	0	110	F20 W35	F20-P56 HydrophobicContact CD1-CB 4.2Å; F20-P56 HydrophobicContact CD2-CB 4.09Å; F20-P56 HydrophobicContact CE1-CB 4.14Å; F20-P56 HydrophobicContact CE2-CB 4.02Å; F20-P56 HydrophobicContact CG-CB 4.18Å; F20-P56 HydrophobicContact CZ-CB 4.04Å; W35-P56 HydrophobicContact CD2-CG 4.05Å; W35-P56 HydrophobicContact CG-CG 4.17Å; W35-P56 HydrophobicContact CZ2-CG 4.02Å
57	N	93.8	Very high	91.8	Very high	95 Å²	95	95.4 Å²	95.4	51%	0.508	50%	0.503	S	S	.	.			trans	-142.7	167.9	175.7	67.5	31.2	0	0	0	109.6	G59 Y60	N57-G59 PolarHBondContact O-N 2.97Å; N57-G59 WeakPolarHBondContact OD1-CA 3.29Å; N57-G59 PolarHBondContact OD1-N 2.65Å; N57-Y60 PolarHBondContact O-N 2.99Å; N57-Y60 WeakPolarHBondContact OD1-CD2 3.26Å; N57-Y60 VanDerWaalsContact OD1-CE2 3.24Å; N57-Y60 WeakPolarHBondContact OD1-CE2 3.45Å; N57-Y60 PolarHBondContact OD1-N 2.89Å
58	T	93.3	Very high	91.4	Very high	139 Å²	139	89.7 Å²	89.7	85%	0.853	48%	0.482	S	S	*	.	G	3₁₀ helix	trans	-62.1	-25.5	179.6	-50.5	0	0	0	0	112.8	Y60 G61	T58-Y60 PolarHBondContact O-N 3.45Å; T58-G61 PolarHBondContact O-N 3.19Å
59	G	94.1	Very high	91	Very high	49 Å²	49	85.8 Å²	85.8	51%	0.505	46%	0.458	S	S	.	.	G	3₁₀ helix	trans	-60.1	-27.9	-179.7	0	0	0	0	0	114.2	K15 N57 G61	K15-G59 VanDerWaalsContact CD-O 3.27Å; K15-G59 WeakPolarHBondContact CD-O 3.13Å; K15-G59 PolarHBondContact NZ-O 2.79Å; N57-G59 PolarHBondContact O-N 2.97Å; N57-G59 WeakPolarHBondContact OD1-CA 3.29Å; N57-G59 PolarHBondContact OD1-N 2.65Å; G59-G61 VanDerWaalsContact C-N 3.31Å; G59-G61 PolarHBondContact O-N 3.38Å
60	Y	93.8	Very high	90.6	Very high	67 Å²	67	85.9 Å²	85.9	26%	0.263	47%	0.47	S	S	.	.	G	3₁₀ helix	trans	-77.9	-11	175.9	-60.2	-71.3	0	0	0	114.4	R16 F20 M55 N57 T58	R16-Y60 HydrophobicContact CB-CD1 4.03Å; R16-Y60 HydrophobicContact CB-CE1 4.42Å; F20-Y60 HydrophobicContact CE1-CE2 4.24Å; F20-Y60 AromaticContact CZ-CD2 3.75Å; F20-Y60 HydrophobicContact CZ-CD2 3.75Å; F20-Y60 AromaticContact CZ-CE2 3.87Å; F20-Y60 HydrophobicContact CZ-CE2 3.87Å; F20-Y60 HydrophobicContact CZ-CG 4.18Å; M55-Y60 WeakPolarHBondContact O-CE2 3.45Å; N57-Y60 PolarHBondContact O-N 2.99Å; N57-Y60 WeakPolarHBondContact OD1-CD2 3.26Å; N57-Y60 VanDerWaalsContact OD1-CE2 3.24Å; N57-Y60 WeakPolarHBondContact OD1-CE2 3.45Å; N57-Y60 PolarHBondContact OD1-N 2.89Å; T58-Y60 PolarHBondContact O-N 3.45Å
61	G	90.5	Very high	90	Very high	45 Å²	45	78.2 Å²	78.2	46%	0.464	44%	0.442	S	S	.	.			trans	-69.8	146.1	-179.5	0	0	0	0	0	113.3	K15 T58 G59	K15-G61 PolarHBondContact NZ-O 2.87Å; T58-G61 PolarHBondContact O-N 3.19Å; G59-G61 VanDerWaalsContact C-N 3.31Å; G59-G61 PolarHBondContact O-N 3.38Å
62	N	90.9	Very high	89.5	Confident	43 Å²	43	74.4 Å²	74.4	23%	0.23	40%	0.404	C	S	.	.			trans	-120.3	130.8	171.6	-69.4	-18.9	0	0	0	109.5	V13 K15 K66	V13-N62 PolarHBondContact O-ND2 3.22Å; K15-N62 VanDerWaalsContact CE-OD1 3.3Å; K15-N62 WeakPolarHBondContact CE-OD1 3.12Å; N62-K66 WeakPolarHBondContact O-CB 3.4Å
63	K	88.5	Confident	88.9	Confident	201 Å²	201	72.1 Å²	72.1	87%	0.874	39%	0.393	S	S	*	.	S	Bend	trans	-86.6	-50.6	-179.9	-65	-175.9	179.4	-177.8	0	112.7
64	K	86.8	Confident	88.5	Confident	185 Å²	185	75.1 Å²	75.1	80%	0.804	40%	0.401	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.1	-39.4	-171.8	-64.2	-174.7	178.6	-177.3	0	114.3
65	T	88.8	Confident	88.2	Confident	12 Å²	12	76.4 Å²	76.4	7%	0.074	40%	0.403	C	S	.	.	T	Hydrogen-bonded Turn	trans	-109	25.1	-175.6	67.5	0	0	0	0	112	P10 I12	P10-T65 HydrophobicContact CB-CG2 4.35Å; P10-T65 HydrophobicContact CG-CG2 4.36Å; I12-T65 HydrophobicContact CG1-CG2 4.5Å
66	K	88.5	Confident	87.8	Confident	122 Å²	122	78.5 Å²	78.5	53%	0.53	41%	0.412	S	S	.	.	T	Hydrogen-bonded Turn	trans	-65.3	134.8	177.3	-154.3	-167.5	177.9	-165	0	108.1	N62 M68	N62-K66 WeakPolarHBondContact O-CB 3.4Å; K66-M68 PolarHBondContact O-N 3.16Å
67	H	87	Confident	87.4	Confident	136 Å²	136	80.2 Å²	80.2	63%	0.63	42%	0.418	S	S	*	.	T	Hydrogen-bonded Turn	trans	60.3	4.7	-179.8	-50.8	-71.9	0	0	0	116.8	P69	H67-P69 WeakPolarHBondContact O-CD 3Å
68	M	87	Confident	87.2	Confident	15 Å²	15	75.7 Å²	75.7	7%	0.074	39%	0.393	C	S	.	.			trans	-79.2	123.2	177.9	-174	177.5	-93.9	0	0	111.4	P10 I12 K66 G72	P10-M68 HydrophobicContact CG-CE 3.89Å; P10-M68 HydrophobicContact CG-SD 3.76Å; I12-M68 HydrophobicContact CD1-CG 4.17Å; I12-M68 HydrophobicContact CD1-SD 4.35Å; I12-M68 HydrophobicContact CG1-SD 4.4Å; K66-M68 PolarHBondContact O-N 3.16Å; M68-G72 WeakPolarHBondContact CE-O 3.3Å
69	P	83.9	Confident	87	Confident	19 Å²	19	73.1 Å²	73.1	12%	0.123	37%	0.371	C	S	.	.			trans	-75.2	167.5	169.8	33.2	-35.5	0	0	0	112.2	I12 H67 S71 G72 F73 K75	I12-P69 WeakPolarHBondContact CD1-O 3.49Å; H67-P69 WeakPolarHBondContact O-CD 3Å; P69-S71 WeakPolarHBondContact CG-OG 3.46Å; P69-S71 PolarHBondContact O-N 2.89Å; P69-S71 VanDerWaalsContact O-N 3.13Å; P69-G72 PolarHBondContact O-N 3.48Å; P69-F73 WeakPolarHBondContact CD-O 3.27Å; P69-F73 WeakPolarHBondContact CG-O 3.25Å; P69-K75 HydrophobicContact CG-CG 4.12Å
70	P	85.3	Confident	86.7	Confident	109 Å²	109	75 Å²	75	71%	0.708	37%	0.37	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.9	-20.8	178.7	-21.3	32.5	0	0	0	114.8	K9 G72	K9-P70 WeakPolarHBondContact CE-O 3.31Å; K9-P70 PolarHBondContact NZ-O 2.98Å; P70-G72 PolarHBondContact O-N 3.22Å
71	S	80.4	Confident	86.2	Confident	49 Å²	49	75.1 Å²	75.1	34%	0.343	38%	0.377	S	S	.	.	T	Hydrogen-bonded Turn	trans	-64.8	-26.8	174.2	57.5	0	0	0	0	112.2	P69	P69-S71 WeakPolarHBondContact CG-OG 3.46Å; P69-S71 PolarHBondContact O-N 2.89Å; P69-S71 VanDerWaalsContact O-N 3.13Å
72	G	79.6	Confident	86	Confident	5 Å²	5	81.5 Å²	81.5	5%	0.052	39%	0.392	C	S	.	.	S	Bend	trans	92.2	0.1	179.5	0	0	0	0	0	114.7	M68 P69 P70	M68-G72 WeakPolarHBondContact CE-O 3.3Å; P69-G72 PolarHBondContact O-N 3.48Å; P70-G72 PolarHBondContact O-N 3.22Å
73	F	81.7	Confident	85.5	Confident	16 Å²	16	82 Å²	82	7%	0.07	39%	0.393	C	S	.	.	S	Bend	trans	-100.2	142.5	175.5	-61.6	-72.7	0	0	0	111.5	L4 P6 P69 S93 C95 P118	L4-F73 WeakPolarHBondContact O-CZ 3.38Å; P6-F73 HydrophobicContact CB-CD1 4.14Å; P6-F73 HydrophobicContact CB-CE1 3.63Å; P6-F73 HydrophobicContact CB-CE2 4.41Å; P6-F73 HydrophobicContact CB-CZ 3.78Å; P6-F73 HydrophobicContact CG-CE1 4.46Å; P6-F73 HydrophobicContact CG-CE2 4.39Å; P6-F73 HydrophobicContact CG-CZ 4.17Å; P69-F73 WeakPolarHBondContact CD-O 3.27Å; P69-F73 WeakPolarHBondContact CG-O 3.25Å; F73-S93 VanDerWaalsContact CD1-O 3.26Å; F73-S93 WeakPolarHBondContact CD1-O 3.4Å; F73-C95 HydrophobicContact CB-CB 3.68Å; F73-C95 HydrophobicContact CG-CB 4.45Å; F73-P118 HydrophobicContact CD2-CG 4.08Å; F73-P118 HydrophobicContact CE1-CG 4.03Å; F73-P118 HydrophobicContact CE2-CB 3.95Å; F73-P118 HydrophobicContact CE2-CG 3.42Å; F73-P118 VanDerWaalsContact CE2-CG 3.42Å; F73-P118 HydrophobicContact CZ-CB 4.34Å; F73-P118 HydrophobicContact CZ-CG 3.38Å
74	W	83.6	Confident	85.1	Confident	107 Å²	107	73.1 Å²	73.1	41%	0.405	36%	0.356	S	S	.	.	P	Polyproline II helix	trans	-74.5	135	177	-73.7	58.8	0	0	0	110.2	P94 C95	W74-P94 CarbonylContact O-C 3.51Å; W74-P94 WeakPolarHBondContact O-CA 3.46Å; W74-P94 VanDerWaalsContact O-CB 3.26Å; W74-P94 WeakPolarHBondContact O-CB 3.08Å; W74-C95 PolarHBondContact O-N 3.35Å
75	K	85.1	Confident	84.6	Confident	114 Å²	114	70.9 Å²	70.9	50%	0.496	35%	0.348	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.5	130.3	-179.8	-62.7	177.8	170.5	-135.3	0	110.5	P69 C95 E97	P69-K75 HydrophobicContact CG-CG 4.12Å; K75-C95 WeakPolarHBondContact CA-O 3.43Å; K75-E97 WeakPolarHBondContact CD-OE1 3.48Å; K75-E97 WeakPolarHBondContact CE-OE1 3.33Å; K75-E97 IonicContact NZ-OE1 3.9Å; K75-E97 PolarHBondContact NZ-OE1 3.33Å; K75-E97 IonicContact NZ-OE2 2.65Å
76	F	86	Confident	83.9	Confident	67 Å²	67	74.6 Å²	74.6	29%	0.294	37%	0.37	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.7	122.4	171.6	-178.4	-102.9	0	0	0	109	V78 P87 P94 C95 A96 E97	F76-V78 HydrophobicContact CD1-CG2 3.65Å; F76-V78 HydrophobicContact CE1-CG2 3.86Å; F76-P87 HydrophobicContact CD1-CG 3.69Å; F76-P87 HydrophobicContact CE1-CG 3.76Å; F76-P87 HydrophobicContact CG-CG 4.46Å; F76-P94 HydrophobicContact CB-CB 3.9Å; F76-P94 HydrophobicContact CB-CG 4.32Å; F76-C95 PolarHBondContact N-O 3.42Å; F76-A96 CarbonylContact O-C 3.57Å; F76-A96 VanDerWaalsContact O-CA 3.29Å; F76-A96 WeakPolarHBondContact O-CA 3.5Å; F76-E97 PolarHBondContact O-N 2.99Å
77	L	87.8	Confident	82.9	Confident	90 Å²	90	69.5 Å²	69.5	47%	0.471	35%	0.35	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85	123.9	179.9	-173.5	68.7	0	0	0	109.3	E97 A99	L77-E97 CarbonylContact C-O 3.37Å; L77-E97 WeakPolarHBondContact CA-O 3.01Å; L77-E97 HydrophobicContact CD1-CB 4.48Å; L77-A99 HydrophobicContact CD1-CB 3.87Å; L77-A99 HydrophobicContact CD2-CB 4.43Å; L77-A99 HydrophobicContact CG-CB 4.08Å
78	V	88.9	Confident	81.8	Confident	0 Å²	0	67.7 Å²	67.7	0%	0	34%	0.344	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.3	126.5	-179.3	-177.9	0	0	0	0	110	F76 N80 E83 A96 E97 A99 I110	F76-V78 HydrophobicContact CD1-CG2 3.65Å; F76-V78 HydrophobicContact CE1-CG2 3.86Å; V78-N80 VanDerWaalsContact CG1-O 3.25Å; V78-N80 WeakPolarHBondContact CG1-O 3.46Å; V78-E83 HydrophobicContact CG1-CB 4.25Å; V78-A96 HydrophobicContact CG2-CB 3.66Å; V78-E97 PolarHBondContact N-O 3.17Å; V78-A99 WeakPolarHBondContact O-CB 3.21Å; V78-A99 PolarHBondContact O-N 3Å; V78-I110 HydrophobicContact CG1-CD1 4.14Å; V78-I110 HydrophobicContact CG1-CG2 4.32Å
79	H	88.8	Confident	80.7	Confident	84 Å²	84	73 Å²	73	39%	0.389	38%	0.378	S	S	.	.			trans	-101.3	-34.2	175.1	-65	-78.9	0	0	0	112.5	E83 A99 V102	H79-E83 IonicContact CD2-OE2 3.63Å; H79-E83 PolarHBondContact N-OE2 2.84Å; H79-A99 WeakPolarHBondContact ND1-CB 3.46Å; H79-V102 WeakPolarHBondContact O-CG2 3.36Å
80	N	88.1	Confident	79.8	Confident	88 Å²	88	75.6 Å²	75.6	47%	0.471	40%	0.396	S	S	.	.	S	Bend	trans	-133	159.8	-173.4	-62.2	-61	0	0	0	112.7	V78 K82 E83	V78-N80 VanDerWaalsContact CG1-O 3.25Å; V78-N80 WeakPolarHBondContact CG1-O 3.46Å; N80-K82 VanDerWaalsContact C-N 3.27Å; N80-K82 PolarHBondContact O-N 3.37Å; N80-E83 HydrophobicContact CB-CG 4.39Å; N80-E83 PolarHBondContact N-OE2 2.97Å; N80-E83 PolarHBondContact ND2-OE1 2.78Å; N80-E83 PolarHBondContact O-N 3.21Å
81	V	83.5	Confident	78.5	Confident	70 Å²	70	76.3 Å²	76.3	42%	0.424	40%	0.403	S	S	.	.	G	3₁₀ helix	trans	-62.8	-34.9	177.1	-175.6	0	0	0	0	111.7	E83 L84 A109 I110	V81-E83 VanDerWaalsContact C-N 3.26Å; V81-E83 PolarHBondContact O-N 3.36Å; V81-L84 WeakPolarHBondContact O-CB 3.44Å; V81-L84 PolarHBondContact O-N 3.13Å; V81-L84 VanDerWaalsContact O-N 3.13Å; V81-A109 HydrophobicContact CG2-CB 4.25Å; V81-I110 HydrophobicContact CG2-CG1 3.85Å
82	K	85.4	Confident	77.7	Confident	179 Å²	179	82 Å²	82	78%	0.778	42%	0.422	S	S	*	.	G	3₁₀ helix	trans	-64.5	-29.5	177.9	-63.9	-176.1	178.5	-175.2	0	113.2	N80 L84 E85	N80-K82 VanDerWaalsContact C-N 3.27Å; N80-K82 PolarHBondContact O-N 3.37Å; K82-L84 PolarHBondContact O-N 3.46Å; K82-E85 PolarHBondContact O-N 2.81Å
83	E	81.9	Confident	76.9	Confident	54 Å²	54	84.3 Å²	84.3	25%	0.252	44%	0.437	S	S	.	.	G	3₁₀ helix	trans	-72.8	-8.2	178.6	-69	163.1	-149.3	0	0	112.3	V78 H79 N80 V81 E85 P87	V78-E83 HydrophobicContact CG1-CB 4.25Å; H79-E83 IonicContact CD2-OE2 3.63Å; H79-E83 PolarHBondContact N-OE2 2.84Å; N80-E83 HydrophobicContact CB-CG 4.39Å; N80-E83 PolarHBondContact N-OE2 2.97Å; N80-E83 PolarHBondContact ND2-OE1 2.78Å; N80-E83 PolarHBondContact O-N 3.21Å; V81-E83 VanDerWaalsContact C-N 3.26Å; V81-E83 PolarHBondContact O-N 3.36Å; E83-E85 VanDerWaalsContact C-N 3.28Å; E83-E85 PolarHBondContact O-N 2.9Å; E83-P87 WeakPolarHBondContact O-CD 3.37Å
84	L	79.1	Confident	76.4	Confident	15 Å²	15	84.4 Å²	84.4	8%	0.079	44%	0.439	C	S	.	.	G	3₁₀ helix	trans	-73.7	-20.8	178.8	-159.9	63.6	0	0	0	113.2	V81 K82 P87 L88 I110 G113 Q114	V81-L84 WeakPolarHBondContact O-CB 3.44Å; V81-L84 PolarHBondContact O-N 3.13Å; V81-L84 VanDerWaalsContact O-N 3.13Å; K82-L84 PolarHBondContact O-N 3.46Å; L84-P87 WeakPolarHBondContact O-CD 3.47Å; L84-L88 WeakPolarHBondContact O-CG 3.39Å; L84-I110 HydrophobicContact CD1-CG2 4.23Å; L84-G113 VanDerWaalsContact CD2-C 3.44Å; L84-G113 WeakPolarHBondContact CD2-O 3.41Å; L84-Q114 HydrophobicContact CD1-CG 3.77Å; L84-Q114 HydrophobicContact CD2-CG 4.11Å; L84-Q114 HydrophobicContact CG-CG 4.44Å
85	E	76	Confident	76.1	Confident	137 Å²	137	79.7 Å²	79.7	64%	0.64	42%	0.423	S	S	*	.	S	Bend	trans	-72.4	-33.2	177.5	-66	175.6	-171.4	0	0	111.9	K82 E83 L88	K82-E85 PolarHBondContact O-N 2.81Å; E83-E85 VanDerWaalsContact C-N 3.28Å; E83-E85 PolarHBondContact O-N 2.9Å; E85-L88 WeakPolarHBondContact O-CB 3.36Å; E85-L88 PolarHBondContact O-N 2.7Å
86	V	73.5	Confident	75.9	Confident	90 Å²	90	74.7 Å²	74.7	55%	0.545	40%	0.402	S	S	.	.	G	3₁₀ helix	trans	-64.3	-43.2	-176.1	-179.5	0	0	0	0	113	L88	V86-L88 PolarHBondContact O-N 3.41Å
87	P	67.8	Low	75.9	Confident	16 Å²	16	74.4 Å²	74.4	10%	0.104	40%	0.402	C	S	.	.	G	3₁₀ helix	trans	-56.5	-28.3	172.3	-31.3	35.9	0	0	0	115.8	F76 E83 L84 T89 C90 P94	F76-P87 HydrophobicContact CD1-CG 3.69Å; F76-P87 HydrophobicContact CE1-CG 3.76Å; F76-P87 HydrophobicContact CG-CG 4.46Å; E83-P87 WeakPolarHBondContact O-CD 3.37Å; L84-P87 WeakPolarHBondContact O-CD 3.47Å; P87-T89 VanDerWaalsContact C-N 3.29Å; P87-T89 PolarHBondContact O-N 3.16Å; P87-C90 PolarHBondContact O-N 3.22Å; P87-P94 HydrophobicContact CB-CG 3.96Å
88	L	64.4	Low	75.9	Confident	97 Å²	97	71 Å²	71	51%	0.508	38%	0.384	S	S	.	.	G	3₁₀ helix	trans	-69.4	-28.6	-169.2	-60.2	175.3	0	0	0	112.8	L84 E85 V86 P115	L84-L88 WeakPolarHBondContact O-CG 3.39Å; E85-L88 WeakPolarHBondContact O-CB 3.36Å; E85-L88 PolarHBondContact O-N 2.7Å; V86-L88 PolarHBondContact O-N 3.41Å; L88-P115 HydrophobicContact CD2-CG 3.37Å
89	T	64.8	Low	76	Confident	128 Å²	128	71.4 Å²	71.4	79%	0.785	39%	0.387	S	S	*	.	G	3₁₀ helix	trans	-86.7	-10.2	-174.9	-32.1	0	0	0	0	112.6	P87	P87-T89 VanDerWaalsContact C-N 3.29Å; P87-T89 PolarHBondContact O-N 3.16Å
90	C	63.9	Low	76	Confident	73 Å²	73	76.5 Å²	76.5	49%	0.493	41%	0.411	S	S	.	.			trans	-87.4	116	-176.7	-73.7	0	0	0	0	111.5	P87 K92 S93	P87-C90 PolarHBondContact O-N 3.22Å; C90-K92 CarbonylContact O-C 3.48Å; C90-K92 PolarHBondContact O-N 3.47Å; C90-K92 VanDerWaalsContact O-N 3.1Å; C90-S93 PolarHBondContact O-N 3.1Å
91	S	58.8	Low	76.1	Confident	124 Å²	124	76.1 Å²	76.1	87%	0.867	42%	0.415	S	S	*	.	S	Bend	trans	-59.3	-22.5	178.7	59.4	0	0	0	0	114.6
92	K	63.1	Low	76.4	Confident	168 Å²	168	73.9 Å²	73.9	73%	0.73	40%	0.401	S	S	*	.	S	Bend	trans	-96.4	86.3	167	-64.7	170.9	-174.1	163.2	0	107.2	C90 P94	C90-K92 CarbonylContact O-C 3.48Å; C90-K92 PolarHBondContact O-N 3.47Å; C90-K92 VanDerWaalsContact O-N 3.1Å; K92-P94 WeakPolarHBondContact O-CD 3.32Å
93	S	63.4	Low	76.6	Confident	53 Å²	53	68.2 Å²	68.2	37%	0.371	38%	0.384	S	S	.	.			trans	-51.9	110.4	-175.7	46.4	0	0	0	0	110.9	F73 C90	F73-S93 VanDerWaalsContact CD1-O 3.26Å; F73-S93 WeakPolarHBondContact CD1-O 3.4Å; C90-S93 PolarHBondContact O-N 3.1Å
94	P	70.4	Confident	76.8	Confident	19 Å²	19	68.6 Å²	68.6	12%	0.123	39%	0.393	C	S	.	.	P	Polyproline II helix	trans	-73.9	146.7	173.3	30.8	-30.8	0	0	0	108.7	W74 F76 P87 K92	W74-P94 CarbonylContact O-C 3.51Å; W74-P94 WeakPolarHBondContact O-CA 3.46Å; W74-P94 VanDerWaalsContact O-CB 3.26Å; W74-P94 WeakPolarHBondContact O-CB 3.08Å; F76-P94 HydrophobicContact CB-CB 3.9Å; F76-P94 HydrophobicContact CB-CG 4.32Å; P87-P94 HydrophobicContact CB-CG 3.96Å; K92-P94 WeakPolarHBondContact O-CD 3.32Å
95	C	77.3	Confident	77.3	Confident	8 Å²	8	76 Å²	76	5%	0.054	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.6	120.6	170.6	-164	0	0	0	0	108.5	F73 W74 K75 F76 P118 S120	F73-C95 HydrophobicContact CB-CB 3.68Å; F73-C95 HydrophobicContact CG-CB 4.45Å; W74-C95 PolarHBondContact O-N 3.35Å; K75-C95 WeakPolarHBondContact CA-O 3.43Å; F76-C95 PolarHBondContact N-O 3.42Å; C95-P118 PolarHBondContact SG-O 2.96Å; C95-S120 WeakPolarHBondContact SG-CB 3.24Å; C95-S120 PolarHBondContact SG-OG 3.38Å
96	A	81.8	Confident	77.8	Confident	8 Å²	8	73.4 Å²	73.4	7%	0.066	42%	0.415	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.7	119.8	-179.6	0	0	0	0	0	110.9	F76 V78 S120	F76-A96 CarbonylContact O-C 3.57Å; F76-A96 VanDerWaalsContact O-CA 3.29Å; F76-A96 WeakPolarHBondContact O-CA 3.5Å; V78-A96 HydrophobicContact CG2-CB 3.66Å; A96-S120 PolarHBondContact O-OG 3.07Å
97	E	84.4	Confident	78.4	Confident	61 Å²	61	70.8 Å²	70.8	29%	0.285	40%	0.397	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.7	126.1	169.7	-66.4	-174	168.9	0	0	108.5	K75 F76 L77 V78	K75-E97 WeakPolarHBondContact CD-OE1 3.48Å; K75-E97 WeakPolarHBondContact CE-OE1 3.33Å; K75-E97 IonicContact NZ-OE1 3.9Å; K75-E97 PolarHBondContact NZ-OE1 3.33Å; K75-E97 IonicContact NZ-OE2 2.65Å; F76-E97 PolarHBondContact O-N 2.99Å; L77-E97 CarbonylContact C-O 3.37Å; L77-E97 WeakPolarHBondContact CA-O 3.01Å; L77-E97 HydrophobicContact CD1-CB 4.48Å; V78-E97 PolarHBondContact N-O 3.17Å
98	I	89.1	Confident	79.3	Confident	20 Å²	20	76.2 Å²	76.2	10%	0.103	42%	0.419	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.9	130	178	-58.5	167.6	0	0	0	108.7	V102 H107 I110	I98-V102 HydrophobicContact CG2-CB 3.86Å; I98-V102 HydrophobicContact CG2-CG1 4.23Å; I98-V102 HydrophobicContact CG2-CG2 3.86Å; I98-H107 VanDerWaalsContact CD1-CE1 3.44Å; I98-H107 WeakPolarHBondContact CD1-CE1 3.47Å; I98-H107 WeakPolarHBondContact CD1-NE2 3.26Å; I98-H107 WeakPolarHBondContact CG2-CD2 3.38Å; I98-I110 HydrophobicContact CD1-CB 4.23Å; I98-I110 HydrophobicContact CD1-CG2 3.96Å; I98-I110 HydrophobicContact CG1-CG2 3.95Å; I98-I110 HydrophobicContact CG2-CD1 4.37Å
99	A	90.3	Very high	80.3	Confident	7 Å²	7	73.8 Å²	73.8	6%	0.058	41%	0.412	C	S	.	.	P	Polyproline II helix	trans	-63.9	148.7	179.7	0	0	0	0	0	112.4	L77 V78 H79 S101 V102	L77-A99 HydrophobicContact CD1-CB 3.87Å; L77-A99 HydrophobicContact CD2-CB 4.43Å; L77-A99 HydrophobicContact CG-CB 4.08Å; V78-A99 WeakPolarHBondContact O-CB 3.21Å; V78-A99 PolarHBondContact O-N 3Å; H79-A99 WeakPolarHBondContact ND1-CB 3.46Å; A99-S101 PolarHBondContact O-N 3.5Å; A99-S101 VanDerWaalsContact O-N 3.1Å; A99-V102 HydrophobicContact CB-CG2 4.2Å; A99-V102 WeakPolarHBondContact O-CG2 3.37Å; A99-V102 PolarHBondContact O-N 3.24Å
100	H	88.2	Confident	81.2	Confident	191 Å²	191	67.7 Å²	67.7	88%	0.884	38%	0.375	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.4	-22.3	-177.4	98.3	-59	0	0	0	113.9	V102	H100-V102 VanDerWaalsContact C-N 3.31Å
101	S	90.6	Very high	82.1	Confident	81 Å²	81	68.8 Å²	68.8	57%	0.566	37%	0.369	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.7	-9.6	-175.2	57.5	0	0	0	0	113.1	A99 S103	A99-S101 PolarHBondContact O-N 3.5Å; A99-S101 VanDerWaalsContact O-N 3.1Å; S101-S103 PolarHBondContact O-N 3.4Å
102	V	90.9	Very high	83.1	Confident	22 Å²	22	71.2 Å²	71.2	13%	0.133	36%	0.364	C	S	.	.	S	Bend	trans	-74.7	127.5	-176.8	-176.1	0	0	0	0	109.4	H79 I98 A99 H100 N106 H107 I110	H79-V102 WeakPolarHBondContact O-CG2 3.36Å; I98-V102 HydrophobicContact CG2-CB 3.86Å; I98-V102 HydrophobicContact CG2-CG1 4.23Å; I98-V102 HydrophobicContact CG2-CG2 3.86Å; A99-V102 HydrophobicContact CB-CG2 4.2Å; A99-V102 WeakPolarHBondContact O-CG2 3.37Å; A99-V102 PolarHBondContact O-N 3.24Å; H100-V102 VanDerWaalsContact C-N 3.31Å; V102-N106 HydrophobicContact CG1-CB 3.57Å; V102-H107 HydrophobicContact CG1-CB 4.39Å; V102-I110 HydrophobicContact CG1-CD1 4.09Å
103	S	89.4	Confident	83.5	Confident	60 Å²	60	65.3 Å²	65.3	42%	0.42	35%	0.35	S	S	.	.			trans	-61.9	154.9	176.8	72.4	0	0	0	0	111.6	S101 K105 N106 H107	S101-S103 PolarHBondContact O-N 3.4Å; S103-K105 PolarHBondContact O-N 3.18Å; S103-K105 VanDerWaalsContact O-N 3.16Å; S103-N106 PolarHBondContact O-N 3.46Å; S103-N106 VanDerWaalsContact O-N 3.13Å; S103-H107 WeakPolarHBondContact O-CB 3.48Å; S103-H107 PolarHBondContact O-N 2.95Å
104	S	86.7	Confident	83.6	Confident	62 Å²	62	64.8 Å²	64.8	43%	0.434	34%	0.342	S	S	.	.	H	α-helix	trans	-58	-32.5	-178.7	58.5	0	0	0	0	113.5	K108	S104-K108 WeakPolarHBondContact O-CG 3.41Å; S104-K108 PolarHBondContact O-N 3.33Å
105	K	88	Confident	82.8	Confident	172 Å²	172	67 Å²	67	75%	0.748	36%	0.356	S	S	*	.	H	α-helix	trans	-64.4	-50.5	175.9	-66.7	-176	-178.9	-179.6	0	111.2	S103 H107 K108 A109	S103-K105 PolarHBondContact O-N 3.18Å; S103-K105 VanDerWaalsContact O-N 3.16Å; K105-H107 VanDerWaalsContact C-N 3.35Å; K105-K108 PolarHBondContact O-N 3.24Å; K105-A109 PolarHBondContact O-N 3.23Å
106	N	86.4	Confident	81.6	Confident	81 Å²	81	71.8 Å²	71.8	43%	0.433	39%	0.39	S	S	.	.	H	α-helix	trans	-71.3	-32.2	-179.6	-68.4	-6.1	0	0	0	111.6	V102 S103 K108 A109 I110	V102-N106 HydrophobicContact CG1-CB 3.57Å; S103-N106 PolarHBondContact O-N 3.46Å; S103-N106 VanDerWaalsContact O-N 3.13Å; N106-K108 VanDerWaalsContact C-N 3.35Å; N106-K108 PolarHBondContact O-N 3.16Å; N106-A109 WeakPolarHBondContact O-CB 3.37Å; N106-A109 PolarHBondContact O-N 3.49Å; N106-A109 VanDerWaalsContact O-N 3.16Å; N106-I110 WeakPolarHBondContact O-CG1 3.47Å; N106-I110 PolarHBondContact O-N 3.34Å
107	H	86.4	Confident	79.8	Confident	35 Å²	35	73.4 Å²	73.4	16%	0.162	40%	0.4	C	S	.	.	H	α-helix	trans	-61	-42.3	174.6	-166.7	-70.2	0	0	0	111.9	I98 V102 S103 K105 W111 Q122	I98-H107 VanDerWaalsContact CD1-CE1 3.44Å; I98-H107 WeakPolarHBondContact CD1-CE1 3.47Å; I98-H107 WeakPolarHBondContact CD1-NE2 3.26Å; I98-H107 WeakPolarHBondContact CG2-CD2 3.38Å; V102-H107 HydrophobicContact CG1-CB 4.39Å; S103-H107 WeakPolarHBondContact O-CB 3.48Å; S103-H107 PolarHBondContact O-N 2.95Å; K105-H107 VanDerWaalsContact C-N 3.35Å; H107-W111 VanDerWaalsContact O-CB 3.31Å; H107-W111 WeakPolarHBondContact O-CB 3.24Å; H107-W111 PolarHBondContact O-N 3.29Å; H107-Q122 PolarHBondContact NE2-NE2 3.21Å
108	K	86.4	Confident	78	Confident	131 Å²	131	72 Å²	72	57%	0.57	40%	0.396	S	S	*	.	H	α-helix	trans	-64.8	-38.9	173.7	-72.5	178.7	-176.8	-179.6	0	111.9	S104 K105 N106 K112	S104-K108 WeakPolarHBondContact O-CG 3.41Å; S104-K108 PolarHBondContact O-N 3.33Å; K105-K108 PolarHBondContact O-N 3.24Å; N106-K108 VanDerWaalsContact C-N 3.35Å; N106-K108 PolarHBondContact O-N 3.16Å; K108-K112 WeakPolarHBondContact O-CB 3.29Å; K108-K112 VanDerWaalsContact O-CG 3.31Å; K108-K112 WeakPolarHBondContact O-CG 3.4Å; K108-K112 PolarHBondContact O-N 3.31Å
109	A	85.8	Confident	75.9	Confident	45 Å²	45	76.7 Å²	76.7	37%	0.372	42%	0.418	S	S	.	.	H	α-helix	trans	-64.6	-45.9	177.6	0	0	0	0	0	111.7	V81 K105 N106 K112 G113	V81-A109 HydrophobicContact CG2-CB 4.25Å; K105-A109 PolarHBondContact O-N 3.23Å; N106-A109 WeakPolarHBondContact O-CB 3.37Å; N106-A109 PolarHBondContact O-N 3.49Å; N106-A109 VanDerWaalsContact O-N 3.16Å; A109-K112 PolarHBondContact O-N 3.37Å; A109-G113 PolarHBondContact O-N 3.04Å
110	I	84.8	Confident	73.5	Confident	0 Å²	0	78 Å²	78	0%	0	43%	0.427	C	S	.	.	H	α-helix	trans	-62.4	-46.5	176.7	-65	167.5	0	0	0	110.5	V78 V81 L84 I98 V102 N106 K112 G113 Q114	V78-I110 HydrophobicContact CG1-CD1 4.14Å; V78-I110 HydrophobicContact CG1-CG2 4.32Å; V81-I110 HydrophobicContact CG2-CG1 3.85Å; L84-I110 HydrophobicContact CD1-CG2 4.23Å; I98-I110 HydrophobicContact CD1-CB 4.23Å; I98-I110 HydrophobicContact CD1-CG2 3.96Å; I98-I110 HydrophobicContact CG1-CG2 3.95Å; I98-I110 HydrophobicContact CG2-CD1 4.37Å; V102-I110 HydrophobicContact CG1-CD1 4.09Å; N106-I110 WeakPolarHBondContact O-CG1 3.47Å; N106-I110 PolarHBondContact O-N 3.34Å; I110-K112 PolarHBondContact O-N 3.12Å; I110-G113 PolarHBondContact O-N 3.43Å; I110-Q114 WeakPolarHBondContact O-CG 3.33Å; I110-Q114 PolarHBondContact O-N 2.81Å
111	W	81.4	Confident	71.2	Confident	97 Å²	97	77.6 Å²	77.6	37%	0.367	43%	0.425	S	S	.	.	H	α-helix	trans	-58.5	-45.5	178.7	177.8	-93.4	0	0	0	112.9	H107 Q119	H107-W111 VanDerWaalsContact O-CB 3.31Å; H107-W111 WeakPolarHBondContact O-CB 3.24Å; H107-W111 PolarHBondContact O-N 3.29Å; W111-Q119 HydrophobicContact CH2-CB 4.27Å; W111-Q119 HydrophobicContact CH2-CG 3.61Å; W111-Q119 VanDerWaalsContact CH2-NE2 3.29Å; W111-Q119 HydrophobicContact CZ2-CG 4.26Å; W111-Q119 HydrophobicContact CZ3-CG 4.3Å
112	K	80.6	Confident	68.9	Low	175 Å²	175	78 Å²	78	76%	0.761	42%	0.418	S	S	*	.	H	α-helix	trans	-72.7	-31.6	178.6	-70.8	-179	178.7	-169.2	0	112.6	K108 A109 I110 Q114	K108-K112 WeakPolarHBondContact O-CB 3.29Å; K108-K112 VanDerWaalsContact O-CG 3.31Å; K108-K112 WeakPolarHBondContact O-CG 3.4Å; K108-K112 PolarHBondContact O-N 3.31Å; A109-K112 PolarHBondContact O-N 3.37Å; I110-K112 PolarHBondContact O-N 3.12Å; K112-Q114 VanDerWaalsContact C-N 3.26Å; K112-Q114 PolarHBondContact O-N 3.28Å
113	G	71.7	Confident	66.4	Low	43 Å²	43	82.1 Å²	82.1	44%	0.443	45%	0.445	S	S	.	.	H	α-helix	trans	-76.6	-8.6	179.6	0	0	0	0	0	114.1	L84 A109 I110 P115	L84-G113 VanDerWaalsContact CD2-C 3.44Å; L84-G113 WeakPolarHBondContact CD2-O 3.41Å; A109-G113 PolarHBondContact O-N 3.04Å; I110-G113 PolarHBondContact O-N 3.43Å; G113-P115 WeakPolarHBondContact O-CD 3.17Å
114	Q	64.4	Low	63.8	Low	42 Å²	42	88.2 Å²	88.2	20%	0.196	47%	0.467	C	S	.	.			trans	-74	114.4	176.6	-82.3	177.9	-61.2	0	0	110.8	L84 I110 K112 S116	L84-Q114 HydrophobicContact CD1-CG 3.77Å; L84-Q114 HydrophobicContact CD2-CG 4.11Å; L84-Q114 HydrophobicContact CG-CG 4.44Å; I110-Q114 WeakPolarHBondContact O-CG 3.33Å; I110-Q114 PolarHBondContact O-N 2.81Å; K112-Q114 VanDerWaalsContact C-N 3.26Å; K112-Q114 PolarHBondContact O-N 3.28Å; Q114-S116 PolarHBondContact O-N 3.42Å; Q114-S116 VanDerWaalsContact O-N 3.12Å
115	P	53.4	Low	61.5	Low	66 Å²	66	89.2 Å²	89.2	43%	0.429	47%	0.473	S	S	.	.			trans	-72.8	107.7	170.3	29.3	-30.2	0	0	0	108.4	L88 G113 C117	L88-P115 HydrophobicContact CD2-CG 3.37Å; G113-P115 WeakPolarHBondContact O-CD 3.17Å; P115-C117 PolarHBondContact O-N 3.47Å
116	S	52.3	Low	59.4	Low	109 Å²	109	86.3 Å²	86.3	76%	0.762	46%	0.462	S	S	*	.	S	Bend	trans	38.2	42.9	165.3	64.5	0	0	0	0	116.5	L4 Q114	L4-S116 WeakPolarHBondContact CD1-O 3.5Å; Q114-S116 PolarHBondContact O-N 3.42Å; Q114-S116 VanDerWaalsContact O-N 3.12Å
117	C	45.5	Very low	57	Low	42 Å²	42	86.1 Å²	86.1	28%	0.284	47%	0.472	S	S	.	.			trans	-85.7	144.5	171.8	-77.7	0	0	0	0	109.8	P115 Q119	P115-C117 PolarHBondContact O-N 3.47Å; C117-Q119 PolarHBondContact O-N 2.75Å; C117-Q119 VanDerWaalsContact O-N 3.16Å
118	P	46.5	Very low	54.9	Low	31 Å²	31	88.3 Å²	88.3	20%	0.201	50%	0.496	C	S	.	.			trans	-58.5	123.5	174.6	2.2	-2.4	0	0	0	109.2	L4 F73 C95 S120	L4-P118 HydrophobicContact CB-CB 3.8Å; L4-P118 HydrophobicContact CB-CG 3.66Å; L4-P118 HydrophobicContact CD1-CB 4.27Å; L4-P118 HydrophobicContact CD1-CG 4.13Å; F73-P118 HydrophobicContact CD2-CG 4.08Å; F73-P118 HydrophobicContact CE1-CG 4.03Å; F73-P118 HydrophobicContact CE2-CB 3.95Å; F73-P118 HydrophobicContact CE2-CG 3.42Å; F73-P118 VanDerWaalsContact CE2-CG 3.42Å; F73-P118 HydrophobicContact CZ-CB 4.34Å; F73-P118 HydrophobicContact CZ-CG 3.38Å; C95-P118 PolarHBondContact SG-O 2.96Å; P118-S120 PolarHBondContact O-N 2.75Å; P118-S120 VanDerWaalsContact O-N 3.08Å
119	Q	44.9	Very low	53	Low	118 Å²	118	88.3 Å²	88.3	55%	0.551	50%	0.498	S	S	*	.			trans	-55.6	113	173.8	-63.3	178.2	-22.4	0	0	109	W111 C117 H121	W111-Q119 HydrophobicContact CH2-CB 4.27Å; W111-Q119 HydrophobicContact CH2-CG 3.61Å; W111-Q119 VanDerWaalsContact CH2-NE2 3.29Å; W111-Q119 HydrophobicContact CZ2-CG 4.26Å; W111-Q119 HydrophobicContact CZ3-CG 4.3Å; C117-Q119 PolarHBondContact O-N 2.75Å; C117-Q119 VanDerWaalsContact O-N 3.16Å; Q119-H121 PolarHBondContact O-N 3.25Å
120	S	39.3	Very low	51	Low	35 Å²	35	93.9 Å²	93.9	25%	0.245	52%	0.516	C	S	.	.			trans	-70	127.2	162.6	36	0	0	0	0	108.7	C95 A96 P118 Q122	C95-S120 WeakPolarHBondContact SG-CB 3.24Å; C95-S120 PolarHBondContact SG-OG 3.38Å; A96-S120 PolarHBondContact O-OG 3.07Å; P118-S120 PolarHBondContact O-N 2.75Å; P118-S120 VanDerWaalsContact O-N 3.08Å; S120-Q122 PolarHBondContact O-N 3.42Å
121	H	39.8	Very low	49.1	Very low	183 Å²	183	104.8 Å²	104.8	85%	0.847	56%	0.557	S	S	*	*			trans	-27.9	103.6	162.3	-67.3	-84.9	0	0	0	112.9	Q119	Q119-H121 PolarHBondContact O-N 3.25Å
122	Q	42.5	Very low	47	Very low	90 Å²	90	113.1 Å²	113.1	42%	0.421	60%	0.596	S	S	.	*			trans	-98.6	128.8	155.5	-84.9	-173.1	-42.9	0	0	108	H107 S120	H107-Q122 PolarHBondContact NE2-NE2 3.21Å; S120-Q122 PolarHBondContact O-N 3.42Å
123	P	37.5	Very low	45.3	Very low	107 Å²	107	110.1 Å²	110.1	70%	0.695	59%	0.588	S	S	*	*			trans	-60.5	148.2	162.7	28.8	-31.5	0	0	0	108.2	C125	P123-C125 VanDerWaalsContact C-N 3.29Å; P123-C125 PolarHBondContact O-N 3.07Å
124	Q	35.8	Very low	43.9	Very low	188 Å²	188	113.6 Å²	113.6	88%	0.879	60%	0.596	S	S	*	*	S	Bend	trans	-55.2	76.9	-172.5	-62.8	164.8	-38	0	0	113.7
125	C	38.1	Very low	42.8	Very low	84 Å²	84	117.6 Å²	117.6	57%	0.568	62%	0.618	S	S	*	*			trans	-91	-15.5	167	-70.4	0	0	0	0	111.9	P123 A127 A128	P123-C125 VanDerWaalsContact C-N 3.29Å; P123-C125 PolarHBondContact O-N 3.07Å; C125-A127 VanDerWaalsContact C-N 3.31Å; C125-A127 PolarHBondContact O-N 2.93Å; C125-A128 PolarHBondContact O-N 3.37Å
126	Q	43.5	Very low	42.2	Very low	110 Å²	110	120.6 Å²	120.6	51%	0.514	63%	0.629	S	S	.	*	G	3₁₀ helix	trans	-68.2	-28.3	-176.6	-65	-174.4	-4.2	0	0	113.2	A128	Q126-A128 VanDerWaalsContact C-N 3.27Å; Q126-A128 PolarHBondContact O-N 3.14Å
127	A	36.1	Very low	41.5	Very low	78 Å²	78	121.3 Å²	121.3	65%	0.645	62%	0.621	S	S	*	*	G	3₁₀ helix	trans	-71.9	-18.8	-178.3	0	0	0	0	0	113.6	C125	C125-A127 VanDerWaalsContact C-N 3.31Å; C125-A127 PolarHBondContact O-N 2.93Å
128	A	42.2	Very low	41.3	Very low	80 Å²	80	126.6 Å²	126.6	66%	0.661	64%	0.643	S	S	*	*	G	3₁₀ helix	trans	-88.6	-19.9	-178.2	0	0	0	0	0	113.7	C125 Q126	C125-A128 PolarHBondContact O-N 3.37Å; Q126-A128 VanDerWaalsContact C-N 3.27Å; Q126-A128 PolarHBondContact O-N 3.14Å
129	Q	46.5	Very low	40.9	Very low	131 Å²	131	133.4 Å²	133.4	61%	0.612	68%	0.675	S	S	*	*	S	Bend	trans	-100.7	-4.6	-168.6	-73.1	170.6	-26.8	0	0	114.7	R131	Q129-R131 VanDerWaalsContact C-N 3.34Å
130	Q	43.5	Very low	40.6	Very low	163 Å²	163	134.6 Å²	134.6	76%	0.762	68%	0.684	S	S	*	*	S	Bend	trans	-90	9.7	175.1	-63.3	-159.1	3.3	0	0	114.1
131	R	45	Very low	40.7	Very low	228 Å²	228	142.9 Å²	142.9	86%	0.86	72%	0.721	S	S	*	*			trans	-100.1	24.3	-178.7	-68.4	-172.6	178.1	175.5	-0.9	114.4	Q129	Q129-R131 VanDerWaalsContact C-N 3.34Å
132	K	37.8	Very low	40.8	Very low	273 Å²	273	139.3 Å²	139.3	100%	1.187	71%	0.709	S	S	*	*			trans	-139.4	0	169.9	-68.3	-167.2	-179.5	-169.1	0	110.6

Retrieved 132 of 132 residues in 22.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).