A0A090N8P0_HUMAN Loading...

Similar to FLJ40113 protein

AlphaFold DB , UniProt , Accession A0A090N8P0, Species HUMAN (Homo sapiens, Human), Gene LOC402253, Length 136 aa.

						>A0A090N8P0_HUMAN|A0A090N8P0|LOC402253
MAEETRQSKLAIAKEKLKEYWQRNSLGVPAGVKRNRKTSGSSPETATSGGCHSPEDSATGIHGEGPTSSATLKDLESPCQELAVVLDSRSIKISQLNNTIKSLVIMANILVFVFPKCIVIDLNRNVDTEISKMSMG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57.1	Low	76.4	Confident	184 Å²	184	109.6 Å²	109.6	91%	0.906	57%	0.57	S	S	*	*				0	-53.3	0	-49.9	-43.3	-78.8	0	0	114.3	T5	M1-T5 PolarHBondContact O-N 2.97Å; M1-T5 PolarHBondContact O-OG1 3.02Å
2	A	60	Low	77.8	Confident	77 Å²	77	107.8 Å²	107.8	64%	0.636	56%	0.56	S	S	*	*	H	α-helix	trans	-70.7	-34.8	-176.1	0	0	0	0	0	114.6	T5 R6	A2-T5 WeakPolarHBondContact O-CB 3.43Å; A2-T5 PolarHBondContact O-N 2.71Å; A2-R6 PolarHBondContact O-N 2.93Å
3	E	59.7	Low	79.1	Confident	109 Å²	109	103.8 Å²	103.8	51%	0.509	55%	0.553	S	S	.	*	H	α-helix	trans	-72.8	-40.8	-179	-172.9	54.4	-147.9	0	0	112.5	T5 R6 Q7	E3-T5 PolarHBondContact O-N 3.4Å; E3-R6 WeakPolarHBondContact O-CB 3.48Å; E3-R6 PolarHBondContact O-N 3.44Å; E3-Q7 WeakPolarHBondContact O-CG 3.36Å; E3-Q7 PolarHBondContact O-N 2.86Å; E3-Q7 PolarHBondContact OE1-NE2 2.96Å
4	E	61.9	Low	80.2	Confident	132 Å²	132	106.6 Å²	106.6	62%	0.617	56%	0.557	S	S	*	*	H	α-helix	trans	-58.2	-34.9	171.6	-75.9	168.2	138.9	0	0	112	Q7 S8	E4-Q7 PolarHBondContact O-N 2.91Å; E4-S8 WeakPolarHBondContact O-CB 3.25Å; E4-S8 PolarHBondContact O-N 3.26Å
5	T	74.5	Confident	81.2	Confident	71 Å²	71	107.9 Å²	107.9	44%	0.436	56%	0.56	S	S	.	*	H	α-helix	trans	-68.3	-35.5	176	-54.9	0	0	0	0	111.6	M1 A2 E3 K9	M1-T5 PolarHBondContact O-N 2.97Å; M1-T5 PolarHBondContact O-OG1 3.02Å; A2-T5 WeakPolarHBondContact O-CB 3.43Å; A2-T5 PolarHBondContact O-N 2.71Å; E3-T5 PolarHBondContact O-N 3.4Å; T5-K9 HydrophobicContact CG2-CD 4.38Å; T5-K9 WeakPolarHBondContact O-CB 3.17Å; T5-K9 WeakPolarHBondContact O-CD 3.14Å; T5-K9 WeakPolarHBondContact O-CG 3.23Å; T5-K9 PolarHBondContact O-N 3.24Å; T5-K9 VanDerWaalsContact O-N 3.11Å
6	R	79.6	Confident	82	Confident	176 Å²	176	109.9 Å²	109.9	66%	0.664	56%	0.563	S	S	*	*	H	α-helix	trans	-70.8	-44	175.5	-69.1	176	69.4	111.5	1.2	111.4	A2 E3 K9 L10	A2-R6 PolarHBondContact O-N 2.93Å; E3-R6 WeakPolarHBondContact O-CB 3.48Å; E3-R6 PolarHBondContact O-N 3.44Å; R6-K9 PolarHBondContact O-N 3.04Å; R6-L10 WeakPolarHBondContact O-CB 3.39Å; R6-L10 PolarHBondContact O-N 3.02Å
7	Q	84.9	Confident	82.7	Confident	102 Å²	102	110.6 Å²	110.6	48%	0.477	57%	0.567	S	S	.	*	H	α-helix	trans	-66	-40.7	177.8	-63.2	-59.8	-23	0	0	111.8	E3 E4 L10 A11	E3-Q7 WeakPolarHBondContact O-CG 3.36Å; E3-Q7 PolarHBondContact O-N 2.86Å; E3-Q7 PolarHBondContact OE1-NE2 2.96Å; E4-Q7 PolarHBondContact O-N 2.91Å; Q7-L10 PolarHBondContact O-N 3.11Å; Q7-A11 WeakPolarHBondContact O-CB 3.43Å; Q7-A11 PolarHBondContact O-N 2.99Å
8	S	83.8	Confident	83.2	Confident	64 Å²	64	112.4 Å²	112.4	45%	0.448	57%	0.57	S	S	.	*	H	α-helix	trans	-61.3	-45.8	174	175.9	0	0	0	0	112	E4 L10 A11 I12	E4-S8 WeakPolarHBondContact O-CB 3.25Å; E4-S8 PolarHBondContact O-N 3.26Å; S8-L10 VanDerWaalsContact C-N 3.32Å; S8-L10 PolarHBondContact O-N 2.95Å; S8-A11 PolarHBondContact O-N 3.19Å; S8-I12 WeakPolarHBondContact O-CG1 3.33Å; S8-I12 PolarHBondContact O-N 3.39Å
9	K	91.6	Very high	83.6	Confident	141 Å²	141	111.8 Å²	111.8	61%	0.613	57%	0.565	S	S	*	*	H	α-helix	trans	-60.5	-40.3	175.1	-75.2	172.1	-178.9	-178.3	0	112.4	T5 R6 A13	T5-K9 HydrophobicContact CG2-CD 4.38Å; T5-K9 WeakPolarHBondContact O-CB 3.17Å; T5-K9 WeakPolarHBondContact O-CD 3.14Å; T5-K9 WeakPolarHBondContact O-CG 3.23Å; T5-K9 PolarHBondContact O-N 3.24Å; T5-K9 VanDerWaalsContact O-N 3.11Å; R6-K9 PolarHBondContact O-N 3.04Å; K9-A13 WeakPolarHBondContact O-CB 3.43Å; K9-A13 PolarHBondContact O-N 3.09Å; K9-A13 VanDerWaalsContact O-N 3.08Å
10	L	94.3	Very high	84.1	Confident	91 Å²	91	113.4 Å²	113.4	48%	0.476	57%	0.565	S	S	.	*	H	α-helix	trans	-66.8	-40.1	177.1	-177.7	62	0	0	0	112	R6 Q7 S8 A13 K14	R6-L10 WeakPolarHBondContact O-CB 3.39Å; R6-L10 PolarHBondContact O-N 3.02Å; Q7-L10 PolarHBondContact O-N 3.11Å; S8-L10 VanDerWaalsContact C-N 3.32Å; S8-L10 PolarHBondContact O-N 2.95Å; L10-A13 PolarHBondContact O-N 3.39Å; L10-K14 WeakPolarHBondContact O-CG 3.46Å; L10-K14 PolarHBondContact O-N 3.45Å
11	A	92.6	Very high	84.2	Confident	59 Å²	59	116.2 Å²	116.2	49%	0.488	57%	0.569	S	S	.	*	H	α-helix	trans	-61.9	-46.5	176.4	0	0	0	0	0	111.5	Q7 S8 A13 K14 E15	Q7-A11 WeakPolarHBondContact O-CB 3.43Å; Q7-A11 PolarHBondContact O-N 2.99Å; S8-A11 PolarHBondContact O-N 3.19Å; A11-A13 PolarHBondContact O-N 3.37Å; A11-K14 PolarHBondContact O-N 3.35Å; A11-E15 PolarHBondContact O-N 2.99Å; A11-E15 VanDerWaalsContact O-N 3.07Å
12	I	93.4	Very high	85.5	Confident	87 Å²	87	112.5 Å²	112.5	45%	0.446	55%	0.55	S	S	.	.	H	α-helix	trans	-60.9	-44	177	-65.3	163.8	0	0	0	111.1	S8 K14 E15 K16	S8-I12 WeakPolarHBondContact O-CG1 3.33Å; S8-I12 PolarHBondContact O-N 3.39Å; I12-K14 VanDerWaalsContact C-N 3.33Å; I12-K14 PolarHBondContact O-N 3.42Å; I12-E15 PolarHBondContact O-N 3.34Å; I12-K16 PolarHBondContact O-N 2.96Å; I12-K16 VanDerWaalsContact O-N 3.11Å
13	A	94.9	Very high	86.5	Confident	57 Å²	57	117.3 Å²	117.3	47%	0.471	55%	0.551	S	S	.	*	H	α-helix	trans	-63.3	-39.8	179.4	0	0	0	0	0	112.2	K9 L10 A11 L17	K9-A13 WeakPolarHBondContact O-CB 3.43Å; K9-A13 PolarHBondContact O-N 3.09Å; K9-A13 VanDerWaalsContact O-N 3.08Å; L10-A13 PolarHBondContact O-N 3.39Å; A11-A13 PolarHBondContact O-N 3.37Å; A13-L17 PolarHBondContact O-N 3.39Å; A13-L17 VanDerWaalsContact O-N 3.09Å
14	K	94.9	Very high	87.2	Confident	142 Å²	142	117.3 Å²	117.3	62%	0.617	56%	0.555	S	S	*	*	H	α-helix	trans	-64	-42	176.2	-82.6	180	152.6	-175.5	0	112.6	L10 A11 I12 L17 K18	L10-K14 WeakPolarHBondContact O-CG 3.46Å; L10-K14 PolarHBondContact O-N 3.45Å; A11-K14 PolarHBondContact O-N 3.35Å; I12-K14 VanDerWaalsContact C-N 3.33Å; I12-K14 PolarHBondContact O-N 3.42Å; K14-L17 PolarHBondContact O-N 3.28Å; K14-K18 PolarHBondContact O-N 2.98Å; K14-K18 VanDerWaalsContact O-N 3.1Å
15	E	95.4	Very high	87.6	Confident	126 Å²	126	113.9 Å²	113.9	59%	0.589	55%	0.545	S	S	*	.	H	α-helix	trans	-64	-46	178.3	-170.8	176.5	-169.2	0	0	111.5	A11 I12 L17 K18 E19	A11-E15 PolarHBondContact O-N 2.99Å; A11-E15 VanDerWaalsContact O-N 3.07Å; I12-E15 PolarHBondContact O-N 3.34Å; E15-L17 VanDerWaalsContact C-N 3.3Å; E15-L17 PolarHBondContact O-N 3.48Å; E15-K18 WeakPolarHBondContact O-CB 3.49Å; E15-K18 PolarHBondContact O-N 2.86Å; E15-K18 VanDerWaalsContact O-N 3.09Å; E15-E19 PolarHBondContact O-N 3.07Å
16	K	94.1	Very high	86.9	Confident	141 Å²	141	116.6 Å²	116.6	61%	0.613	56%	0.557	S	S	*	*	H	α-helix	trans	-61.6	-36.3	176.4	-73.2	-161.8	173.8	-169.7	0	113.4	I12 Y20	I12-K16 PolarHBondContact O-N 2.96Å; I12-K16 VanDerWaalsContact O-N 3.11Å; K16-Y20 WeakPolarHBondContact O-CB 3.48Å; K16-Y20 PolarHBondContact O-N 2.95Å
17	L	92.9	Very high	85.8	Confident	121 Å²	121	111 Å²	111	63%	0.634	55%	0.554	S	S	*	*	H	α-helix	trans	-64.8	-42	174.7	-177.5	63.9	0	0	0	111.3	A13 K14 E15 Y20 W21	A13-L17 PolarHBondContact O-N 3.39Å; A13-L17 VanDerWaalsContact O-N 3.09Å; K14-L17 PolarHBondContact O-N 3.28Å; E15-L17 VanDerWaalsContact C-N 3.3Å; E15-L17 PolarHBondContact O-N 3.48Å; L17-Y20 PolarHBondContact O-N 2.88Å; L17-W21 WeakPolarHBondContact O-CB 3.1Å; L17-W21 PolarHBondContact O-N 2.94Å
18	K	92.4	Very high	84.1	Confident	144 Å²	144	112 Å²	112	63%	0.626	57%	0.567	S	S	*	*	H	α-helix	trans	-64.4	-42.9	176.7	-173.8	-176.1	176.2	-172.2	0	111.9	K14 E15 W21 Q22	K14-K18 PolarHBondContact O-N 2.98Å; K14-K18 VanDerWaalsContact O-N 3.1Å; E15-K18 WeakPolarHBondContact O-CB 3.49Å; E15-K18 PolarHBondContact O-N 2.86Å; E15-K18 VanDerWaalsContact O-N 3.09Å; K18-W21 PolarHBondContact O-N 2.75Å; K18-Q22 WeakPolarHBondContact O-CG 3.47Å; K18-Q22 PolarHBondContact O-N 3.27Å
19	E	91	Very high	82.3	Confident	101 Å²	101	114.9 Å²	114.9	47%	0.472	58%	0.584	S	S	.	*	H	α-helix	trans	-63.1	-42.8	175.3	-79.1	-172.6	155.3	0	0	112.7	E15 W21 Q22 R23	E15-E19 PolarHBondContact O-N 3.07Å; E19-W21 VanDerWaalsContact C-N 3.32Å; E19-Q22 PolarHBondContact O-N 3.1Å; E19-R23 WeakPolarHBondContact O-CB 3.48Å; E19-R23 WeakPolarHBondContact O-CG 3.42Å; E19-R23 PolarHBondContact O-N 3.42Å
20	Y	92.8	Very high	80.4	Confident	143 Å²	143	112.7 Å²	112.7	56%	0.561	59%	0.592	S	S	*	*	H	α-helix	trans	-60.4	-46.2	175.9	178.4	-95.8	0	0	0	110.6	K16 L17 R23 N24	K16-Y20 WeakPolarHBondContact O-CB 3.48Å; K16-Y20 PolarHBondContact O-N 2.95Å; L17-Y20 PolarHBondContact O-N 2.88Å; Y20-R23 PolarHBondContact O-N 2.97Å; Y20-N24 VanDerWaalsContact O-CB 3.23Å; Y20-N24 WeakPolarHBondContact O-CB 3.42Å; Y20-N24 PolarHBondContact O-N 3.09Å
21	W	86.6	Confident	78.4	Confident	173 Å²	173	111.6 Å²	111.6	66%	0.655	60%	0.603	S	S	*	*	H	α-helix	trans	-62.4	-45.3	177.2	-160.8	81.8	0	0	0	111.3	L17 K18 E19 R23 N24 S25	L17-W21 WeakPolarHBondContact O-CB 3.1Å; L17-W21 PolarHBondContact O-N 2.94Å; K18-W21 PolarHBondContact O-N 2.75Å; E19-W21 VanDerWaalsContact C-N 3.32Å; W21-R23 PolarHBondContact O-N 3.46Å; W21-N24 PolarHBondContact O-N 3.37Å; W21-S25 WeakPolarHBondContact O-CA 3.49Å; W21-S25 WeakPolarHBondContact O-CB 3.42Å; W21-S25 PolarHBondContact O-N 3.15Å; W21-S25 PolarHBondContact O-OG 3.19Å
22	Q	84.9	Confident	75.9	Confident	106 Å²	106	114.8 Å²	114.8	50%	0.495	62%	0.616	S	S	.	*	H	α-helix	trans	-63.3	-41.4	177.3	-75.6	-145.5	-27.5	0	0	113.6	K18 E19 N24 L26	K18-Q22 WeakPolarHBondContact O-CG 3.47Å; K18-Q22 PolarHBondContact O-N 3.27Å; E19-Q22 PolarHBondContact O-N 3.1Å; Q22-N24 VanDerWaalsContact C-N 3.31Å; Q22-N24 PolarHBondContact O-N 3.25Å; Q22-L26 VanDerWaalsContact O-CB 3.25Å; Q22-L26 WeakPolarHBondContact O-CB 3.2Å; Q22-L26 WeakPolarHBondContact O-CG 3.45Å; Q22-L26 PolarHBondContact O-N 2.8Å
23	R	80.6	Confident	74.1	Confident	177 Å²	177	119.4 Å²	119.4	67%	0.668	63%	0.633	S	S	*	*	H	α-helix	trans	-69.4	-29.3	177.9	-72	-174.3	-67.3	132.8	-5.3	113.1	E19 Y20 W21	E19-R23 WeakPolarHBondContact O-CB 3.48Å; E19-R23 WeakPolarHBondContact O-CG 3.42Å; E19-R23 PolarHBondContact O-N 3.42Å; Y20-R23 PolarHBondContact O-N 2.97Å; W21-R23 PolarHBondContact O-N 3.46Å
24	N	73.4	Confident	72.1	Confident	109 Å²	109	126.4 Å²	126.4	58%	0.583	65%	0.647	S	S	*	*	H	α-helix	trans	-88.7	-29	178.9	-173.5	79	0	0	0	112.9	Y20 W21 Q22	Y20-N24 VanDerWaalsContact O-CB 3.23Å; Y20-N24 WeakPolarHBondContact O-CB 3.42Å; Y20-N24 PolarHBondContact O-N 3.09Å; W21-N24 PolarHBondContact O-N 3.37Å; Q22-N24 VanDerWaalsContact C-N 3.31Å; Q22-N24 PolarHBondContact O-N 3.25Å
25	S	72.1	Confident	70.2	Confident	60 Å²	60	126.2 Å²	126.2	42%	0.42	65%	0.653	S	S	.	*	H	α-helix	trans	-83.8	-28.4	177.4	-64.4	0	0	0	0	112.6	W21 G27	W21-S25 WeakPolarHBondContact O-CA 3.49Å; W21-S25 WeakPolarHBondContact O-CB 3.42Å; W21-S25 PolarHBondContact O-N 3.15Å; W21-S25 PolarHBondContact O-OG 3.19Å; S25-G27 VanDerWaalsContact C-N 3.32Å; S25-G27 PolarHBondContact O-N 3.39Å
26	L	59.1	Low	68.1	Low	129 Å²	129	130.4 Å²	130.4	68%	0.675	66%	0.663	S	S	*	*	S	Bend	trans	-87	77.3	169.2	-67.1	165.5	0	0	0	108.7	Q22	Q22-L26 VanDerWaalsContact O-CB 3.25Å; Q22-L26 WeakPolarHBondContact O-CB 3.2Å; Q22-L26 WeakPolarHBondContact O-CG 3.45Å; Q22-L26 PolarHBondContact O-N 2.8Å
27	G	56.1	Low	66.1	Low	59 Å²	59	133.3 Å²	133.3	61%	0.608	68%	0.676	S	S	*	*			trans	-52.7	139.3	172.8	0	0	0	0	0	111.7	S25	S25-G27 VanDerWaalsContact C-N 3.32Å; S25-G27 PolarHBondContact O-N 3.39Å
28	V	48.9	Very low	63.5	Low	123 Å²	123	132.6 Å²	132.6	75%	0.745	68%	0.676	S	S	*	*			trans	32.9	112.7	157	-179.1	0	0	0	0	115.1	A30	V28-A30 PolarHBondContact O-N 3.11Å
29	P	47.3	Very low	60.9	Low	124 Å²	124	131.4 Å²	131.4	81%	0.805	69%	0.686	S	S	*	*			trans	-64.7	94	164	27	-28.6	0	0	0	108.4	G31	P29-G31 PolarHBondContact O-N 3Å
30	A	51.5	Low	58.1	Low	94 Å²	94	130 Å²	130	78%	0.777	70%	0.699	S	S	*	*			trans	-65.8	114.5	166.3	0	0	0	0	0	107.6	V28	V28-A30 PolarHBondContact O-N 3.11Å
31	G	52.2	Low	55.3	Low	69 Å²	69	129.1 Å²	129.1	71%	0.711	71%	0.714	S	S	*	*			trans	78.4	73.1	158.8	0	0	0	0	0	116.4	P29 K33	P29-G31 PolarHBondContact O-N 3Å; G31-K33 PolarHBondContact O-N 3.21Å
32	V	39.8	Very low	52.9	Low	126 Å²	126	126.3 Å²	126.3	76%	0.764	72%	0.721	S	S	*	*			trans	-72.3	79.7	148.8	178	0	0	0	0	108	R34	V32-R34 HydrophobicContact CG1-CB 3.99Å; V32-R34 PolarHBondContact O-N 3Å
33	K	54.9	Low	51.6	Low	183 Å²	183	126.5 Å²	126.5	80%	0.796	73%	0.731	S	S	*	*			trans	-68	85.4	151.9	-178.1	-179.3	177.5	178.3	0	106.2	G31 N35	G31-K33 PolarHBondContact O-N 3.21Å; K33-N35 VanDerWaalsContact C-N 3.28Å; K33-N35 PolarHBondContact O-N 3.08Å
34	R	52.7	Low	49.4	Very low	205 Å²	205	126.4 Å²	126.4	77%	0.774	74%	0.738	S	S	*	*			trans	-64.1	88.5	170.7	50.5	-177.4	-159.7	91.4	2.9	109.4	V32 R36	V32-R34 HydrophobicContact CG1-CB 3.99Å; V32-R34 PolarHBondContact O-N 3Å; R34-R36 PolarHBondContact O-N 3.4Å
35	N	54.7	Low	47.4	Very low	138 Å²	138	127.3 Å²	127.3	74%	0.738	75%	0.748	S	S	*	*			trans	-76.1	71.5	168.6	55.2	9.7	0	0	0	109.8	K33 K37	K33-N35 VanDerWaalsContact C-N 3.28Å; K33-N35 PolarHBondContact O-N 3.08Å; N35-K37 VanDerWaalsContact C-N 3.34Å; N35-K37 PolarHBondContact O-N 3.44Å
36	R	52.7	Low	45.6	Very low	214 Å²	214	128.9 Å²	128.9	81%	0.808	76%	0.764	S	S	*	*			trans	-75.5	92	167.9	-171.1	171.9	177	172.6	-1.1	109	R34	R34-R36 PolarHBondContact O-N 3.4Å
37	K	52.5	Low	44.8	Very low	202 Å²	202	129.9 Å²	129.9	88%	0.878	78%	0.776	S	S	*	*			trans	-77.8	116.1	166.7	-162	163	-177.1	176.6	0	108.2	N35	N35-K37 VanDerWaalsContact C-N 3.34Å; N35-K37 PolarHBondContact O-N 3.44Å
38	T	37.6	Very low	44.6	Very low	105 Å²	105	132.6 Å²	132.6	64%	0.644	79%	0.785	S	S	*	*			trans	-155.5	105.1	158.5	-13.3	0	0	0	0	109.6
39	S	38.1	Very low	44.1	Very low	119 Å²	119	130.2 Å²	130.2	83%	0.832	79%	0.786	S	S	*	*			trans	2.3	135.9	159.1	42.8	0	0	0	0	122.4
40	G	31.7	Very low	43.7	Very low	71 Å²	71	127.9 Å²	127.9	73%	0.732	79%	0.785	S	S	*	*			trans	162	94.8	150.4	0	0	0	0	0	117.2
41	S	35	Very low	43.4	Very low	126 Å²	126	129.9 Å²	129.9	88%	0.881	79%	0.791	S	S	*	*			trans	59.8	123	156.1	73.6	0	0	0	0	123.9
42	S	35.7	Very low	43.1	Very low	114 Å²	114	135.7 Å²	135.7	80%	0.797	80%	0.799	S	S	*	*			trans	-82.1	-174.3	150.9	-53.3	0	0	0	0	111.2
43	P	57.1	Low	43.8	Very low	110 Å²	110	135.1 Å²	135.1	71%	0.714	80%	0.801	S	S	*	*			cis	-134.3	-179.9	-10.6	23.2	2.6	0	0	0	114.7
44	E	35	Very low	43.9	Very low	174 Å²	174	132.3 Å²	132.3	81%	0.813	80%	0.802	S	S	*	*			trans	131.1	121.7	137.3	-67	-161	126.8	0	0	119
45	T	30.7	Very low	43.3	Very low	128 Å²	128	131.8 Å²	131.8	79%	0.785	81%	0.808	S	S	*	*				61.9	108.6	129.4	-49.5	0	0	0	0	121
46	A	34.2	Very low	42.6	Very low	93 Å²	93	131.8 Å²	131.8	77%	0.769	81%	0.808	S	S	*	*				-172.7	111.3	123.5	0	0	0	0	0	111.4
47	T	43.3	Very low	42.3	Very low	150 Å²	150	127.3 Å²	127.3	92%	0.92	81%	0.81	S	S	*	*			trans	-61.9	127.9	157.9	-64.5	0	0	0	0	109.4
48	S	50	Low	42	Very low	116 Å²	116	121.2 Å²	121.2	81%	0.811	80%	0.797	S	S	*	*			trans	-161.9	119.7	163.6	-177.8	0	0	0	0	112.9
49	G	38.8	Very low	42.5	Very low	73 Å²	73	123.6 Å²	123.6	75%	0.753	81%	0.812	S	S	*	*			trans	61.6	104.9	158	0	0	0	0	0	116.6
50	G	39.1	Very low	42.5	Very low	76 Å²	76	121 Å²	121	78%	0.784	80%	0.803	S	S	*	*				79.7	86.4	51.2	0	0	0	0	0	110.4
51	C	45.5	Very low	43.2	Very low	135 Å²	135	125.4 Å²	125.4	91%	0.912	81%	0.808	S	S	*	*			trans	-165.1	117.6	151.7	-96	0	0	0	0	109.4
52	H	46.7	Very low	43.8	Very low	191 Å²	191	126 Å²	126	88%	0.884	80%	0.797	S	S	*	*			trans	-86	139.2	168.1	-71.8	-90.5	0	0	0	109.5
53	S	54	Low	44.1	Very low	115 Å²	115	124.4 Å²	124.4	80%	0.804	80%	0.798	S	S	*	*				-167.9	134.5	128.2	-91.5	0	0	0	0	110.6
54	P	57.2	Low	43.8	Very low	123 Å²	123	125.7 Å²	125.7	80%	0.799	79%	0.794	S	S	*	*			trans	-96.4	121.9	177.7	34.5	-24	0	0	0	109.4
55	E	39.2	Very low	44.2	Very low	194 Å²	194	120.8 Å²	120.8	91%	0.907	79%	0.791	S	S	*	*			trans	-140	136	170.2	-149.7	146.3	142.8	0	0	112.5
56	D	41.4	Very low	45.7	Very low	139 Å²	139	120.4 Å²	120.4	74%	0.743	79%	0.79	S	S	*	*			trans	-77.4	134.3	-166	-172.1	5.1	0	0	0	110.8
57	S	44.6	Very low	46.2	Very low	120 Å²	120	121.9 Å²	121.9	84%	0.839	79%	0.79	S	S	*	*			trans	-158.4	83	151.1	-8.6	0	0	0	0	108.7
58	A	47.8	Very low	46.4	Very low	74 Å²	74	120.1 Å²	120.1	61%	0.612	78%	0.784	S	S	*	*			trans	-54.9	164.5	149.3	0	0	0	0	0	110.6
59	T	47.9	Very low	46.4	Very low	155 Å²	155	119.5 Å²	119.5	95%	0.951	78%	0.78	S	S	*	*			trans	75.7	104.5	171.5	23.1	0	0	0	0	117.4
60	G	37.8	Very low	47	Very low	64 Å²	64	120.1 Å²	120.1	66%	0.66	78%	0.778	S	S	*	*			trans	175.4	87	162.8	0	0	0	0	0	114.2
61	I	46.4	Very low	47.7	Very low	163 Å²	163	120.4 Å²	120.4	84%	0.836	76%	0.764	S	S	*	*			trans	62.9	93	141.8	54.1	176.5	0	0	0	117.8	G63	I61-G63 PolarHBondContact O-N 3.28Å
62	H	46.8	Very low	48.1	Very low	140 Å²	140	119.7 Å²	119.7	65%	0.648	75%	0.751	S	S	*	*			trans	-32.4	104.6	137.5	179.6	-118.2	0	0	0	109.7	E64	H62-E64 IonicContact CE1-OE1 3.15Å; H62-E64 IonicContact CE1-OE2 3.63Å; H62-E64 PolarHBondContact CE1-OE2 3.04Å; H62-E64 IonicContact CG-OE1 2.72Å; H62-E64 WeakPolarHBondContact ND1-CG 3.42Å; H62-E64 IonicContact ND1-OE1 3.87Å; H62-E64 PolarHBondContact ND1-OE1 2.93Å; H62-E64 IonicContact ND1-OE2 2.8Å; H62-E64 PolarHBondContact ND1-OE2 2.9Å; H62-E64 PolarHBondContact O-N 3.49Å
63	G	42.4	Very low	48.6	Very low	79 Å²	79	118.8 Å²	118.8	81%	0.814	74%	0.744	S	S	*	*			trans	-74.3	62	174	0	0	0	0	0	110.4	I61 G65	I61-G63 PolarHBondContact O-N 3.28Å; G63-G65 PolarHBondContact O-N 2.86Å
64	E	52.1	Low	48.7	Very low	137 Å²	137	119.1 Å²	119.1	64%	0.64	74%	0.737	S	S	*	*			trans	-68.2	90.4	157.3	53.1	-154.2	140.1	0	0	107.6	H62 P66	H62-E64 IonicContact CE1-OE1 3.15Å; H62-E64 IonicContact CE1-OE2 3.63Å; H62-E64 PolarHBondContact CE1-OE2 3.04Å; H62-E64 IonicContact CG-OE1 2.72Å; H62-E64 WeakPolarHBondContact ND1-CG 3.42Å; H62-E64 IonicContact ND1-OE1 3.87Å; H62-E64 PolarHBondContact ND1-OE1 2.93Å; H62-E64 IonicContact ND1-OE2 2.8Å; H62-E64 PolarHBondContact ND1-OE2 2.9Å; H62-E64 PolarHBondContact O-N 3.49Å; E64-P66 WeakPolarHBondContact O-CD 3.47Å
65	G	41.8	Very low	48.6	Very low	72 Å²	72	118.3 Å²	118.3	74%	0.742	73%	0.725	S	S	*	*			trans	-62	114.9	169.8	0	0	0	0	0	109.3	G63 T67	G63-G65 PolarHBondContact O-N 2.86Å; G65-T67 PolarHBondContact O-N 3.46Å
66	P	61.9	Low	49.6	Very low	119 Å²	119	114.8 Å²	114.8	77%	0.773	71%	0.709	S	S	*	*			trans	-99.7	76.5	179.2	34.6	-21.1	0	0	0	108.5	E64	E64-P66 WeakPolarHBondContact O-CD 3.47Å
67	T	46	Very low	50.8	Low	125 Å²	125	111.9 Å²	111.9	77%	0.767	70%	0.7	S	S	*	*			trans	-159.2	67.9	164.8	-20	0	0	0	0	113.8	G65	G65-T67 PolarHBondContact O-N 3.46Å
68	S	48.1	Very low	52.1	Low	113 Å²	113	108.7 Å²	108.7	79%	0.79	68%	0.676	S	S	*	*	S	Bend	trans	-143	24.1	153.3	-79.8	0	0	0	0	112.3
69	S	49.9	Very low	53.2	Low	102 Å²	102	109.1 Å²	109.1	71%	0.713	67%	0.673	S	S	*	*	S	Bend	trans	-92.4	-7.6	177.1	-170.2	0	0	0	0	113.2	T71	S69-T71 VanDerWaalsContact C-N 3.34Å; S69-T71 PolarHBondContact O-N 2.85Å
70	A	50.1	Low	54.5	Low	86 Å²	86	107.9 Å²	107.9	71%	0.711	66%	0.657	S	S	*	*	S	Bend	trans	-77.8	-13.2	-178.9	0	0	0	0	0	114.3
71	T	54.9	Low	56.5	Low	82 Å²	82	111 Å²	111	50%	0.503	65%	0.654	S	S	.	*	S	Bend	trans	-106.6	-12.5	-168	-21.1	0	0	0	0	114.9	S69 L75	S69-T71 VanDerWaalsContact C-N 3.34Å; S69-T71 PolarHBondContact O-N 2.85Å; T71-L75 WeakPolarHBondContact O-CD1 3.43Å
72	L	52.4	Low	58.2	Low	121 Å²	121	108.3 Å²	108.3	63%	0.634	64%	0.641	S	S	*	*	H	α-helix	trans	-71.6	-43.5	-179.6	-150.6	-170.9	0	0	0	111	D74 L75 E76	L72-D74 VanDerWaalsContact C-N 3.29Å; L72-D74 PolarHBondContact O-N 3.26Å; L72-L75 PolarHBondContact O-N 3.37Å; L72-E76 PolarHBondContact O-N 3.35Å
73	K	57.5	Low	59.9	Low	172 Å²	172	103.9 Å²	103.9	75%	0.748	63%	0.629	S	S	*	*	H	α-helix	trans	-70.7	-26.5	-176	-50.2	-164.1	178.5	-166.8	0	113.1	L75	K73-L75 VanDerWaalsContact C-N 3.34Å
74	D	56.5	Low	61.8	Low	122 Å²	122	104.7 Å²	104.7	65%	0.652	62%	0.618	S	S	*	*	H	α-helix	trans	-78	-20.5	178.7	-158.1	48.7	0	0	0	112.4	L72 P78	L72-D74 VanDerWaalsContact C-N 3.29Å; L72-D74 PolarHBondContact O-N 3.26Å; D74-P78 WeakPolarHBondContact O-CD 3.46Å; D74-P78 WeakPolarHBondContact O-CG 3.09Å
75	L	55.8	Low	63.5	Low	105 Å²	105	101.9 Å²	101.9	55%	0.55	61%	0.61	S	S	.	*	H	α-helix	trans	-92	-18.1	176.8	-79.8	159.2	0	0	0	113.4	T71 L72 K73 P78 C79	T71-L75 WeakPolarHBondContact O-CD1 3.43Å; L72-L75 PolarHBondContact O-N 3.37Å; K73-L75 VanDerWaalsContact C-N 3.34Å; L75-P78 WeakPolarHBondContact O-CD 3.21Å; L75-C79 PolarHBondContact O-N 3.11Å; L75-C79 PolarHBondContact O-SG 3.34Å
76	E	59.9	Low	65.7	Low	120 Å²	120	103.5 Å²	103.5	56%	0.561	60%	0.601	S	S	*	*	H	α-helix	trans	-75.1	-35.7	-179.1	-168.4	146.3	170.5	0	0	112.7	L72 C79 Q80	L72-E76 PolarHBondContact O-N 3.35Å; E76-C79 PolarHBondContact O-N 3.38Å; E76-Q80 WeakPolarHBondContact O-CB 3.45Å; E76-Q80 PolarHBondContact O-N 3.13Å
77	S	65.6	Low	67	Low	79 Å²	79	103 Å²	103	55%	0.552	59%	0.592	S	S	*	*	H	α-helix	trans	-60.2	-49.5	174.4	136.4	0	0	0	0	112.8	C79 Q80 E81	S77-C79 VanDerWaalsContact C-N 3.29Å; S77-C79 PolarHBondContact O-N 3.41Å; S77-Q80 PolarHBondContact O-N 3.35Å; S77-E81 WeakPolarHBondContact O-CB 3.41Å; S77-E81 PolarHBondContact O-N 2.89Å
78	P	72.3	Confident	69.2	Low	53 Å²	53	99.6 Å²	99.6	34%	0.344	57%	0.573	S	S	.	*	H	α-helix	trans	-60.4	-36.9	174.1	-24.9	32	0	0	0	113	D74 L75 L82	D74-P78 WeakPolarHBondContact O-CD 3.46Å; D74-P78 WeakPolarHBondContact O-CG 3.09Å; L75-P78 WeakPolarHBondContact O-CD 3.21Å; P78-L82 WeakPolarHBondContact O-CB 3.23Å; P78-L82 WeakPolarHBondContact O-CG 3.41Å; P78-L82 PolarHBondContact O-N 2.98Å
79	C	70.6	Confident	71.4	Confident	82 Å²	82	102 Å²	102	55%	0.554	56%	0.564	S	S	*	*	H	α-helix	trans	-67.5	-41.6	178.6	-67.9	0	0	0	0	111.9	L75 E76 S77 A83	L75-C79 PolarHBondContact O-N 3.11Å; L75-C79 PolarHBondContact O-SG 3.34Å; E76-C79 PolarHBondContact O-N 3.38Å; S77-C79 VanDerWaalsContact C-N 3.29Å; S77-C79 PolarHBondContact O-N 3.41Å; C79-A83 PolarHBondContact O-N 2.94Å; C79-A83 VanDerWaalsContact O-N 3.13Å
80	Q	75.8	Confident	73.4	Confident	129 Å²	129	100.6 Å²	100.6	60%	0.603	56%	0.555	S	S	*	*	H	α-helix	trans	-65.5	-42.6	176.3	-161.4	80.3	16.6	0	0	111.4	E76 S77 A83 V84	E76-Q80 WeakPolarHBondContact O-CB 3.45Å; E76-Q80 PolarHBondContact O-N 3.13Å; S77-Q80 PolarHBondContact O-N 3.35Å; Q80-A83 PolarHBondContact O-N 3.39Å; Q80-V84 WeakPolarHBondContact O-CG2 3.5Å; Q80-V84 PolarHBondContact O-N 3.16Å
81	E	79.6	Confident	75.4	Confident	129 Å²	129	102 Å²	102	60%	0.603	55%	0.549	S	S	*	.	H	α-helix	trans	-63.2	-44.7	177.9	-173.6	-179	165.5	0	0	111.6	S77 A83 V84 V85	S77-E81 WeakPolarHBondContact O-CB 3.41Å; S77-E81 PolarHBondContact O-N 2.89Å; E81-A83 VanDerWaalsContact C-N 3.32Å; E81-A83 PolarHBondContact O-N 3.27Å; E81-V84 PolarHBondContact O-N 2.85Å; E81-V85 WeakPolarHBondContact O-CG2 3.32Å; E81-V85 PolarHBondContact O-N 2.93Å
82	L	82.8	Confident	77.4	Confident	108 Å²	108	104.5 Å²	104.5	57%	0.565	55%	0.553	S	S	*	*	H	α-helix	trans	-62.9	-37.4	176.9	-72.8	175	0	0	0	112.3	P78 V85 L86	P78-L82 WeakPolarHBondContact O-CB 3.23Å; P78-L82 WeakPolarHBondContact O-CG 3.41Å; P78-L82 PolarHBondContact O-N 2.98Å; L82-V85 PolarHBondContact O-N 2.99Å; L82-L86 WeakPolarHBondContact O-CB 3.24Å; L82-L86 VanDerWaalsContact O-CG 3.23Å; L82-L86 WeakPolarHBondContact O-CG 3.46Å; L82-L86 PolarHBondContact O-N 3.32Å
83	A	81	Confident	79.3	Confident	47 Å²	47	103.4 Å²	103.4	39%	0.388	55%	0.547	S	S	.	.	H	α-helix	trans	-60.8	-47.2	175.8	0	0	0	0	0	111.5	C79 Q80 E81 V85 L86 D87	C79-A83 PolarHBondContact O-N 2.94Å; C79-A83 VanDerWaalsContact O-N 3.13Å; Q80-A83 PolarHBondContact O-N 3.39Å; E81-A83 VanDerWaalsContact C-N 3.32Å; E81-A83 PolarHBondContact O-N 3.27Å; A83-V85 VanDerWaalsContact C-N 3.33Å; A83-V85 PolarHBondContact O-N 3.25Å; A83-L86 PolarHBondContact O-N 3.32Å; A83-D87 PolarHBondContact O-N 2.97Å
84	V	82.6	Confident	81.1	Confident	95 Å²	95	98 Å²	98	58%	0.576	53%	0.531	S	S	*	.	H	α-helix	trans	-62.9	-40.1	177.5	175.9	0	0	0	0	111.6	Q80 E81 S88	Q80-V84 WeakPolarHBondContact O-CG2 3.5Å; Q80-V84 PolarHBondContact O-N 3.16Å; E81-V84 PolarHBondContact O-N 2.85Å; V84-S88 WeakPolarHBondContact O-CB 3.4Å; V84-S88 PolarHBondContact O-N 3.3Å
85	V	87.9	Confident	82.9	Confident	78 Å²	78	98.4 Å²	98.4	47%	0.473	53%	0.529	S	S	.	.	H	α-helix	trans	-65	-41.6	176.4	170.6	0	0	0	0	111.5	E81 L82 A83 S88 R89	E81-V85 WeakPolarHBondContact O-CG2 3.32Å; E81-V85 PolarHBondContact O-N 2.93Å; L82-V85 PolarHBondContact O-N 2.99Å; A83-V85 VanDerWaalsContact C-N 3.33Å; A83-V85 PolarHBondContact O-N 3.25Å; V85-S88 PolarHBondContact O-N 2.96Å; V85-R89 WeakPolarHBondContact O-CB 3.47Å; V85-R89 PolarHBondContact O-N 3.5Å
86	L	88.4	Confident	84.8	Confident	107 Å²	107	98.4 Å²	98.4	56%	0.56	53%	0.529	S	S	*	.	H	α-helix	trans	-66.1	-41.6	178	-72.9	176	0	0	0	112	L82 A83 R89 S90	L82-L86 WeakPolarHBondContact O-CB 3.24Å; L82-L86 VanDerWaalsContact O-CG 3.23Å; L82-L86 WeakPolarHBondContact O-CG 3.46Å; L82-L86 PolarHBondContact O-N 3.32Å; A83-L86 PolarHBondContact O-N 3.32Å; L86-R89 PolarHBondContact O-N 3.42Å; L86-S90 WeakPolarHBondContact O-CB 3.36Å; L86-S90 PolarHBondContact O-N 3.22Å
87	D	89.8	Confident	86.5	Confident	108 Å²	108	96.5 Å²	96.5	58%	0.578	52%	0.523	S	S	*	.	H	α-helix	trans	-64.3	-45.6	176	-77.2	-16.7	0	0	0	111.5	A83 R89 S90 I91	A83-D87 PolarHBondContact O-N 2.97Å; D87-R89 VanDerWaalsContact C-N 3.26Å; D87-R89 PolarHBondContact O-N 2.99Å; D87-S90 WeakPolarHBondContact O-CB 3.41Å; D87-S90 PolarHBondContact O-N 2.89Å; D87-S90 VanDerWaalsContact O-N 3.16Å; D87-I91 WeakPolarHBondContact O-CG1 3.39Å; D87-I91 PolarHBondContact O-N 3.25Å
88	S	91.4	Very high	87.9	Confident	53 Å²	53	97.5 Å²	97.5	37%	0.371	52%	0.522	S	S	.	.	H	α-helix	trans	-57.3	-41.6	173.8	-173.4	0	0	0	0	111.8	V84 V85 I91 K92	V84-S88 WeakPolarHBondContact O-CB 3.4Å; V84-S88 PolarHBondContact O-N 3.3Å; V85-S88 PolarHBondContact O-N 2.96Å; S88-I91 PolarHBondContact O-N 3.24Å; S88-K92 WeakPolarHBondContact O-CG 3.3Å; S88-K92 PolarHBondContact O-N 3.46Å; S88-K92 VanDerWaalsContact O-N 3.13Å
89	R	94.5	Very high	89	Confident	163 Å²	163	99 Å²	99	62%	0.615	53%	0.53	S	S	*	.	H	α-helix	trans	-67.4	-40.4	177.5	-168.8	179.9	-177.7	-171.7	1.6	111.9	V85 L86 D87 I91 K92 I93	V85-R89 WeakPolarHBondContact O-CB 3.47Å; V85-R89 PolarHBondContact O-N 3.5Å; L86-R89 PolarHBondContact O-N 3.42Å; D87-R89 VanDerWaalsContact C-N 3.26Å; D87-R89 PolarHBondContact O-N 2.99Å; R89-I91 VanDerWaalsContact C-N 3.35Å; R89-K92 PolarHBondContact O-N 3Å; R89-I93 HydrophobicContact CG-CD1 3.93Å; R89-I93 HydrophobicContact CG-CG1 4.48Å; R89-I93 VanDerWaalsContact O-CG1 3.24Å; R89-I93 WeakPolarHBondContact O-CG1 3.48Å; R89-I93 PolarHBondContact O-N 3.28Å
90	S	91.8	Very high	90.3	Very high	73 Å²	73	99.5 Å²	99.5	51%	0.51	53%	0.526	S	S	.	.	H	α-helix	trans	-58.9	-45.9	175.6	-175.6	0	0	0	0	111.4	L86 D87 K92 I93 S94	L86-S90 WeakPolarHBondContact O-CB 3.36Å; L86-S90 PolarHBondContact O-N 3.22Å; D87-S90 WeakPolarHBondContact O-CB 3.41Å; D87-S90 PolarHBondContact O-N 2.89Å; D87-S90 VanDerWaalsContact O-N 3.16Å; S90-K92 PolarHBondContact O-N 2.98Å; S90-I93 PolarHBondContact O-N 3.4Å; S90-S94 PolarHBondContact O-N 3.41Å
91	I	93.1	Very high	91.2	Very high	116 Å²	116	99 Å²	99	60%	0.595	52%	0.522	S	S	*	.	H	α-helix	trans	-58.8	-49	176.2	-66	165.2	0	0	0	110.4	D87 S88 R89 I93 S94 Q95	D87-I91 WeakPolarHBondContact O-CG1 3.39Å; D87-I91 PolarHBondContact O-N 3.25Å; S88-I91 PolarHBondContact O-N 3.24Å; R89-I91 VanDerWaalsContact C-N 3.35Å; I91-I93 PolarHBondContact O-N 3.26Å; I91-S94 PolarHBondContact O-N 3.13Å; I91-S94 PolarHBondContact O-OG 3.47Å; I91-Q95 PolarHBondContact O-N 3.41Å
92	K	95.2	Very high	91.9	Very high	134 Å²	134	96.1 Å²	96.1	58%	0.583	52%	0.516	S	S	*	.	H	α-helix	trans	-61.5	-39.8	178.1	-71.1	175.4	-178.6	174.9	0	113.1	S88 R89 S90 Q95 L96	S88-K92 WeakPolarHBondContact O-CG 3.3Å; S88-K92 PolarHBondContact O-N 3.46Å; S88-K92 VanDerWaalsContact O-N 3.13Å; R89-K92 PolarHBondContact O-N 3Å; S90-K92 PolarHBondContact O-N 2.98Å; K92-Q95 PolarHBondContact O-N 3.33Å; K92-L96 WeakPolarHBondContact O-CB 3.44Å; K92-L96 PolarHBondContact O-N 2.89Å
93	I	93.8	Very high	92.5	Very high	99 Å²	99	96.9 Å²	96.9	51%	0.508	52%	0.52	S	S	.	.	H	α-helix	trans	-64.7	-43.3	178.1	-71	165.3	0	0	0	110.6	R89 S90 I91 L96 N97	R89-I93 HydrophobicContact CG-CD1 3.93Å; R89-I93 HydrophobicContact CG-CG1 4.48Å; R89-I93 VanDerWaalsContact O-CG1 3.24Å; R89-I93 WeakPolarHBondContact O-CG1 3.48Å; R89-I93 PolarHBondContact O-N 3.28Å; S90-I93 PolarHBondContact O-N 3.4Å; I91-I93 PolarHBondContact O-N 3.26Å; I93-L96 PolarHBondContact O-N 3.09Å; I93-N97 WeakPolarHBondContact O-CB 3.28Å; I93-N97 PolarHBondContact O-N 3.03Å
94	S	93.8	Very high	93.2	Very high	59 Å²	59	98.4 Å²	98.4	41%	0.413	52%	0.524	S	S	.	.	H	α-helix	trans	-64.8	-40	177.8	70.2	0	0	0	0	112.1	S90 I91 N97 N98	S90-S94 PolarHBondContact O-N 3.41Å; I91-S94 PolarHBondContact O-N 3.13Å; I91-S94 PolarHBondContact O-OG 3.47Å; S94-N97 PolarHBondContact O-N 3.12Å; S94-N98 PolarHBondContact O-N 2.98Å; S94-N98 VanDerWaalsContact O-N 3.09Å; S94-N98 PolarHBondContact O-ND2 3.45Å; S94-N98 VanDerWaalsContact O-ND2 3.12Å
95	Q	94.8	Very high	93.6	Very high	129 Å²	129	98.8 Å²	98.8	60%	0.603	52%	0.522	S	S	*	.	H	α-helix	trans	-59.1	-48.9	173.4	-170.3	-175.3	26.3	0	0	111.3	I91 K92 N97 N98 T99	I91-Q95 PolarHBondContact O-N 3.41Å; K92-Q95 PolarHBondContact O-N 3.33Å; Q95-N97 VanDerWaalsContact C-N 3.33Å; Q95-N97 PolarHBondContact O-N 2.92Å; Q95-N98 PolarHBondContact O-N 3.25Å; Q95-T99 PolarHBondContact O-N 3.43Å; Q95-T99 PolarHBondContact O-OG1 3.28Å
96	L	95.9	Very high	93.8	Very high	106 Å²	106	100.9 Å²	100.9	56%	0.555	53%	0.528	S	S	*	.	H	α-helix	trans	-61.7	-40.5	179.2	-176.3	62.5	0	0	0	112.1	K92 I93 N98 T99 I100	K92-L96 WeakPolarHBondContact O-CB 3.44Å; K92-L96 PolarHBondContact O-N 2.89Å; I93-L96 PolarHBondContact O-N 3.09Å; L96-N98 VanDerWaalsContact C-N 3.33Å; L96-N98 PolarHBondContact O-N 3.48Å; L96-T99 PolarHBondContact O-N 3.35Å; L96-I100 HydrophobicContact CD1-CD1 4.34Å; L96-I100 HydrophobicContact CD1-CG1 4.47Å; L96-I100 HydrophobicContact CG-CD1 3.94Å; L96-I100 HydrophobicContact CG-CG1 4.5Å; L96-I100 VanDerWaalsContact O-CG1 3.3Å; L96-I100 WeakPolarHBondContact O-CG1 3.47Å; L96-I100 PolarHBondContact O-N 2.95Å
97	N	96	Very high	94	Very high	80 Å²	80	98.1 Å²	98.1	43%	0.428	52%	0.521	S	S	.	.	H	α-helix	trans	-60.2	-44.7	176.7	-170.8	-34	0	0	0	111.4	I93 S94 Q95 T99 I100 K101	I93-N97 WeakPolarHBondContact O-CB 3.28Å; I93-N97 PolarHBondContact O-N 3.03Å; S94-N97 PolarHBondContact O-N 3.12Å; Q95-N97 VanDerWaalsContact C-N 3.33Å; Q95-N97 PolarHBondContact O-N 2.92Å; N97-T99 PolarHBondContact O-N 3.27Å; N97-I100 PolarHBondContact O-N 2.85Å; N97-K101 WeakPolarHBondContact O-CG 3.27Å; N97-K101 PolarHBondContact O-N 2.91Å; N97-K101 VanDerWaalsContact OD1-CE 3.27Å; N97-K101 WeakPolarHBondContact OD1-CE 3.4Å
98	N	94.7	Very high	93.8	Very high	100 Å²	100	97.9 Å²	97.9	54%	0.535	52%	0.519	S	S	.	.	H	α-helix	trans	-62.9	-41.4	176.4	-70.6	-37.7	0	0	0	112	S94 Q95 L96 K101 S102	S94-N98 PolarHBondContact O-N 2.98Å; S94-N98 VanDerWaalsContact O-N 3.09Å; S94-N98 PolarHBondContact O-ND2 3.45Å; S94-N98 VanDerWaalsContact O-ND2 3.12Å; Q95-N98 PolarHBondContact O-N 3.25Å; L96-N98 VanDerWaalsContact C-N 3.33Å; L96-N98 PolarHBondContact O-N 3.48Å; N98-K101 PolarHBondContact O-N 3.28Å; N98-S102 PolarHBondContact O-N 3.47Å
99	T	96	Very high	93.5	Very high	83 Å²	83	99.8 Å²	99.8	51%	0.509	52%	0.524	S	S	.	.	H	α-helix	trans	-61.5	-46.5	174.5	-57.2	0	0	0	0	111.8	Q95 L96 N97 K101 S102 L103	Q95-T99 PolarHBondContact O-N 3.43Å; Q95-T99 PolarHBondContact O-OG1 3.28Å; L96-T99 PolarHBondContact O-N 3.35Å; N97-T99 PolarHBondContact O-N 3.27Å; T99-K101 PolarHBondContact O-N 2.74Å; T99-S102 PolarHBondContact O-N 2.99Å; T99-L103 WeakPolarHBondContact O-CB 3.37Å; T99-L103 PolarHBondContact O-N 2.9Å
100	I	96.6	Very high	93.1	Very high	93 Å²	93	96.4 Å²	96.4	48%	0.477	52%	0.518	S	S	.	.	H	α-helix	trans	-60.4	-46.7	178.1	-69.6	166.2	0	0	0	110.4	L96 N97 S102 L103 V104	L96-I100 HydrophobicContact CD1-CD1 4.34Å; L96-I100 HydrophobicContact CD1-CG1 4.47Å; L96-I100 HydrophobicContact CG-CD1 3.94Å; L96-I100 HydrophobicContact CG-CG1 4.5Å; L96-I100 VanDerWaalsContact O-CG1 3.3Å; L96-I100 WeakPolarHBondContact O-CG1 3.47Å; L96-I100 PolarHBondContact O-N 2.95Å; N97-I100 PolarHBondContact O-N 2.85Å; I100-S102 VanDerWaalsContact C-N 3.35Å; I100-S102 PolarHBondContact O-N 3.43Å; I100-L103 PolarHBondContact O-N 3.45Å; I100-V104 HydrophobicContact CG2-CG2 4.31Å; I100-V104 WeakPolarHBondContact O-CB 3.46Å; I100-V104 VanDerWaalsContact O-CG2 3.28Å; I100-V104 WeakPolarHBondContact O-CG2 3.43Å; I100-V104 PolarHBondContact O-N 3.38Å
101	K	95.9	Very high	92.5	Very high	120 Å²	120	98 Å²	98	52%	0.522	53%	0.525	S	S	.	.	H	α-helix	trans	-57.3	-47.4	176.6	-78.7	177.7	174.4	177.4	0	111.9	N97 N98 T99 L103 V104 I105	N97-K101 WeakPolarHBondContact O-CG 3.27Å; N97-K101 PolarHBondContact O-N 2.91Å; N97-K101 VanDerWaalsContact OD1-CE 3.27Å; N97-K101 WeakPolarHBondContact OD1-CE 3.4Å; N98-K101 PolarHBondContact O-N 3.28Å; T99-K101 PolarHBondContact O-N 2.74Å; K101-L103 VanDerWaalsContact C-N 3.35Å; K101-L103 PolarHBondContact O-N 3.32Å; K101-V104 PolarHBondContact O-N 3.01Å; K101-I105 VanDerWaalsContact O-CG1 3.28Å; K101-I105 WeakPolarHBondContact O-CG1 3.45Å; K101-I105 PolarHBondContact O-N 3.4Å
102	S	94.2	Very high	91.8	Very high	68 Å²	68	99.1 Å²	99.1	48%	0.476	53%	0.525	S	S	.	.	H	α-helix	trans	-61.3	-43.6	177.9	179.7	0	0	0	0	111.8	N98 T99 I100 V104 I105 M106	N98-S102 PolarHBondContact O-N 3.47Å; T99-S102 PolarHBondContact O-N 2.99Å; I100-S102 VanDerWaalsContact C-N 3.35Å; I100-S102 PolarHBondContact O-N 3.43Å; S102-V104 PolarHBondContact O-N 3.22Å; S102-I105 PolarHBondContact O-N 2.77Å; S102-M106 WeakPolarHBondContact O-CB 3.44Å; S102-M106 VanDerWaalsContact O-CG 3.3Å; S102-M106 WeakPolarHBondContact O-CG 3.46Å; S102-M106 PolarHBondContact O-N 3.23Å
103	L	95.7	Very high	90.8	Very high	124 Å²	124	95.6 Å²	95.6	65%	0.649	52%	0.515	S	S	*	.	H	α-helix	trans	-66.2	-39.6	179.6	-163.1	69.8	0	0	0	112.1	T99 I100 K101 M106 A107	T99-L103 WeakPolarHBondContact O-CB 3.37Å; T99-L103 PolarHBondContact O-N 2.9Å; I100-L103 PolarHBondContact O-N 3.45Å; K101-L103 VanDerWaalsContact C-N 3.35Å; K101-L103 PolarHBondContact O-N 3.32Å; L103-M106 PolarHBondContact O-N 3.2Å; L103-A107 VanDerWaalsContact O-CB 3.31Å; L103-A107 WeakPolarHBondContact O-CB 3.09Å; L103-A107 PolarHBondContact O-N 2.95Å
104	V	94.3	Very high	89.7	Confident	78 Å²	78	96.6 Å²	96.6	47%	0.473	52%	0.516	S	S	.	.	H	α-helix	trans	-62.2	-43.7	173.8	168.7	0	0	0	0	110.6	I100 K101 S102 A107 N108	I100-V104 HydrophobicContact CG2-CG2 4.31Å; I100-V104 WeakPolarHBondContact O-CB 3.46Å; I100-V104 VanDerWaalsContact O-CG2 3.28Å; I100-V104 WeakPolarHBondContact O-CG2 3.43Å; I100-V104 PolarHBondContact O-N 3.38Å; K101-V104 PolarHBondContact O-N 3.01Å; S102-V104 PolarHBondContact O-N 3.22Å; V104-A107 PolarHBondContact O-N 2.87Å; V104-N108 WeakPolarHBondContact CG1-ND2 3.23Å; V104-N108 WeakPolarHBondContact O-CB 3.44Å; V104-N108 PolarHBondContact O-N 3.49Å; V104-N108 PolarHBondContact O-ND2 2.98Å
105	I	92.6	Very high	88.7	Confident	103 Å²	103	97.1 Å²	97.1	53%	0.528	52%	0.518	S	S	.	.	H	α-helix	trans	-62.9	-47.7	176.5	-67.9	164.1	0	0	0	110.5	K101 S102 A107 N108 I109	K101-I105 VanDerWaalsContact O-CG1 3.28Å; K101-I105 WeakPolarHBondContact O-CG1 3.45Å; K101-I105 PolarHBondContact O-N 3.4Å; S102-I105 PolarHBondContact O-N 2.77Å; I105-A107 PolarHBondContact O-N 2.94Å; I105-N108 PolarHBondContact O-N 3.39Å; I105-I109 HydrophobicContact CG2-CD1 3.84Å; I105-I109 HydrophobicContact CG2-CG1 4.49Å; I105-I109 WeakPolarHBondContact O-CG1 3.31Å; I105-I109 PolarHBondContact O-N 2.97Å
106	M	92.1	Very high	87.6	Confident	123 Å²	123	95.7 Å²	95.7	61%	0.606	51%	0.51	S	S	*	.	H	α-helix	trans	-57.7	-46.1	177.1	-75.3	-80.6	-76.2	0	0	111.9	S102 L103 I109 L110	S102-M106 WeakPolarHBondContact O-CB 3.44Å; S102-M106 VanDerWaalsContact O-CG 3.3Å; S102-M106 WeakPolarHBondContact O-CG 3.46Å; S102-M106 PolarHBondContact O-N 3.23Å; L103-M106 PolarHBondContact O-N 3.2Å; M106-I109 PolarHBondContact O-N 3.02Å; M106-L110 WeakPolarHBondContact O-CB 3.3Å; M106-L110 PolarHBondContact O-N 3.39Å
107	A	91.1	Very high	86.4	Confident	49 Å²	49	93.4 Å²	93.4	41%	0.405	50%	0.502	S	S	.	.	H	α-helix	trans	-64.1	-41.2	177.8	0	0	0	0	0	111.9	L103 V104 I105 L110 V111	L103-A107 VanDerWaalsContact O-CB 3.31Å; L103-A107 WeakPolarHBondContact O-CB 3.09Å; L103-A107 PolarHBondContact O-N 2.95Å; V104-A107 PolarHBondContact O-N 2.87Å; I105-A107 PolarHBondContact O-N 2.94Å; A107-L110 WeakPolarHBondContact O-CB 3.3Å; A107-L110 PolarHBondContact O-N 3.24Å; A107-V111 WeakPolarHBondContact O-CB 3.24Å; A107-V111 VanDerWaalsContact O-CG2 3.23Å; A107-V111 WeakPolarHBondContact O-CG2 3.33Å; A107-V111 PolarHBondContact O-N 2.99Å
108	N	86.9	Confident	85.3	Confident	102 Å²	102	94.5 Å²	94.5	55%	0.545	51%	0.507	S	S	.	.	H	α-helix	trans	-63.7	-41.7	176	-79.9	-60.6	0	0	0	112.1	V104 I105 V111 F112	V104-N108 WeakPolarHBondContact CG1-ND2 3.23Å; V104-N108 WeakPolarHBondContact O-CB 3.44Å; V104-N108 PolarHBondContact O-N 3.49Å; V104-N108 PolarHBondContact O-ND2 2.98Å; I105-N108 PolarHBondContact O-N 3.39Å; N108-V111 PolarHBondContact O-N 3.19Å; N108-F112 VanDerWaalsContact O-CB 3.3Å; N108-F112 WeakPolarHBondContact O-CB 3.33Å; N108-F112 PolarHBondContact O-N 3.48Å
109	I	84.6	Confident	84.3	Confident	93 Å²	93	94.5 Å²	94.5	48%	0.477	51%	0.51	S	S	.	.	H	α-helix	trans	-61.9	-46.9	174	-67.6	167.9	0	0	0	109.7	I105 M106 V111 F112 V113	I105-I109 HydrophobicContact CG2-CD1 3.84Å; I105-I109 HydrophobicContact CG2-CG1 4.49Å; I105-I109 WeakPolarHBondContact O-CG1 3.31Å; I105-I109 PolarHBondContact O-N 2.97Å; M106-I109 PolarHBondContact O-N 3.02Å; I109-V111 VanDerWaalsContact C-N 3.35Å; I109-V111 PolarHBondContact O-N 3.08Å; I109-F112 PolarHBondContact O-N 2.82Å; I109-V113 HydrophobicContact CG2-CB 4.45Å; I109-V113 HydrophobicContact CG2-CG2 3.86Å; I109-V113 WeakPolarHBondContact O-CB 3.46Å; I109-V113 VanDerWaalsContact O-CG2 3.26Å; I109-V113 WeakPolarHBondContact O-CG2 3.25Å; I109-V113 PolarHBondContact O-N 3.24Å
110	L	85.3	Confident	83.5	Confident	93 Å²	93	95.1 Å²	95.1	49%	0.487	51%	0.51	S	S	.	.	H	α-helix	trans	-55.7	-50.8	178.2	-162.9	83.7	0	0	0	110.9	M106 A107 F112 F114	M106-L110 WeakPolarHBondContact O-CB 3.3Å; M106-L110 PolarHBondContact O-N 3.39Å; A107-L110 WeakPolarHBondContact O-CB 3.3Å; A107-L110 PolarHBondContact O-N 3.24Å; L110-F112 VanDerWaalsContact C-N 3.32Å; L110-F112 PolarHBondContact O-N 3.41Å; L110-F114 HydrophobicContact CB-CD2 4.4Å; L110-F114 HydrophobicContact CD1-CD2 3.43Å; L110-F114 VanDerWaalsContact CD1-CD2 3.43Å; L110-F114 HydrophobicContact CD1-CE1 4.43Å; L110-F114 HydrophobicContact CD1-CE2 3.05Å; L110-F114 HydrophobicContact CD1-CG 4.29Å; L110-F114 HydrophobicContact CD1-CZ 3.61Å; L110-F114 HydrophobicContact CG-CD2 3.75Å; L110-F114 HydrophobicContact CG-CE2 3.92Å; L110-F114 HydrophobicContact CG-CG 4.38Å; L110-F114 WeakPolarHBondContact O-CB 3.17Å; L110-F114 WeakPolarHBondContact O-CD2 3.28Å; L110-F114 PolarHBondContact O-N 3.45Å
111	V	80.9	Confident	82.5	Confident	107 Å²	107	95.2 Å²	95.2	65%	0.648	51%	0.511	S	S	*	.	H	α-helix	trans	-66.9	-31.9	-178.1	173.7	0	0	0	0	112.3	A107 N108 I109 P115	A107-V111 WeakPolarHBondContact O-CB 3.24Å; A107-V111 VanDerWaalsContact O-CG2 3.23Å; A107-V111 WeakPolarHBondContact O-CG2 3.33Å; A107-V111 PolarHBondContact O-N 2.99Å; N108-V111 PolarHBondContact O-N 3.19Å; I109-V111 VanDerWaalsContact C-N 3.35Å; I109-V111 PolarHBondContact O-N 3.08Å; V111-P115 WeakPolarHBondContact O-CD 3.21Å; V111-P115 VanDerWaalsContact O-CG 3.24Å; V111-P115 WeakPolarHBondContact O-CG 3.42Å
112	F	76.8	Confident	81.6	Confident	138 Å²	138	95 Å²	95	61%	0.605	52%	0.515	S	S	*	.	H	α-helix	trans	-88.7	-33.3	-177.8	-168.9	-98.5	0	0	0	113.9	N108 I109 L110 K116	N108-F112 VanDerWaalsContact O-CB 3.3Å; N108-F112 WeakPolarHBondContact O-CB 3.33Å; N108-F112 PolarHBondContact O-N 3.48Å; I109-F112 PolarHBondContact O-N 2.82Å; L110-F112 VanDerWaalsContact C-N 3.32Å; L110-F112 PolarHBondContact O-N 3.41Å; F112-K116 HydrophobicContact CD1-CD 4.44Å; F112-K116 VanDerWaalsContact CD2-NZ 3.28Å; F112-K116 HydrophobicContact CE1-CD 4.16Å; F112-K116 WeakPolarHBondContact O-CG 3.41Å; F112-K116 PolarHBondContact O-NZ 3.25Å
113	V	75.3	Confident	80.7	Confident	60 Å²	60	96.6 Å²	96.6	36%	0.364	52%	0.518	S	S	.	.	H	α-helix	trans	-91.1	-41.5	-173.4	178	0	0	0	0	111.1	I109 K116 C117	I109-V113 HydrophobicContact CG2-CB 4.45Å; I109-V113 HydrophobicContact CG2-CG2 3.86Å; I109-V113 WeakPolarHBondContact O-CB 3.46Å; I109-V113 VanDerWaalsContact O-CG2 3.26Å; I109-V113 WeakPolarHBondContact O-CG2 3.25Å; I109-V113 PolarHBondContact O-N 3.24Å; V113-K116 PolarHBondContact O-N 3.43Å; V113-C117 PolarHBondContact O-N 3.01Å; V113-C117 PolarHBondContact O-SG 3.35Å; V113-C117 VanDerWaalsContact O-SG 3.33Å
114	F	69.4	Low	79.9	Confident	120 Å²	120	98.4 Å²	98.4	53%	0.526	52%	0.516	S	S	.	.	H	α-helix	trans	-59.6	-48.5	-177.1	-87.1	-108.7	0	0	0	113.5	L110 K116 C117 I118	L110-F114 HydrophobicContact CB-CD2 4.4Å; L110-F114 HydrophobicContact CD1-CD2 3.43Å; L110-F114 VanDerWaalsContact CD1-CD2 3.43Å; L110-F114 HydrophobicContact CD1-CE1 4.43Å; L110-F114 HydrophobicContact CD1-CE2 3.05Å; L110-F114 HydrophobicContact CD1-CG 4.29Å; L110-F114 HydrophobicContact CD1-CZ 3.61Å; L110-F114 HydrophobicContact CG-CD2 3.75Å; L110-F114 HydrophobicContact CG-CE2 3.92Å; L110-F114 HydrophobicContact CG-CG 4.38Å; L110-F114 WeakPolarHBondContact O-CB 3.17Å; L110-F114 WeakPolarHBondContact O-CD2 3.28Å; L110-F114 PolarHBondContact O-N 3.45Å; F114-K116 VanDerWaalsContact C-N 3.28Å; F114-K116 PolarHBondContact O-N 2.88Å; F114-C117 PolarHBondContact O-N 3.34Å; F114-I118 WeakPolarHBondContact O-CD1 3.25Å; F114-I118 VanDerWaalsContact O-CG1 3.25Å; F114-I118 WeakPolarHBondContact O-CG1 3.47Å; F114-I118 PolarHBondContact O-N 3.23Å
115	P	74.6	Confident	79.3	Confident	71 Å²	71	99.3 Å²	99.3	46%	0.461	52%	0.518	S	S	.	.	H	α-helix	trans	-64.3	-35.2	179	-22.3	34.6	0	0	0	112.4	V111 V119	V111-P115 WeakPolarHBondContact O-CD 3.21Å; V111-P115 VanDerWaalsContact O-CG 3.24Å; V111-P115 WeakPolarHBondContact O-CG 3.42Å; P115-V119 VanDerWaalsContact O-CG2 3.25Å; P115-V119 WeakPolarHBondContact O-CG2 3.38Å; P115-V119 PolarHBondContact O-N 2.98Å; P115-V119 VanDerWaalsContact O-N 3.08Å
116	K	70.6	Confident	78.9	Confident	98 Å²	98	97.7 Å²	97.7	43%	0.426	51%	0.513	S	S	.	.	H	α-helix	trans	-68.2	-43.7	177.2	-72.6	-170.6	179.5	72.5	0	112	F112 V113 F114 V119 I120	F112-K116 HydrophobicContact CD1-CD 4.44Å; F112-K116 VanDerWaalsContact CD2-NZ 3.28Å; F112-K116 HydrophobicContact CE1-CD 4.16Å; F112-K116 WeakPolarHBondContact O-CG 3.41Å; F112-K116 PolarHBondContact O-NZ 3.25Å; V113-K116 PolarHBondContact O-N 3.43Å; F114-K116 VanDerWaalsContact C-N 3.28Å; F114-K116 PolarHBondContact O-N 2.88Å; K116-V119 PolarHBondContact O-N 3.38Å; K116-I120 WeakPolarHBondContact O-CD1 3.43Å; K116-I120 WeakPolarHBondContact O-CG1 3.26Å; K116-I120 PolarHBondContact O-N 2.88Å
117	C	70	Confident	78.3	Confident	59 Å²	59	96.1 Å²	96.1	40%	0.399	51%	0.507	S	S	.	.	H	α-helix	trans	-61.2	-46.6	176	-69.8	0	0	0	0	111.2	V113 F114 V119 I120 D121	V113-C117 PolarHBondContact O-N 3.01Å; V113-C117 PolarHBondContact O-SG 3.35Å; V113-C117 VanDerWaalsContact O-SG 3.33Å; F114-C117 PolarHBondContact O-N 3.34Å; C117-V119 VanDerWaalsContact C-N 3.35Å; C117-V119 PolarHBondContact O-N 3.41Å; C117-I120 PolarHBondContact O-N 3.33Å; C117-D121 WeakPolarHBondContact O-CB 3.39Å; C117-D121 VanDerWaalsContact O-CG 3.29Å; C117-D121 PolarHBondContact O-N 3.33Å
118	I	74.5	Confident	77.8	Confident	102 Å²	102	96.9 Å²	96.9	52%	0.523	51%	0.507	S	S	.	.	H	α-helix	trans	-58.5	-45.5	178.1	-67.6	164.7	0	0	0	111.4	F114 D121 L122	F114-I118 WeakPolarHBondContact O-CD1 3.25Å; F114-I118 VanDerWaalsContact O-CG1 3.25Å; F114-I118 WeakPolarHBondContact O-CG1 3.47Å; F114-I118 PolarHBondContact O-N 3.23Å; I118-D121 PolarHBondContact O-N 3.04Å; I118-L122 WeakPolarHBondContact O-CB 3.48Å; I118-L122 PolarHBondContact O-N 2.99Å
119	V	74	Confident	77.5	Confident	100 Å²	100	95.9 Å²	95.9	61%	0.606	50%	0.499	S	S	*	.	H	α-helix	trans	-65.1	-41	179.4	170.8	0	0	0	0	111.8	P115 K116 C117 L122 N123	P115-V119 VanDerWaalsContact O-CG2 3.25Å; P115-V119 WeakPolarHBondContact O-CG2 3.38Å; P115-V119 PolarHBondContact O-N 2.98Å; P115-V119 VanDerWaalsContact O-N 3.08Å; K116-V119 PolarHBondContact O-N 3.38Å; C117-V119 VanDerWaalsContact C-N 3.35Å; C117-V119 PolarHBondContact O-N 3.41Å; V119-L122 PolarHBondContact O-N 3.29Å; V119-N123 WeakPolarHBondContact O-CB 3.4Å; V119-N123 PolarHBondContact O-N 2.93Å
120	I	77.7	Confident	77.4	Confident	97 Å²	97	96.4 Å²	96.4	50%	0.497	50%	0.502	S	S	.	.	H	α-helix	trans	-64.4	-43.8	177.6	-67.9	163	0	0	0	110.9	K116 C117 N123 R124	K116-I120 WeakPolarHBondContact O-CD1 3.43Å; K116-I120 WeakPolarHBondContact O-CG1 3.26Å; K116-I120 PolarHBondContact O-N 2.88Å; C117-I120 PolarHBondContact O-N 3.33Å; I120-N123 PolarHBondContact O-N 3.45Å; I120-R124 WeakPolarHBondContact O-CB 3.21Å; I120-R124 PolarHBondContact O-N 3.4Å
121	D	76	Confident	77.1	Confident	95 Å²	95	95.2 Å²	95.2	51%	0.508	50%	0.501	S	S	.	.	H	α-helix	trans	-65.2	-39.9	179.3	-70.1	-32.5	0	0	0	111.4	C117 I118 N125	C117-D121 WeakPolarHBondContact O-CB 3.39Å; C117-D121 VanDerWaalsContact O-CG 3.29Å; C117-D121 PolarHBondContact O-N 3.33Å; I118-D121 PolarHBondContact O-N 3.04Å; D121-N125 WeakPolarHBondContact O-CB 3.35Å; D121-N125 PolarHBondContact O-N 3.03Å
122	L	77	Confident	77.1	Confident	115 Å²	115	96.2 Å²	96.2	60%	0.602	50%	0.497	S	S	*	.	H	α-helix	trans	-64.7	-43.5	175.6	-138.4	74.5	0	0	0	111.7	I118 V119 N125 V126	I118-L122 WeakPolarHBondContact O-CB 3.48Å; I118-L122 PolarHBondContact O-N 2.99Å; V119-L122 PolarHBondContact O-N 3.29Å; L122-N125 PolarHBondContact O-N 3.31Å; L122-V126 WeakPolarHBondContact O-CG2 3.44Å; L122-V126 PolarHBondContact O-N 3.36Å
123	N	76.1	Confident	77.1	Confident	101 Å²	101	96.9 Å²	96.9	54%	0.54	50%	0.503	S	S	.	.	H	α-helix	trans	-65.8	-43.9	-179.6	-154	42.8	0	0	0	111.3	V119 I120 N125 V126 D127	V119-N123 WeakPolarHBondContact O-CB 3.4Å; V119-N123 PolarHBondContact O-N 2.93Å; I120-N123 PolarHBondContact O-N 3.45Å; N123-N125 VanDerWaalsContact C-N 3.31Å; N123-N125 PolarHBondContact O-N 3.01Å; N123-V126 PolarHBondContact O-N 3.1Å; N123-D127 PolarHBondContact O-N 2.98Å
124	R	77.8	Confident	77.2	Confident	162 Å²	162	98.8 Å²	98.8	61%	0.611	52%	0.519	S	S	*	.	H	α-helix	trans	-61.3	-39.4	174.8	-172.2	-170.2	-65.8	177.7	0.8	112.2	I120 T128	I120-R124 WeakPolarHBondContact O-CB 3.21Å; I120-R124 PolarHBondContact O-N 3.4Å; R124-T128 WeakPolarHBondContact O-CB 3.34Å; R124-T128 PolarHBondContact O-N 3.46Å; R124-T128 PolarHBondContact O-OG1 3.17Å
125	N	82.3	Confident	77.4	Confident	97 Å²	97	101 Å²	101	52%	0.519	53%	0.534	S	S	.	.	H	α-helix	trans	-65.2	-43.2	178.1	-175.4	66.3	0	0	0	111.7	D121 L122 N123 T128 E129	D121-N125 WeakPolarHBondContact O-CB 3.35Å; D121-N125 PolarHBondContact O-N 3.03Å; L122-N125 PolarHBondContact O-N 3.31Å; N123-N125 VanDerWaalsContact C-N 3.31Å; N123-N125 PolarHBondContact O-N 3.01Å; N125-T128 PolarHBondContact O-N 2.97Å; N125-E129 PolarHBondContact O-N 3.32Å
126	V	83.5	Confident	76.7	Confident	69 Å²	69	103.7 Å²	103.7	42%	0.418	57%	0.574	S	S	.	*	H	α-helix	trans	-63.5	-46	175.8	171.7	0	0	0	0	111.4	L122 N123 T128 E129 I130	L122-V126 WeakPolarHBondContact O-CG2 3.44Å; L122-V126 PolarHBondContact O-N 3.36Å; N123-V126 PolarHBondContact O-N 3.1Å; V126-T128 PolarHBondContact O-N 3.04Å; V126-E129 PolarHBondContact O-N 2.9Å; V126-I130 HydrophobicContact CG1-CD1 3.65Å; V126-I130 HydrophobicContact CG1-CG1 4.28Å; V126-I130 WeakPolarHBondContact O-CG1 3.27Å; V126-I130 PolarHBondContact O-N 2.97Å
127	D	79.3	Confident	77	Confident	91 Å²	91	104 Å²	104	49%	0.487	58%	0.581	S	S	.	*	H	α-helix	trans	-59.1	-38.2	176.6	-71.4	-31	0	0	0	111.9	N123 S131	N123-D127 PolarHBondContact O-N 2.98Å; D127-S131 VanDerWaalsContact O-CB 3.27Å; D127-S131 WeakPolarHBondContact O-CB 3.49Å; D127-S131 PolarHBondContact O-N 3.3Å
128	T	80.8	Confident	77.4	Confident	64 Å²	64	106.3 Å²	106.3	39%	0.393	59%	0.591	S	S	.	*	H	α-helix	trans	-66.1	-42.9	177.2	-58.2	0	0	0	0	111.6	R124 N125 V126 S131 K132	R124-T128 WeakPolarHBondContact O-CB 3.34Å; R124-T128 PolarHBondContact O-N 3.46Å; R124-T128 PolarHBondContact O-OG1 3.17Å; N125-T128 PolarHBondContact O-N 2.97Å; V126-T128 PolarHBondContact O-N 3.04Å; T128-S131 PolarHBondContact O-N 3.23Å; T128-K132 WeakPolarHBondContact O-CG 3.38Å; T128-K132 PolarHBondContact O-N 3.5Å; T128-K132 VanDerWaalsContact O-N 3.12Å
129	E	81.6	Confident	77.5	Confident	81 Å²	81	106.6 Å²	106.6	38%	0.379	60%	0.595	S	S	.	*	H	α-helix	trans	-68.8	-40.8	177.4	-74.3	-62.2	122.1	0	0	112.5	N125 V126 S131 K132 M133	N125-E129 PolarHBondContact O-N 3.32Å; V126-E129 PolarHBondContact O-N 2.9Å; E129-S131 VanDerWaalsContact C-N 3.33Å; E129-S131 PolarHBondContact O-N 2.76Å; E129-K132 PolarHBondContact O-N 3.31Å; E129-K132 IonicContact OE1-NZ 3.19Å; E129-K132 PolarHBondContact OE1-NZ 3.1Å; E129-M133 WeakPolarHBondContact O-CG 3.42Å; E129-M133 PolarHBondContact O-N 3.04Å; E129-M133 VanDerWaalsContact O-N 3.1Å
130	I	81.3	Confident	77.7	Confident	104 Å²	104	106.9 Å²	106.9	53%	0.533	59%	0.594	S	S	.	*	H	α-helix	trans	-61.5	-43.4	174.4	-68.3	170.5	0	0	0	110.5	V126 K132 M133 S134	V126-I130 HydrophobicContact CG1-CD1 3.65Å; V126-I130 HydrophobicContact CG1-CG1 4.28Å; V126-I130 WeakPolarHBondContact O-CG1 3.27Å; V126-I130 PolarHBondContact O-N 2.97Å; I130-K132 VanDerWaalsContact C-N 3.34Å; I130-K132 PolarHBondContact O-N 3.48Å; I130-M133 PolarHBondContact O-N 3.45Å; I130-S134 PolarHBondContact O-N 3.12Å; I130-S134 VanDerWaalsContact O-N 3.1Å
131	S	78.7	Confident	77.8	Confident	68 Å²	68	107.6 Å²	107.6	48%	0.476	60%	0.6	S	S	.	*	H	α-helix	trans	-62.2	-39.6	178.2	-168	0	0	0	0	112.4	D127 T128 E129 S134	D127-S131 VanDerWaalsContact O-CB 3.27Å; D127-S131 WeakPolarHBondContact O-CB 3.49Å; D127-S131 PolarHBondContact O-N 3.3Å; T128-S131 PolarHBondContact O-N 3.23Å; E129-S131 VanDerWaalsContact C-N 3.33Å; E129-S131 PolarHBondContact O-N 2.76Å; S131-S134 PolarHBondContact O-N 3.49Å
132	K	82.8	Confident	77.9	Confident	128 Å²	128	108.4 Å²	108.4	56%	0.557	61%	0.606	S	S	*	*	H	α-helix	trans	-63.8	-39.9	174.1	-71.6	172.7	-170.9	167.4	0	112.7	T128 E129 I130 S134 M135	T128-K132 WeakPolarHBondContact O-CG 3.38Å; T128-K132 PolarHBondContact O-N 3.5Å; T128-K132 VanDerWaalsContact O-N 3.12Å; E129-K132 PolarHBondContact O-N 3.31Å; E129-K132 IonicContact OE1-NZ 3.19Å; E129-K132 PolarHBondContact OE1-NZ 3.1Å; I130-K132 VanDerWaalsContact C-N 3.34Å; I130-K132 PolarHBondContact O-N 3.48Å; K132-S134 VanDerWaalsContact C-N 3.3Å; K132-S134 PolarHBondContact O-N 2.72Å; K132-M135 PolarHBondContact O-N 3.34Å
133	M	76.2	Confident	77.9	Confident	152 Å²	152	107.9 Å²	107.9	75%	0.749	61%	0.607	S	S	*	*	H	α-helix	trans	-69.5	-26.6	178.8	-73.2	178.8	164.9	0	0	113	E129 I130	E129-M133 WeakPolarHBondContact O-CG 3.42Å; E129-M133 PolarHBondContact O-N 3.04Å; E129-M133 VanDerWaalsContact O-N 3.1Å; I130-M133 PolarHBondContact O-N 3.45Å
134	S	78	Confident	78.1	Confident	100 Å²	100	108.5 Å²	108.5	70%	0.699	61%	0.612	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.6	-10.3	179.9	-171.5	0	0	0	0	114.4	I130 S131 K132	I130-S134 PolarHBondContact O-N 3.12Å; I130-S134 VanDerWaalsContact O-N 3.1Å; S131-S134 PolarHBondContact O-N 3.49Å; K132-S134 VanDerWaalsContact C-N 3.3Å; K132-S134 PolarHBondContact O-N 2.72Å
135	M	72.4	Confident	78.1	Confident	167 Å²	167	104 Å²	104	82%	0.823	61%	0.612	S	S	*	*	T	Hydrogen-bonded Turn	trans	-104.6	-1	-177	-81.6	176.7	64.5	0	0	114.5	K132	K132-M135 PolarHBondContact O-N 3.34Å
136	G	60.4	Low	77.7	Confident	127 Å²	127	104.6 Å²	104.6	100%	1.309	62%	0.62	S	S	*	*			trans	-99.6	0	174.2	0	0	0	0	0	112.2

Retrieved 136 of 136 residues in 31.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).