A0A093GSG6_STRCA Loading...

Anaphase-promoting complex subunit 16

Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. The APC/C complex catalyzes assembly of branched 'Lys-11'-/'Lys-48'-linked branched ubiquitin chains on target proteins.

AlphaFold DB , UniProt , Accession A0A093GSG6, Species STRCA (Struthio camelus australis), Gene n/a, Length 110 aa.

						>A0A093GSG6_STRCA|A0A093GSG6
MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWKKKPIEQLLGFTPSSG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39.1	Very low	41.7	Very low	249 Å²	249	116.2 Å²	116.2	100%	1.227	82%	0.824	S	S	*	*				0	135.4	0	-59.6	-175.7	178.1	0	0	106.9
2	A	40.9	Very low	41.9	Very low	104 Å²	104	113.1 Å²	113.1	86%	0.86	82%	0.823	S	S	*	*			cis	-137.8	166.3	-4.2	0	0	0	0	0	109.5
3	A	47.2	Very low	41.8	Very low	90 Å²	90	116 Å²	116	74%	0.744	83%	0.83	S	S	*	*			trans	-102.3	150.9	177.1	0	0	0	0	0	111.6
4	S	35.7	Very low	41.8	Very low	114 Å²	114	115.8 Å²	115.8	80%	0.797	83%	0.827	S	S	*	*			trans	-166.3	122.6	157.5	-80.4	0	0	0	0	105.4
5	S	39.3	Very low	42.1	Very low	104 Å²	104	112.7 Å²	112.7	73%	0.727	82%	0.82	S	S	*	*			cis	62.4	126.6	42.5	-43.6	0	0	0	0	110.2
6	S	38.8	Very low	42.3	Very low	112 Å²	112	112.7 Å²	112.7	78%	0.783	82%	0.818	S	S	*	*			cis	-164.1	172.4	15.6	-64.6	0	0	0	0	107.9
7	S	43.1	Very low	42.1	Very low	97 Å²	97	111.4 Å²	111.4	68%	0.678	81%	0.807	S	S	*	*			cis	179.2	157.4	-21.7	54.3	0	0	0	0	108.7
8	S	42.1	Very low	42.4	Very low	113 Å²	113	113.3 Å²	113.3	79%	0.79	81%	0.811	S	S	*	*			trans	71.4	160.8	158.9	-46.1	0	0	0	0	116.1
9	S	44.1	Very low	42.4	Very low	110 Å²	110	113.3 Å²	113.3	77%	0.769	81%	0.805	S	S	*	*			cis	-163.7	154.9	2.7	12.4	0	0	0	0	111.7
10	A	46.3	Very low	42.8	Very low	108 Å²	108	111.2 Å²	111.2	89%	0.893	80%	0.801	S	S	*	*			trans	47.7	116	147.5	0	0	0	0	0	121
11	G	42.3	Very low	43.2	Very low	77 Å²	77	111.2 Å²	111.2	79%	0.794	80%	0.8	S	S	*	*			trans	-159.4	118.6	159.5	0	0	0	0	0	108.8
12	G	43.9	Very low	43.5	Very low	79 Å²	79	102 Å²	102	81%	0.814	77%	0.77	S	S	*	*			trans	-66.6	142.3	-163.4	0	0	0	0	0	114.6	S14	G12-S14 VanDerWaalsContact C-N 3.32Å; G12-S14 PolarHBondContact O-N 2.85Å
13	V	41.3	Very low	43.8	Very low	151 Å²	151	104.5 Å²	104.5	92%	0.915	76%	0.761	S	S	*	*			trans	-68.4	95.5	160.5	-60.3	0	0	0	0	107.5	G15	V13-G15 PolarHBondContact O-N 3.04Å
14	S	41.2	Very low	44	Very low	113 Å²	113	103.3 Å²	103.3	79%	0.79	75%	0.747	S	S	*	*			trans	-72.2	103	174.5	-153.4	0	0	0	0	107.4	G12 S16	G12-S14 VanDerWaalsContact C-N 3.32Å; G12-S14 PolarHBondContact O-N 2.85Å; S14-S16 VanDerWaalsContact C-N 3.33Å; S14-S16 PolarHBondContact O-N 3.1Å
15	G	46.7	Very low	44.5	Very low	69 Å²	69	103.7 Å²	103.7	71%	0.711	75%	0.745	S	S	*	*			trans	-66.4	92.8	178.4	0	0	0	0	0	109.8	V13 S17	V13-G15 PolarHBondContact O-N 3.04Å; G15-S17 PolarHBondContact O-N 3.46Å
16	S	45.4	Very low	45	Very low	113 Å²	113	103.7 Å²	103.7	79%	0.79	75%	0.745	S	S	*	*			trans	-61.2	92.6	162.4	-66.4	0	0	0	0	107.8	S14 V18	S14-S16 VanDerWaalsContact C-N 3.33Å; S14-S16 PolarHBondContact O-N 3.1Å; S16-V18 PolarHBondContact O-N 3.49Å
17	S	39.1	Very low	45.8	Very low	91 Å²	91	103.6 Å²	103.6	64%	0.636	74%	0.736	S	S	*	*			trans	-45	124.2	177.9	45.8	0	0	0	0	110.1	G15 T19	G15-S17 PolarHBondContact O-N 3.46Å; S17-T19 PolarHBondContact O-N 3.42Å
18	V	46.1	Very low	46.6	Very low	146 Å²	146	100.8 Å²	100.8	89%	0.885	71%	0.713	S	S	*	*			trans	-67.6	79.1	170.7	-176	0	0	0	0	107.8	S16 G20	S16-V18 PolarHBondContact O-N 3.49Å; V18-G20 VanDerWaalsContact C-N 3.28Å; V18-G20 PolarHBondContact O-N 2.9Å
19	T	43.7	Very low	47.5	Very low	113 Å²	113	97.6 Å²	97.6	69%	0.693	69%	0.693	S	S	*	*			trans	-69.7	94.9	164.9	53.2	0	0	0	0	105.9	S17 S21	S17-T19 PolarHBondContact O-N 3.42Å; T19-S21 PolarHBondContact O-N 3.21Å
20	G	49.6	Very low	48.6	Very low	71 Å²	71	95.4 Å²	95.4	73%	0.732	68%	0.676	S	S	*	*			trans	-64.4	82.2	174.9	0	0	0	0	0	110.5	V18 G22	V18-G20 VanDerWaalsContact C-N 3.28Å; V18-G20 PolarHBondContact O-N 2.9Å; G20-G22 PolarHBondContact O-N 2.84Å
21	S	51.3	Low	49.3	Very low	111 Å²	111	91.6 Å²	91.6	78%	0.776	64%	0.643	S	S	*	*			trans	-67.3	90.4	159.9	55.7	0	0	0	0	106.7	T19 F23	T19-S21 PolarHBondContact O-N 3.21Å; S21-F23 PolarHBondContact O-N 3.36Å
22	G	46.3	Very low	50	Low	57 Å²	57	98.9 Å²	98.9	59%	0.588	65%	0.646	S	S	*	*			trans	-57	107	-179.1	0	0	0	0	0	109.8	G20 S24	G20-G22 PolarHBondContact O-N 2.84Å; G22-S24 VanDerWaalsContact C-N 3.28Å; G22-S24 PolarHBondContact O-N 3.15Å; G22-S24 PolarHBondContact O-OG 3.42Å
23	F	47.2	Very low	50.4	Low	156 Å²	156	102.9 Å²	102.9	68%	0.684	64%	0.641	S	S	*	*			trans	-62.2	91.3	-179.9	-174.1	-96.5	0	0	0	108.7	S21 L28	S21-F23 PolarHBondContact O-N 3.36Å; F23-L28 HydrophobicContact CE1-CD2 4.31Å; F23-L28 HydrophobicContact CZ-CD2 4.06Å
24	S	50.2	Low	51.1	Low	64 Å²	64	99 Å²	99	45%	0.448	62%	0.624	S	S	.	*			trans	-77.3	141.4	-177	-69.8	0	0	0	0	108.2	G22 S26 D27	G22-S24 VanDerWaalsContact C-N 3.28Å; G22-S24 PolarHBondContact O-N 3.15Å; G22-S24 PolarHBondContact O-OG 3.42Å; S24-S26 PolarHBondContact O-N 3.21Å; S24-D27 PolarHBondContact O-N 3.25Å
25	V	46.1	Very low	51.8	Low	122 Å²	122	98.6 Å²	98.6	74%	0.739	61%	0.613	S	S	*	*	G	3₁₀ helix	trans	-56.6	-21.1	177.4	-177.3	0	0	0	0	111.7	D27 L28	V25-D27 VanDerWaalsContact C-N 3.33Å; V25-D27 PolarHBondContact O-N 3.28Å; V25-L28 HydrophobicContact CG1-CD1 3.97Å; V25-L28 WeakPolarHBondContact O-CB 3.43Å; V25-L28 WeakPolarHBondContact O-CD1 3.4Å; V25-L28 WeakPolarHBondContact O-CG 3.29Å; V25-L28 PolarHBondContact O-N 2.92Å
26	S	51.2	Low	51.8	Low	105 Å²	105	104.3 Å²	104.3	73%	0.734	62%	0.619	S	S	*	*	G	3₁₀ helix	trans	-62.1	-25.1	171.3	-48.3	0	0	0	0	115.5	S24 L28	S24-S26 PolarHBondContact O-N 3.21Å; S26-L28 PolarHBondContact O-N 3.03Å
27	D	55	Low	52.3	Low	110 Å²	110	104.6 Å²	104.6	59%	0.588	62%	0.616	S	S	*	*	G	3₁₀ helix	trans	-73.4	-1.2	176.4	-82.6	-47.1	0	0	0	113.3	S24 V25 A29	S24-D27 PolarHBondContact O-N 3.25Å; V25-D27 VanDerWaalsContact C-N 3.33Å; V25-D27 PolarHBondContact O-N 3.28Å; D27-A29 PolarHBondContact O-N 2.99Å
28	L	58.9	Low	52.3	Low	38 Å²	38	109 Å²	109	20%	0.199	62%	0.619	C	S	.	*	G	3₁₀ helix	trans	-81.4	16.6	174.7	-59.3	171.4	0	0	0	113.1	F23 V25 S26 A64	F23-L28 HydrophobicContact CE1-CD2 4.31Å; F23-L28 HydrophobicContact CZ-CD2 4.06Å; V25-L28 HydrophobicContact CG1-CD1 3.97Å; V25-L28 WeakPolarHBondContact O-CB 3.43Å; V25-L28 WeakPolarHBondContact O-CD1 3.4Å; V25-L28 WeakPolarHBondContact O-CG 3.29Å; V25-L28 PolarHBondContact O-N 2.92Å; S26-L28 PolarHBondContact O-N 3.03Å; L28-A64 HydrophobicContact CD2-CB 3.91Å
29	A	62.6	Low	52.3	Low	45 Å²	45	107.2 Å²	107.2	37%	0.372	61%	0.611	S	S	.	*	S	Bend	trans	-67.7	142.9	166.3	0	0	0	0	0	109.9	D27 K33	D27-A29 PolarHBondContact O-N 2.99Å; A29-K33 HydrophobicContact CB-CB 4.09Å; A29-K33 HydrophobicContact CB-CG 4.46Å
30	P	65.9	Low	52.9	Low	65 Å²	65	111.3 Å²	111.3	42%	0.422	62%	0.62	S	S	.	*			trans	-53.5	135.5	176.9	-26.7	34.2	0	0	0	111	R32 K33 Y61	P30-R32 PolarHBondContact O-N 3.17Å; P30-K33 WeakPolarHBondContact O-CB 3.4Å; P30-K33 PolarHBondContact O-N 3.05Å; P30-Y61 HydrophobicContact CB-CE2 4.49Å; P30-Y61 HydrophobicContact CG-CE2 4.4Å
31	P	60.8	Low	53	Low	28 Å²	28	111.2 Å²	111.2	18%	0.182	62%	0.619	C	S	.	*	G	3₁₀ helix	trans	-51.2	-29	-170.1	-32.8	36.1	0	0	0	115.6	K33 A34 L35 V58 Y61	P31-K33 PolarHBondContact O-N 3.28Å; P31-K33 VanDerWaalsContact O-N 3.08Å; P31-A34 PolarHBondContact O-N 3.23Å; P31-L35 WeakPolarHBondContact O-CG 3.35Å; P31-L35 PolarHBondContact O-N 3.31Å; P31-V58 HydrophobicContact CB-CG2 4.36Å; P31-V58 HydrophobicContact CG-CG2 4.16Å; P31-Y61 HydrophobicContact CG-CG 4.29Å
32	R	56.9	Low	52.9	Low	229 Å²	229	110.2 Å²	110.2	86%	0.864	62%	0.617	S	S	*	*	G	3₁₀ helix	trans	-56.2	-18.8	171.1	-78	179.7	152.8	151.3	-5	115.3	P30	P30-R32 PolarHBondContact O-N 3.17Å
33	K	53.7	Low	53.4	Low	164 Å²	164	110.7 Å²	110.7	71%	0.713	62%	0.622	S	S	*	*	G	3₁₀ helix	trans	-84	-31.1	173.5	-69.6	-84.8	-176.4	170.2	0	112.4	A29 P30 P31	A29-K33 HydrophobicContact CB-CB 4.09Å; A29-K33 HydrophobicContact CB-CG 4.46Å; P30-K33 WeakPolarHBondContact O-CB 3.4Å; P30-K33 PolarHBondContact O-N 3.05Å; P31-K33 PolarHBondContact O-N 3.28Å; P31-K33 VanDerWaalsContact O-N 3.08Å
34	A	55.3	Low	53.5	Low	68 Å²	68	112.9 Å²	112.9	56%	0.562	63%	0.634	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.8	-30.4	178.1	0	0	0	0	0	112.5	P31 F36 T37	P31-A34 PolarHBondContact O-N 3.23Å; A34-F36 VanDerWaalsContact C-N 3.27Å; A34-F36 PolarHBondContact O-N 3.26Å; A34-T37 PolarHBondContact O-OG1 2.76Å
35	L	55	Low	53.3	Low	105 Å²	105	119 Å²	119	55%	0.55	66%	0.658	S	S	.	*	T	Hydrogen-bonded Turn	trans	-79.4	-0.4	-178.1	-60.6	173.2	0	0	0	114.9	P31 T37 L54	P31-L35 WeakPolarHBondContact O-CG 3.35Å; P31-L35 PolarHBondContact O-N 3.31Å; L35-T37 VanDerWaalsContact C-N 3.3Å; L35-L54 HydrophobicContact CD1-CD2 3.54Å; L35-L54 HydrophobicContact CD2-CD2 3.57Å; L35-L54 HydrophobicContact CG-CD2 4.13Å
36	F	48.3	Very low	53.6	Low	190 Å²	190	119.2 Å²	119.2	83%	0.833	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.2	4.1	178.1	-141.8	-93.4	0	0	0	113.8	A34	A34-F36 VanDerWaalsContact C-N 3.27Å; A34-F36 PolarHBondContact O-N 3.26Å
37	T	54.4	Low	53.8	Low	119 Å²	119	122.4 Å²	122.4	73%	0.73	66%	0.658	S	S	*	*			trans	-101.1	84.9	165	40	0	0	0	0	110.2	A34 L35 P39	A34-T37 PolarHBondContact O-OG1 2.76Å; L35-T37 VanDerWaalsContact C-N 3.3Å; T37-P39 VanDerWaalsContact O-CD 3.26Å; T37-P39 WeakPolarHBondContact O-CD 3.38Å
38	Y	40.1	Very low	53.9	Low	182 Å²	182	122.4 Å²	122.4	71%	0.714	66%	0.657	S	S	*	*			trans	-77.5	112	173.5	179.6	-96.7	0	0	0	110.5	K40	Y38-K40 HydrophobicContact CD1-CB 4.08Å; Y38-K40 HydrophobicContact CD1-CG 4.37Å; Y38-K40 HydrophobicContact CE1-CB 4.12Å; Y38-K40 HydrophobicContact CE1-CG 4.05Å; Y38-K40 PolarHBondContact O-N 2.6Å
39	P	46.3	Very low	54	Low	110 Å²	110	122.9 Å²	122.9	71%	0.714	67%	0.672	S	S	*	*			trans	-70.5	112.2	170.5	29.5	-32.2	0	0	0	108.8	T37 G41	T37-P39 VanDerWaalsContact O-CD 3.26Å; T37-P39 WeakPolarHBondContact O-CD 3.38Å; P39-G41 PolarHBondContact O-N 3.13Å
40	K	55.1	Low	54.4	Low	199 Å²	199	123 Å²	123	87%	0.865	67%	0.67	S	S	*	*	S	Bend	trans	-81.6	82.4	-170.4	-164.5	152.3	-173.8	171	0	111.8	Y38	Y38-K40 HydrophobicContact CD1-CB 4.08Å; Y38-K40 HydrophobicContact CD1-CG 4.37Å; Y38-K40 HydrophobicContact CE1-CB 4.12Å; Y38-K40 HydrophobicContact CE1-CG 4.05Å; Y38-K40 PolarHBondContact O-N 2.6Å
41	G	52.7	Low	55	Low	69 Å²	69	126.5 Å²	126.5	71%	0.711	68%	0.68	S	S	*	*			trans	133.3	91.3	164.2	0	0	0	0	0	115.5	P39	P39-G41 PolarHBondContact O-N 3.13Å
42	A	48.3	Very low	56.1	Low	90 Å²	90	133 Å²	133	74%	0.744	70%	0.701	S	S	*	*			trans	-168	85.6	154.6	0	0	0	0	0	108.6
43	G	57.1	Low	57.4	Low	67 Å²	67	129 Å²	129	69%	0.691	69%	0.69	S	S	*	*			trans	-71.2	165.5	169.9	0	0	0	0	0	111.9
44	E	49.2	Very low	58.9	Low	202 Å²	202	124.2 Å²	124.2	94%	0.944	67%	0.673	S	S	*	*	S	Bend	trans	83.8	-3	158.4	-49.8	-168	139.9	0	0	120.3
45	M	46.2	Very low	60.5	Low	191 Å²	191	125.2 Å²	125.2	94%	0.941	67%	0.674	S	S	*	*	S	Bend	trans	-139	10.5	173.3	-64.2	-166	78.2	0	0	117.5
46	L	53.3	Low	62.1	Low	127 Å²	127	125.6 Å²	125.6	67%	0.665	67%	0.673	S	S	*	*			trans	-112.1	-1.9	-168.3	-156	74.9	0	0	0	116.6	S50	L46-S50 WeakPolarHBondContact O-CB 3.41Å; L46-S50 PolarHBondContact O-OG 3.21Å; L46-S50 VanDerWaalsContact O-OG 3.05Å
47	E	54.7	Low	64	Low	173 Å²	173	118.2 Å²	118.2	81%	0.808	65%	0.645	S	S	*	*	H	α-helix	trans	-59.6	-57	-172.2	-69.7	-91.1	110.4	0	0	112.3	G49 S50	E47-G49 PolarHBondContact O-N 3.37Å; E47-S50 PolarHBondContact O-N 3.18Å; E47-S50 PolarHBondContact O-OG 2.98Å
48	D	57.6	Low	65.9	Low	109 Å²	109	115.6 Å²	115.6	58%	0.583	63%	0.629	S	S	*	*	H	α-helix	trans	-78.4	-21.5	-160.1	-149.2	63.3	0	0	0	114.9	R52	D48-R52 PolarHBondContact O-NE 2.91Å; D48-R52 PolarHBondContact O-NH2 3.08Å; D48-R52 IonicContact OD2-CZ 2.6Å; D48-R52 IonicContact OD2-NE 2.64Å; D48-R52 IonicContact OD2-NH2 3.64Å; D48-R52 PolarHBondContact OD2-NH2 3.39Å
49	G	60.1	Low	68.5	Low	48 Å²	48	112.7 Å²	112.7	50%	0.495	62%	0.62	S	S	.	*	H	α-helix	trans	-89.3	-27.2	174.9	0	0	0	0	0	113.5	E47 F53	E47-G49 PolarHBondContact O-N 3.37Å; G49-F53 WeakPolarHBondContact O-CB 3.36Å; G49-F53 PolarHBondContact O-N 3.47Å; G49-F53 VanDerWaalsContact O-N 3.08Å
50	S	72.1	Confident	70.7	Confident	47 Å²	47	110.2 Å²	110.2	33%	0.329	61%	0.605	S	S	.	*	H	α-helix	trans	-74.6	-40.5	-176.8	68.1	0	0	0	0	112.3	L46 E47 R52 F53 L54	L46-S50 WeakPolarHBondContact O-CB 3.41Å; L46-S50 PolarHBondContact O-OG 3.21Å; L46-S50 VanDerWaalsContact O-OG 3.05Å; E47-S50 PolarHBondContact O-N 3.18Å; E47-S50 PolarHBondContact O-OG 2.98Å; S50-R52 PolarHBondContact O-N 3.23Å; S50-F53 PolarHBondContact O-N 3.11Å; S50-L54 WeakPolarHBondContact O-CB 3.43Å; S50-L54 VanDerWaalsContact O-CG 3.23Å; S50-L54 WeakPolarHBondContact O-CG 3.36Å; S50-L54 PolarHBondContact O-N 3.15Å
51	E	77.3	Confident	72.6	Confident	139 Å²	139	104.3 Å²	104.3	65%	0.65	58%	0.578	S	S	*	*	H	α-helix	trans	-61	-44.9	173.8	-175.7	177.9	-160.9	0	0	111.8	F53 L54 C55	E51-F53 PolarHBondContact O-N 3.04Å; E51-L54 WeakPolarHBondContact O-CB 3.48Å; E51-L54 PolarHBondContact O-N 3.06Å; E51-C55 WeakPolarHBondContact O-CB 3.42Å; E51-C55 PolarHBondContact O-N 3.47Å
52	R	84.3	Confident	74.7	Confident	164 Å²	164	106.6 Å²	106.6	62%	0.619	57%	0.57	S	S	*	*	H	α-helix	trans	-61.9	-42.9	177.2	-72	-174.3	-95.4	170.3	-12.2	112	D48 S50 C55 E56	D48-R52 PolarHBondContact O-NE 2.91Å; D48-R52 PolarHBondContact O-NH2 3.08Å; D48-R52 IonicContact OD2-CZ 2.6Å; D48-R52 IonicContact OD2-NE 2.64Å; D48-R52 IonicContact OD2-NH2 3.64Å; D48-R52 PolarHBondContact OD2-NH2 3.39Å; S50-R52 PolarHBondContact O-N 3.23Å; R52-C55 PolarHBondContact O-N 3.5Å; R52-E56 WeakPolarHBondContact O-CB 3.38Å; R52-E56 PolarHBondContact O-N 3.23Å
53	F	84.4	Confident	77	Confident	145 Å²	145	105.7 Å²	105.7	64%	0.636	56%	0.555	S	S	*	*	H	α-helix	trans	-66	-38.4	175	-179.3	-97.1	0	0	0	112.9	G49 S50 E51 S57	G49-F53 WeakPolarHBondContact O-CB 3.36Å; G49-F53 PolarHBondContact O-N 3.47Å; G49-F53 VanDerWaalsContact O-N 3.08Å; S50-F53 PolarHBondContact O-N 3.11Å; E51-F53 PolarHBondContact O-N 3.04Å; F53-S57 WeakPolarHBondContact CE1-OG 3.45Å; F53-S57 VanDerWaalsContact O-CB 3.24Å; F53-S57 WeakPolarHBondContact O-CB 3.41Å; F53-S57 PolarHBondContact O-N 3.2Å; F53-S57 PolarHBondContact O-OG 3.4Å
54	L	85.1	Confident	78.9	Confident	65 Å²	65	103.8 Å²	103.8	34%	0.34	53%	0.533	S	S	.	.	H	α-helix	trans	-63.4	-45.2	174.5	-76.4	171.2	0	0	0	111.8	L35 S50 E51 S57 V58	L35-L54 HydrophobicContact CD1-CD2 3.54Å; L35-L54 HydrophobicContact CD2-CD2 3.57Å; L35-L54 HydrophobicContact CG-CD2 4.13Å; S50-L54 WeakPolarHBondContact O-CB 3.43Å; S50-L54 VanDerWaalsContact O-CG 3.23Å; S50-L54 WeakPolarHBondContact O-CG 3.36Å; S50-L54 PolarHBondContact O-N 3.15Å; E51-L54 WeakPolarHBondContact O-CB 3.48Å; E51-L54 PolarHBondContact O-N 3.06Å; L54-S57 PolarHBondContact O-N 3.43Å; L54-V58 WeakPolarHBondContact O-CB 3.37Å; L54-V58 WeakPolarHBondContact O-CG2 3.39Å; L54-V58 PolarHBondContact O-N 2.94Å
55	C	88.3	Confident	81.1	Confident	88 Å²	88	96.7 Å²	96.7	60%	0.595	51%	0.506	S	S	*	.	H	α-helix	trans	-58.8	-51.4	176.1	-170.4	0	0	0	0	110.9	E51 R52 S57 V58 F59	E51-C55 WeakPolarHBondContact O-CB 3.42Å; E51-C55 PolarHBondContact O-N 3.47Å; R52-C55 PolarHBondContact O-N 3.5Å; C55-S57 VanDerWaalsContact C-N 3.33Å; C55-S57 PolarHBondContact O-N 3.37Å; C55-V58 PolarHBondContact O-N 3.27Å; C55-F59 WeakPolarHBondContact O-CB 3.47Å; C55-F59 PolarHBondContact O-N 2.86Å
56	E	90.3	Very high	83.6	Confident	113 Å²	113	91.7 Å²	91.7	53%	0.528	49%	0.486	S	S	.	.	H	α-helix	trans	-61.9	-38.2	178	-173.6	62.8	-168.6	0	0	112.5	R52 S60	R52-E56 WeakPolarHBondContact O-CB 3.38Å; R52-E56 PolarHBondContact O-N 3.23Å; E56-S60 WeakPolarHBondContact O-CB 3.3Å; E56-S60 PolarHBondContact O-N 2.74Å; E56-S60 PolarHBondContact O-OG 2.97Å
57	S	87.3	Confident	85.7	Confident	35 Å²	35	90 Å²	90	25%	0.245	48%	0.478	C	S	.	.	H	α-helix	trans	-68	-41.6	177.7	-63.2	0	0	0	0	112.3	F53 L54 C55 Y61	F53-S57 WeakPolarHBondContact CE1-OG 3.45Å; F53-S57 VanDerWaalsContact O-CB 3.24Å; F53-S57 WeakPolarHBondContact O-CB 3.41Å; F53-S57 PolarHBondContact O-N 3.2Å; F53-S57 PolarHBondContact O-OG 3.4Å; L54-S57 PolarHBondContact O-N 3.43Å; C55-S57 VanDerWaalsContact C-N 3.33Å; C55-S57 PolarHBondContact O-N 3.37Å; S57-Y61 VanDerWaalsContact O-CB 3.3Å; S57-Y61 WeakPolarHBondContact O-CB 3.43Å; S57-Y61 PolarHBondContact O-N 2.93Å
58	V	93.2	Very high	87.8	Confident	65 Å²	65	87 Å²	87	39%	0.394	46%	0.462	S	S	.	.	H	α-helix	trans	-68.8	-41.5	176.2	171.6	0	0	0	0	110.8	P31 L54 C55 Y61 Q62	P31-V58 HydrophobicContact CB-CG2 4.36Å; P31-V58 HydrophobicContact CG-CG2 4.16Å; L54-V58 WeakPolarHBondContact O-CB 3.37Å; L54-V58 WeakPolarHBondContact O-CG2 3.39Å; L54-V58 PolarHBondContact O-N 2.94Å; C55-V58 PolarHBondContact O-N 3.27Å; V58-Y61 PolarHBondContact O-N 3.25Å; V58-Q62 WeakPolarHBondContact O-CG 3.33Å; V58-Q62 PolarHBondContact O-N 2.96Å
59	F	95.4	Very high	89.7	Confident	120 Å²	120	86.8 Å²	86.8	53%	0.526	46%	0.457	S	S	.	.	H	α-helix	trans	-61.6	-50.9	174.5	178.5	-105.1	0	0	0	111.7	C55 Y61 Q62 V63	C55-F59 WeakPolarHBondContact O-CB 3.47Å; C55-F59 PolarHBondContact O-N 2.86Å; F59-Y61 VanDerWaalsContact C-N 3.3Å; F59-Y61 PolarHBondContact O-N 3.03Å; F59-Q62 WeakPolarHBondContact O-CB 3.45Å; F59-Q62 PolarHBondContact O-N 2.92Å; F59-Q62 VanDerWaalsContact O-N 3.08Å; F59-V63 HydrophobicContact CD1-CG2 4.42Å; F59-V63 HydrophobicContact CD2-CG2 4.47Å; F59-V63 HydrophobicContact CE1-CG2 4Å; F59-V63 HydrophobicContact CE2-CG2 4.07Å; F59-V63 HydrophobicContact CZ-CG2 3.81Å; F59-V63 WeakPolarHBondContact O-CG2 3.34Å; F59-V63 PolarHBondContact O-N 3.11Å
60	S	93.3	Very high	91.6	Very high	58 Å²	58	89 Å²	89	41%	0.406	46%	0.461	S	S	.	.	H	α-helix	trans	-57.3	-42.1	175.8	-66.8	0	0	0	0	112.2	E56 V63 A64	E56-S60 WeakPolarHBondContact O-CB 3.3Å; E56-S60 PolarHBondContact O-N 2.74Å; E56-S60 PolarHBondContact O-OG 2.97Å; S60-V63 PolarHBondContact O-N 2.86Å; S60-A64 VanDerWaalsContact O-CB 3.3Å; S60-A64 WeakPolarHBondContact O-CB 3.28Å; S60-A64 PolarHBondContact O-N 2.96Å
61	Y	93.8	Very high	92.8	Very high	75 Å²	75	92.9 Å²	92.9	29%	0.294	47%	0.472	S	S	.	.	H	α-helix	trans	-63	-43.8	174.1	175.9	-90.7	0	0	0	112.1	P30 P31 S57 V58 F59 A64 S65	P30-Y61 HydrophobicContact CB-CE2 4.49Å; P30-Y61 HydrophobicContact CG-CE2 4.4Å; P31-Y61 HydrophobicContact CG-CG 4.29Å; S57-Y61 VanDerWaalsContact O-CB 3.3Å; S57-Y61 WeakPolarHBondContact O-CB 3.43Å; S57-Y61 PolarHBondContact O-N 2.93Å; V58-Y61 PolarHBondContact O-N 3.25Å; F59-Y61 VanDerWaalsContact C-N 3.3Å; F59-Y61 PolarHBondContact O-N 3.03Å; Y61-A64 PolarHBondContact O-N 3.42Å; Y61-S65 VanDerWaalsContact O-CB 3.27Å; Y61-S65 WeakPolarHBondContact O-CB 3.47Å; Y61-S65 PolarHBondContact O-N 3.07Å
62	Q	96.7	Very high	93.8	Very high	117 Å²	117	91.5 Å²	91.5	55%	0.547	47%	0.465	S	S	.	.	H	α-helix	trans	-61.4	-46.6	176.4	-79.7	-178.2	-12.5	0	0	111.7	V58 F59 A64 S65 T66	V58-Q62 WeakPolarHBondContact O-CG 3.33Å; V58-Q62 PolarHBondContact O-N 2.96Å; F59-Q62 WeakPolarHBondContact O-CB 3.45Å; F59-Q62 PolarHBondContact O-N 2.92Å; F59-Q62 VanDerWaalsContact O-N 3.08Å; Q62-A64 PolarHBondContact O-N 3.49Å; Q62-S65 WeakPolarHBondContact O-CB 3.36Å; Q62-S65 PolarHBondContact O-N 3.11Å; Q62-T66 WeakPolarHBondContact O-CG2 3.47Å; Q62-T66 PolarHBondContact O-N 3.29Å; Q62-T66 PolarHBondContact O-OG1 3.37Å
63	V	97.8	Very high	94.5	Very high	71 Å²	71	87 Å²	87	43%	0.43	45%	0.453	S	S	.	.	H	α-helix	trans	-63	-41.6	176.8	175.4	0	0	0	0	111.6	F59 S60 S65 T66 L67	F59-V63 HydrophobicContact CD1-CG2 4.42Å; F59-V63 HydrophobicContact CD2-CG2 4.47Å; F59-V63 HydrophobicContact CE1-CG2 4Å; F59-V63 HydrophobicContact CE2-CG2 4.07Å; F59-V63 HydrophobicContact CZ-CG2 3.81Å; F59-V63 WeakPolarHBondContact O-CG2 3.34Å; F59-V63 PolarHBondContact O-N 3.11Å; S60-V63 PolarHBondContact O-N 2.86Å; V63-S65 VanDerWaalsContact C-N 3.32Å; V63-S65 PolarHBondContact O-N 3.39Å; V63-T66 PolarHBondContact O-OG1 3.22Å; V63-T66 VanDerWaalsContact O-OG1 3.08Å; V63-L67 VanDerWaalsContact O-CB 3.28Å; V63-L67 WeakPolarHBondContact O-CB 3.39Å; V63-L67 PolarHBondContact O-N 2.98Å
64	A	96.3	Very high	95.2	Very high	27 Å²	27	85.8 Å²	85.8	22%	0.223	45%	0.45	C	S	.	.	H	α-helix	trans	-65.3	-36.2	174.9	0	0	0	0	0	112.2	L28 S60 Y61 Q62 K68	L28-A64 HydrophobicContact CD2-CB 3.91Å; S60-A64 VanDerWaalsContact O-CB 3.3Å; S60-A64 WeakPolarHBondContact O-CB 3.28Å; S60-A64 PolarHBondContact O-N 2.96Å; Y61-A64 PolarHBondContact O-N 3.42Å; Q62-A64 PolarHBondContact O-N 3.49Å; A64-K68 VanDerWaalsContact O-CG 3.31Å; A64-K68 WeakPolarHBondContact O-CG 3.31Å; A64-K68 PolarHBondContact O-N 2.87Å
65	S	96	Very high	95.8	Very high	54 Å²	54	86.6 Å²	86.6	38%	0.378	45%	0.452	S	S	.	.	H	α-helix	trans	-69.4	-44.7	177.1	-169.4	0	0	0	0	112.1	Y61 Q62 V63 K68 Q69	Y61-S65 VanDerWaalsContact O-CB 3.27Å; Y61-S65 WeakPolarHBondContact O-CB 3.47Å; Y61-S65 PolarHBondContact O-N 3.07Å; Q62-S65 WeakPolarHBondContact O-CB 3.36Å; Q62-S65 PolarHBondContact O-N 3.11Å; V63-S65 VanDerWaalsContact C-N 3.32Å; V63-S65 PolarHBondContact O-N 3.39Å; S65-K68 PolarHBondContact O-N 3.45Å; S65-Q69 PolarHBondContact O-N 3.24Å
66	T	97.9	Very high	96.3	Very high	85 Å²	85	84.8 Å²	84.8	52%	0.521	44%	0.438	S	S	.	.	H	α-helix	trans	-67.4	-37.4	175.9	55.2	0	0	0	0	111.5	Q62 V63 K68 Q69 V70	Q62-T66 WeakPolarHBondContact O-CG2 3.47Å; Q62-T66 PolarHBondContact O-N 3.29Å; Q62-T66 PolarHBondContact O-OG1 3.37Å; V63-T66 PolarHBondContact O-OG1 3.22Å; V63-T66 VanDerWaalsContact O-OG1 3.08Å; T66-K68 PolarHBondContact O-N 2.84Å; T66-Q69 WeakPolarHBondContact O-CB 3.43Å; T66-Q69 PolarHBondContact O-N 2.8Å; T66-V70 WeakPolarHBondContact O-CG2 3.42Å; T66-V70 PolarHBondContact O-N 2.93Å
67	L	98.4	Very high	96.7	Very high	93 Å²	93	81.5 Å²	81.5	49%	0.487	43%	0.43	S	S	.	.	H	α-helix	trans	-63.6	-38.3	173.7	-178.7	61	0	0	0	112.6	V63 K71	V63-L67 VanDerWaalsContact O-CB 3.28Å; V63-L67 WeakPolarHBondContact O-CB 3.39Å; V63-L67 PolarHBondContact O-N 2.98Å; L67-K71 WeakPolarHBondContact O-CB 3.37Å; L67-K71 WeakPolarHBondContact O-CG 3.5Å; L67-K71 PolarHBondContact O-N 3.35Å; L67-K71 VanDerWaalsContact O-N 3.11Å
68	K	98	Very high	97.3	Very high	110 Å²	110	86.4 Å²	86.4	48%	0.478	44%	0.443	S	S	.	.	H	α-helix	trans	-61.8	-46.3	171.5	-77	172.7	-178.1	179.2	0	111.1	A64 S65 T66 K71 H72	A64-K68 VanDerWaalsContact O-CG 3.31Å; A64-K68 WeakPolarHBondContact O-CG 3.31Å; A64-K68 PolarHBondContact O-N 2.87Å; S65-K68 PolarHBondContact O-N 3.45Å; T66-K68 PolarHBondContact O-N 2.84Å; K68-K71 PolarHBondContact O-N 3.45Å; K68-H72 WeakPolarHBondContact O-CB 3.38Å; K68-H72 PolarHBondContact O-N 3.46Å
69	Q	98.3	Very high	97.5	Very high	104 Å²	104	88.3 Å²	88.3	49%	0.486	45%	0.449	S	S	.	.	H	α-helix	trans	-60.1	-51.1	178.5	-171	61.5	41.8	0	0	111.6	S65 T66 K71 H72 D73	S65-Q69 PolarHBondContact O-N 3.24Å; T66-Q69 WeakPolarHBondContact O-CB 3.43Å; T66-Q69 PolarHBondContact O-N 2.8Å; Q69-K71 VanDerWaalsContact C-N 3.31Å; Q69-K71 PolarHBondContact O-N 2.88Å; Q69-H72 WeakPolarHBondContact O-CB 3.31Å; Q69-H72 PolarHBondContact O-N 3.08Å; Q69-H72 VanDerWaalsContact O-N 3.07Å; Q69-D73 WeakPolarHBondContact CG-OD2 3.28Å; Q69-D73 VanDerWaalsContact NE2-CG 3.26Å; Q69-D73 PolarHBondContact NE2-OD1 2.93Å; Q69-D73 PolarHBondContact NE2-OD2 2.78Å; Q69-D73 PolarHBondContact O-N 2.77Å
70	V	98.7	Very high	97.7	Very high	93 Å²	93	88.5 Å²	88.5	56%	0.564	45%	0.452	S	S	*	.	H	α-helix	trans	-58.9	-40.1	178.4	170.7	0	0	0	0	112.1	T66 D73 Q74	T66-V70 WeakPolarHBondContact O-CG2 3.42Å; T66-V70 PolarHBondContact O-N 2.93Å; V70-D73 PolarHBondContact O-N 2.88Å; V70-Q74 VanDerWaalsContact O-CB 3.28Å; V70-Q74 WeakPolarHBondContact O-CB 3.38Å; V70-Q74 PolarHBondContact O-N 2.94Å
71	K	98.6	Very high	97.9	Very high	129 Å²	129	93.5 Å²	93.5	56%	0.561	47%	0.466	S	S	*	.	H	α-helix	trans	-66.8	-39	175.5	-76.8	179.6	177.1	-177.7	0	112.7	L67 K68 Q69 Q75	L67-K71 WeakPolarHBondContact O-CB 3.37Å; L67-K71 WeakPolarHBondContact O-CG 3.5Å; L67-K71 PolarHBondContact O-N 3.35Å; L67-K71 VanDerWaalsContact O-N 3.11Å; K68-K71 PolarHBondContact O-N 3.45Å; Q69-K71 VanDerWaalsContact C-N 3.31Å; Q69-K71 PolarHBondContact O-N 2.88Å; K71-Q75 PolarHBondContact O-N 2.97Å; K71-Q75 VanDerWaalsContact O-N 3.11Å
72	H	98.6	Very high	98.1	Very high	110 Å²	110	95 Å²	95	51%	0.509	48%	0.478	S	S	.	.	H	α-helix	trans	-62.8	-49.8	174.3	174.8	-87.1	0	0	0	110.7	K68 Q69 Q74 Q75 V76	K68-H72 WeakPolarHBondContact O-CB 3.38Å; K68-H72 PolarHBondContact O-N 3.46Å; Q69-H72 WeakPolarHBondContact O-CB 3.31Å; Q69-H72 PolarHBondContact O-N 3.08Å; Q69-H72 VanDerWaalsContact O-N 3.07Å; H72-Q74 VanDerWaalsContact C-N 3.34Å; H72-Q74 PolarHBondContact O-N 2.95Å; H72-Q75 CarbonylContact O-C 3.57Å; H72-Q75 WeakPolarHBondContact O-CA 3.48Å; H72-Q75 WeakPolarHBondContact O-CB 3.47Å; H72-Q75 PolarHBondContact O-N 3.04Å; H72-V76 VanDerWaalsContact CE1-CG2 3.47Å; H72-V76 WeakPolarHBondContact CE1-CG2 3.44Å; H72-V76 PolarHBondContact O-N 3.01Å
73	D	98.6	Very high	98.2	Very high	70 Å²	70	92.5 Å²	92.5	37%	0.374	48%	0.478	S	S	.	.	H	α-helix	trans	-69.6	-34	-175.4	-59.3	-17.1	0	0	0	111.5	Q69 V70 Q75 V76 A77	Q69-D73 WeakPolarHBondContact CG-OD2 3.28Å; Q69-D73 VanDerWaalsContact NE2-CG 3.26Å; Q69-D73 PolarHBondContact NE2-OD1 2.93Å; Q69-D73 PolarHBondContact NE2-OD2 2.78Å; Q69-D73 PolarHBondContact O-N 2.77Å; V70-D73 PolarHBondContact O-N 2.88Å; D73-Q75 VanDerWaalsContact C-N 3.3Å; D73-Q75 PolarHBondContact O-N 3.34Å; D73-V76 PolarHBondContact O-N 3.21Å; D73-A77 VanDerWaalsContact O-CB 3.31Å; D73-A77 WeakPolarHBondContact O-CB 3.19Å; D73-A77 PolarHBondContact O-N 2.86Å
74	Q	98.7	Very high	98.2	Very high	119 Å²	119	90.7 Å²	90.7	56%	0.556	47%	0.473	S	S	*	.	H	α-helix	trans	-62.7	-35.7	168.2	-172.1	-177.7	32.2	0	0	112.2	V70 H72 R78	V70-Q74 VanDerWaalsContact O-CB 3.28Å; V70-Q74 WeakPolarHBondContact O-CB 3.38Å; V70-Q74 PolarHBondContact O-N 2.94Å; H72-Q74 VanDerWaalsContact C-N 3.34Å; H72-Q74 PolarHBondContact O-N 2.95Å; Q74-R78 WeakPolarHBondContact O-CG 3.49Å; Q74-R78 PolarHBondContact O-N 3.21Å
75	Q	98.6	Very high	98.3	Very high	82 Å²	82	93.2 Å²	93.2	38%	0.383	48%	0.483	S	S	.	.	H	α-helix	trans	-70.2	-45.4	175.1	179.3	60.3	15.6	0	0	111.3	K71 H72 D73 R78 M79	K71-Q75 PolarHBondContact O-N 2.97Å; K71-Q75 VanDerWaalsContact O-N 3.11Å; H72-Q75 CarbonylContact O-C 3.57Å; H72-Q75 WeakPolarHBondContact O-CA 3.48Å; H72-Q75 WeakPolarHBondContact O-CB 3.47Å; H72-Q75 PolarHBondContact O-N 3.04Å; D73-Q75 VanDerWaalsContact C-N 3.3Å; D73-Q75 PolarHBondContact O-N 3.34Å; Q75-R78 PolarHBondContact O-N 3.47Å; Q75-M79 WeakPolarHBondContact O-CG 3.49Å; Q75-M79 PolarHBondContact O-N 2.86Å
76	V	98.7	Very high	98.3	Very high	51 Å²	51	94.1 Å²	94.1	31%	0.309	49%	0.486	S	S	.	.	H	α-helix	trans	-58.7	-51.7	176.2	173.2	0	0	0	0	110.5	H72 D73 R78 M79 E80	H72-V76 VanDerWaalsContact CE1-CG2 3.47Å; H72-V76 WeakPolarHBondContact CE1-CG2 3.44Å; H72-V76 PolarHBondContact O-N 3.01Å; D73-V76 PolarHBondContact O-N 3.21Å; V76-R78 PolarHBondContact O-N 3.2Å; V76-R78 VanDerWaalsContact O-N 3.15Å; V76-M79 CarbonylContact O-C 3.58Å; V76-M79 WeakPolarHBondContact O-CA 3.48Å; V76-M79 WeakPolarHBondContact O-CB 3.27Å; V76-M79 PolarHBondContact O-N 2.84Å; V76-E80 HydrophobicContact CG1-CG 4.18Å; V76-E80 WeakPolarHBondContact CG1-OE1 3.36Å; V76-E80 WeakPolarHBondContact O-CG 3.45Å; V76-E80 PolarHBondContact O-N 2.82Å
77	A	98.6	Very high	98.2	Very high	43 Å²	43	96.7 Å²	96.7	36%	0.355	49%	0.492	S	S	.	.	H	α-helix	trans	-62	-25.6	178.8	0	0	0	0	0	113.8	D73 K81	D73-A77 VanDerWaalsContact O-CB 3.31Å; D73-A77 WeakPolarHBondContact O-CB 3.19Å; D73-A77 PolarHBondContact O-N 2.86Å; A77-K81 VanDerWaalsContact O-CG 3.3Å; A77-K81 WeakPolarHBondContact O-CG 3.3Å; A77-K81 PolarHBondContact O-N 3.5Å
78	R	98.7	Very high	98.1	Very high	138 Å²	138	98.3 Å²	98.3	52%	0.521	50%	0.497	S	S	.	.	H	α-helix	trans	-73.7	-43.2	169.2	-77.5	-170.2	-61	-177.2	0.8	111.8	Q74 Q75 V76 K81 L82	Q74-R78 WeakPolarHBondContact O-CG 3.49Å; Q74-R78 PolarHBondContact O-N 3.21Å; Q75-R78 PolarHBondContact O-N 3.47Å; V76-R78 PolarHBondContact O-N 3.2Å; V76-R78 VanDerWaalsContact O-N 3.15Å; R78-K81 PolarHBondContact O-N 3.39Å; R78-L82 WeakPolarHBondContact O-CG 3.47Å; R78-L82 PolarHBondContact O-N 2.89Å
79	M	98.8	Very high	98	Very high	105 Å²	105	99.1 Å²	99.1	52%	0.517	51%	0.506	S	S	.	.	H	α-helix	trans	-65	-40.7	177.6	-67.8	-58.5	-58.4	0	0	112.1	Q75 V76 L82 A83	Q75-M79 WeakPolarHBondContact O-CG 3.49Å; Q75-M79 PolarHBondContact O-N 2.86Å; V76-M79 CarbonylContact O-C 3.58Å; V76-M79 WeakPolarHBondContact O-CA 3.48Å; V76-M79 WeakPolarHBondContact O-CB 3.27Å; V76-M79 PolarHBondContact O-N 2.84Å; M79-L82 PolarHBondContact O-N 3.47Å; M79-L82 HydrophobicContact SD-CD1 4.49Å; M79-A83 WeakPolarHBondContact O-CB 3.37Å; M79-A83 PolarHBondContact O-N 3.22Å
80	E	98.4	Very high	97.8	Very high	125 Å²	125	100 Å²	100	58%	0.584	51%	0.51	S	S	*	.	H	α-helix	trans	-60.9	-44.4	175.2	-71.2	171.4	164.6	0	0	111.7	V76 L82 A83 G84	V76-E80 HydrophobicContact CG1-CG 4.18Å; V76-E80 WeakPolarHBondContact CG1-OE1 3.36Å; V76-E80 WeakPolarHBondContact O-CG 3.45Å; V76-E80 PolarHBondContact O-N 2.82Å; E80-L82 VanDerWaalsContact C-N 3.35Å; E80-L82 PolarHBondContact O-N 2.91Å; E80-A83 PolarHBondContact O-N 2.87Å; E80-G84 PolarHBondContact O-N 3.19Å
81	K	98.4	Very high	97.5	Very high	163 Å²	163	98.5 Å²	98.5	71%	0.709	51%	0.507	S	S	*	.	H	α-helix	trans	-61.9	-40.5	174.1	-75.4	177.6	-179.6	-172.1	0	112.7	A77 R78 G84 L85	A77-K81 VanDerWaalsContact O-CG 3.3Å; A77-K81 WeakPolarHBondContact O-CG 3.3Å; A77-K81 PolarHBondContact O-N 3.5Å; R78-K81 PolarHBondContact O-N 3.39Å; K81-G84 PolarHBondContact O-N 2.85Å; K81-L85 PolarHBondContact O-N 3.35Å
82	L	98.4	Very high	97.4	Very high	106 Å²	106	95.4 Å²	95.4	56%	0.555	50%	0.497	S	S	*	.	H	α-helix	trans	-68.4	-35.4	176.3	-70.2	173.2	0	0	0	112.2	R78 M79 E80 L85	R78-L82 WeakPolarHBondContact O-CG 3.47Å; R78-L82 PolarHBondContact O-N 2.89Å; M79-L82 PolarHBondContact O-N 3.47Å; M79-L82 HydrophobicContact SD-CD1 4.49Å; E80-L82 VanDerWaalsContact C-N 3.35Å; E80-L82 PolarHBondContact O-N 2.91Å; L82-L85 HydrophobicContact CD2-CD1 3.94Å; L82-L85 WeakPolarHBondContact O-CB 3.43Å; L82-L85 PolarHBondContact O-N 3.42Å
83	A	98	Very high	97.1	Very high	64 Å²	64	96.4 Å²	96.4	53%	0.529	50%	0.502	S	S	.	.	H	α-helix	trans	-66.4	-38.9	173.6	0	0	0	0	0	111.7	M79 E80 L85 V86	M79-A83 WeakPolarHBondContact O-CB 3.37Å; M79-A83 PolarHBondContact O-N 3.22Å; E80-A83 PolarHBondContact O-N 2.87Å; A83-L85 PolarHBondContact O-N 3.08Å; A83-V86 WeakPolarHBondContact O-CB 3.47Å; A83-V86 WeakPolarHBondContact O-CG2 3.24Å; A83-V86 PolarHBondContact O-N 2.99Å; A83-V86 VanDerWaalsContact O-N 3.11Å
84	G	97.3	Very high	96.7	Very high	33 Å²	33	102.7 Å²	102.7	34%	0.34	52%	0.521	S	S	.	.	H	α-helix	trans	-61.9	-19.2	175.2	0	0	0	0	0	114.9	E80 K81 V86 E87	E80-G84 PolarHBondContact O-N 3.19Å; K81-G84 PolarHBondContact O-N 2.85Å; G84-V86 PolarHBondContact O-N 2.79Å; G84-E87 PolarHBondContact O-N 2.95Å
85	L	98	Very high	96.5	Very high	80 Å²	80	102.2 Å²	102.2	42%	0.419	52%	0.517	S	S	.	.	H	α-helix	trans	-66.1	-14.4	173.7	-61.7	177.5	0	0	0	113.3	K81 L82 A83 E88 L89	K81-L85 PolarHBondContact O-N 3.35Å; L82-L85 HydrophobicContact CD2-CD1 3.94Å; L82-L85 WeakPolarHBondContact O-CB 3.43Å; L82-L85 PolarHBondContact O-N 3.42Å; A83-L85 PolarHBondContact O-N 3.08Å; L85-E88 PolarHBondContact O-N 2.92Å; L85-L89 WeakPolarHBondContact O-CB 3.46Å; L85-L89 PolarHBondContact O-N 2.87Å
86	V	97.1	Very high	96.1	Very high	73 Å²	73	105.6 Å²	105.6	44%	0.442	53%	0.53	S	S	.	.	H	α-helix	trans	-65.5	-44.4	172.8	177	0	0	0	0	110.5	A83 G84 E88 L89 E90	A83-V86 WeakPolarHBondContact O-CB 3.47Å; A83-V86 WeakPolarHBondContact O-CG2 3.24Å; A83-V86 PolarHBondContact O-N 2.99Å; A83-V86 VanDerWaalsContact O-N 3.11Å; G84-V86 PolarHBondContact O-N 2.79Å; V86-E88 VanDerWaalsContact C-N 3.31Å; V86-E88 PolarHBondContact O-N 2.88Å; V86-L89 WeakPolarHBondContact O-CB 3.35Å; V86-L89 PolarHBondContact O-N 2.73Å; V86-L89 VanDerWaalsContact O-N 3.08Å; V86-E90 WeakPolarHBondContact O-CG 3.48Å; V86-E90 PolarHBondContact O-N 2.88Å
87	E	96.2	Very high	95.7	Very high	140 Å²	140	109 Å²	109	65%	0.654	54%	0.541	S	S	*	.	H	α-helix	trans	-61.9	-39.4	176.8	-52.9	-72.9	151.9	0	0	111.4	G84 A91	G84-E87 PolarHBondContact O-N 2.95Å; E87-A91 WeakPolarHBondContact O-CB 3.26Å; E87-A91 PolarHBondContact O-N 3.45Å
88	E	95.6	Very high	95.4	Very high	127 Å²	127	109.9 Å²	109.9	59%	0.593	54%	0.543	S	S	*	.	H	α-helix	trans	-65.7	-37.8	174	-66.4	-176.6	-163.1	0	0	112	L85 V86 D92	L85-E88 PolarHBondContact O-N 2.92Å; V86-E88 VanDerWaalsContact C-N 3.31Å; V86-E88 PolarHBondContact O-N 2.88Å; E88-D92 WeakPolarHBondContact O-CB 3.3Å; E88-D92 PolarHBondContact O-N 3.02Å
89	L	95.4	Very high	95.2	Very high	127 Å²	127	107.9 Å²	107.9	67%	0.665	54%	0.541	S	S	*	.	H	α-helix	trans	-68.5	-42.3	178.4	-175.3	67.2	0	0	0	111.8	L85 V86 D92 E93	L85-L89 WeakPolarHBondContact O-CB 3.46Å; L85-L89 PolarHBondContact O-N 2.87Å; V86-L89 WeakPolarHBondContact O-CB 3.35Å; V86-L89 PolarHBondContact O-N 2.73Å; V86-L89 VanDerWaalsContact O-N 3.08Å; L89-D92 CarbonylContact O-C 3.6Å; L89-D92 PolarHBondContact O-N 3.3Å; L89-E93 PolarHBondContact O-N 2.92Å
90	E	93.4	Very high	95	Very high	121 Å²	121	107 Å²	107	57%	0.565	54%	0.536	S	S	*	.	H	α-helix	trans	-63.6	-43.5	174.9	-70.8	179.4	-164.4	0	0	111.2	V86 D92 E93	V86-E90 WeakPolarHBondContact O-CG 3.48Å; V86-E90 PolarHBondContact O-N 2.88Å; E90-D92 PolarHBondContact O-N 2.94Å; E90-E93 WeakPolarHBondContact O-CB 3.48Å; E90-E93 PolarHBondContact O-N 3.16Å
91	A	93.9	Very high	94.7	Very high	62 Å²	62	103 Å²	103	51%	0.512	52%	0.518	S	S	.	.	H	α-helix	trans	-63	-27.3	176.3	0	0	0	0	0	113.8	E87 W94	E87-A91 WeakPolarHBondContact O-CB 3.26Å; E87-A91 PolarHBondContact O-N 3.45Å; A91-W94 PolarHBondContact O-NE1 2.89Å; A91-W94 VanDerWaalsContact O-NE1 3.13Å
92	D	95	Very high	94.5	Very high	65 Å²	65	100.6 Å²	100.6	35%	0.348	51%	0.512	S	S	.	.	H	α-helix	trans	-99.7	-0.1	-180	-94.1	27.7	0	0	0	114.4	E88 L89 E90 W94 K95	E88-D92 WeakPolarHBondContact O-CB 3.3Å; E88-D92 PolarHBondContact O-N 3.02Å; L89-D92 CarbonylContact O-C 3.6Å; L89-D92 PolarHBondContact O-N 3.3Å; E90-D92 PolarHBondContact O-N 2.94Å; D92-W94 VanDerWaalsContact C-N 3.29Å; D92-W94 PolarHBondContact O-N 3.39Å; D92-K95 HydrophobicContact CB-CD 4.3Å; D92-K95 WeakPolarHBondContact O-CB 3.36Å; D92-K95 PolarHBondContact O-N 3.32Å; D92-K95 WeakPolarHBondContact OD1-CE 3.4Å; D92-K95 IonicContact OD1-NZ 2.76Å; D92-K95 PolarHBondContact OD1-NZ 3.08Å; D92-K95 WeakPolarHBondContact OD2-CD 3.23Å; D92-K95 IonicContact OD2-NZ 3.96Å; D92-K95 PolarHBondContact OD2-NZ 3.36Å
93	E	92.4	Very high	94.3	Very high	131 Å²	131	100.9 Å²	100.9	61%	0.612	51%	0.513	S	S	*	.	G	3₁₀ helix	trans	-54.5	-43.5	-175.5	-174.8	177.4	-151.9	0	0	112.2	L89 E90 K95 K96	L89-E93 PolarHBondContact O-N 2.92Å; E90-E93 WeakPolarHBondContact O-CB 3.48Å; E90-E93 PolarHBondContact O-N 3.16Å; E93-K95 PolarHBondContact O-N 3.2Å; E93-K96 PolarHBondContact O-N 3.35Å
94	W	91.6	Very high	94.2	Very high	202 Å²	202	100.7 Å²	100.7	77%	0.765	52%	0.518	S	S	*	.	G	3₁₀ helix	trans	-59.4	-18.6	179.4	69.8	-88.3	0	0	0	114.6	A91 D92 K96	A91-W94 PolarHBondContact O-NE1 2.89Å; A91-W94 VanDerWaalsContact O-NE1 3.13Å; D92-W94 VanDerWaalsContact C-N 3.29Å; D92-W94 PolarHBondContact O-N 3.39Å; W94-K96 VanDerWaalsContact C-N 3.32Å
95	K	93.4	Very high	94.1	Very high	109 Å²	109	106.8 Å²	106.8	47%	0.474	54%	0.535	S	S	.	.	G	3₁₀ helix	trans	-83.8	-8.4	176.7	-57.4	174.6	-175.1	160.6	0	112.7	D92 E93	D92-K95 HydrophobicContact CB-CD 4.3Å; D92-K95 WeakPolarHBondContact O-CB 3.36Å; D92-K95 PolarHBondContact O-N 3.32Å; D92-K95 WeakPolarHBondContact OD1-CE 3.4Å; D92-K95 IonicContact OD1-NZ 2.76Å; D92-K95 PolarHBondContact OD1-NZ 3.08Å; D92-K95 WeakPolarHBondContact OD2-CD 3.23Å; D92-K95 IonicContact OD2-NZ 3.96Å; D92-K95 PolarHBondContact OD2-NZ 3.36Å; E93-K95 PolarHBondContact O-N 3.2Å
96	K	90.5	Very high	93.8	Very high	153 Å²	153	106 Å²	106	67%	0.665	53%	0.534	S	S	*	.	S	Bend	trans	-115.9	164.6	-173.3	-55.9	-59.4	-179	-178.6	0	110.5	E93 W94	E93-K96 PolarHBondContact O-N 3.35Å; W94-K96 VanDerWaalsContact C-N 3.32Å
97	K	91.6	Very high	93.4	Very high	123 Å²	123	108.2 Å²	108.2	54%	0.535	55%	0.549	S	S	.	.			trans	-76.6	138.8	167.1	-68.5	-169	176.6	-168.9	0	108.6	L102	K97-L102 HydrophobicContact CB-CD1 4.31Å; K97-L102 HydrophobicContact CB-CD2 3.96Å; K97-L102 HydrophobicContact CB-CG 3.97Å; K97-L102 HydrophobicContact CD-CD2 4.11Å
98	P	92	Very high	92.6	Very high	61 Å²	61	105.1 Å²	105.1	40%	0.396	54%	0.543	S	S	.	.			trans	-52	142.8	172.5	-27	35	0	0	0	111.9	E100 Q101 L102	P98-E100 WeakPolarHBondContact CB-OE2 3.48Å; P98-E100 PolarHBondContact O-N 2.87Å; P98-Q101 PolarHBondContact O-N 3.49Å; P98-Q101 VanDerWaalsContact O-N 3.15Å; P98-L102 PolarHBondContact O-N 3.46Å
99	I	93.2	Very high	91.4	Very high	95 Å²	95	104.2 Å²	104.2	49%	0.487	55%	0.551	S	S	.	*	H	α-helix	trans	-64.2	-31.3	-174.6	-171.6	58.9	0	0	0	111.5	Q101 L102 L103	I99-Q101 VanDerWaalsContact C-N 3.32Å; I99-Q101 PolarHBondContact O-N 3.32Å; I99-L102 PolarHBondContact O-N 3.08Å; I99-L103 HydrophobicContact CD1-CD1 4.19Å; I99-L103 HydrophobicContact CD1-CG 4.14Å; I99-L103 HydrophobicContact CG1-CD1 3.84Å; I99-L103 HydrophobicContact CG1-CG 4.22Å; I99-L103 WeakPolarHBondContact O-CB 3.42Å; I99-L103 VanDerWaalsContact O-CG 3.29Å; I99-L103 WeakPolarHBondContact O-CG 3.5Å; I99-L103 PolarHBondContact O-N 2.81Å
100	E	94.3	Very high	89.7	Confident	88 Å²	88	105.2 Å²	105.2	41%	0.411	59%	0.592	S	S	.	*	H	α-helix	trans	-62.3	-39.5	176.9	-58.8	72.3	-158.6	0	0	111.8	P98 G104 F105 T106	P98-E100 WeakPolarHBondContact CB-OE2 3.48Å; P98-E100 PolarHBondContact O-N 2.87Å; E100-G104 PolarHBondContact O-N 2.89Å; E100-F105 HydrophobicContact CB-CB 4.24Å; E100-F105 PolarHBondContact O-N 3.25Å; E100-T106 HydrophobicContact CB-CG2 4.16Å; E100-T106 PolarHBondContact O-N 3.34Å
101	Q	93.9	Very high	89.5	Confident	41 Å²	41	104.5 Å²	104.5	19%	0.192	59%	0.594	C	S	.	*	H	α-helix	trans	-74	-34.6	178.7	-172.6	-175.3	-7.7	0	0	111.1	P98 I99 G104 T106 S108	P98-Q101 PolarHBondContact O-N 3.49Å; P98-Q101 VanDerWaalsContact O-N 3.15Å; I99-Q101 VanDerWaalsContact C-N 3.32Å; I99-Q101 PolarHBondContact O-N 3.32Å; Q101-G104 PolarHBondContact O-N 2.97Å; Q101-T106 WeakPolarHBondContact CA-OG1 3.33Å; Q101-T106 PolarHBondContact N-OG1 2.64Å; Q101-S108 PolarHBondContact NE2-OG 3.05Å
102	L	93.1	Very high	89.3	Confident	112 Å²	112	106.7 Å²	106.7	59%	0.586	60%	0.598	S	S	*	*	H	α-helix	trans	-70.6	-34.2	174.8	-67.6	175.6	0	0	0	112.5	K97 P98 I99 G104	K97-L102 HydrophobicContact CB-CD1 4.31Å; K97-L102 HydrophobicContact CB-CD2 3.96Å; K97-L102 HydrophobicContact CB-CG 3.97Å; K97-L102 HydrophobicContact CD-CD2 4.11Å; P98-L102 PolarHBondContact O-N 3.46Å; I99-L102 PolarHBondContact O-N 3.08Å; L102-G104 VanDerWaalsContact C-N 3.34Å
103	L	95.4	Very high	89	Confident	111 Å²	111	109 Å²	109	58%	0.581	61%	0.612	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.3	-3	176.2	-63.7	177.9	0	0	0	113.4	I99 F105	I99-L103 HydrophobicContact CD1-CD1 4.19Å; I99-L103 HydrophobicContact CD1-CG 4.14Å; I99-L103 HydrophobicContact CG1-CD1 3.84Å; I99-L103 HydrophobicContact CG1-CG 4.22Å; I99-L103 WeakPolarHBondContact O-CB 3.42Å; I99-L103 VanDerWaalsContact O-CG 3.29Å; I99-L103 WeakPolarHBondContact O-CG 3.5Å; I99-L103 PolarHBondContact O-N 2.81Å; L103-F105 VanDerWaalsContact C-N 3.34Å; L103-F105 HydrophobicContact CB-CD2 3.75Å; L103-F105 HydrophobicContact CB-CE2 3.69Å; L103-F105 HydrophobicContact CD1-CD2 4.35Å; L103-F105 HydrophobicContact CD1-CE2 3.77Å; L103-F105 HydrophobicContact CG-CE2 4.39Å; L103-F105 PolarHBondContact O-N 3.46Å
104	G	94.3	Very high	88.8	Confident	61 Å²	61	107.7 Å²	107.7	63%	0.629	61%	0.612	S	S	*	*	T	Hydrogen-bonded Turn	trans	75.9	14.9	176.8	0	0	0	0	0	115.2	E100 Q101 L102 T106	E100-G104 PolarHBondContact O-N 2.89Å; Q101-G104 PolarHBondContact O-N 2.97Å; L102-G104 VanDerWaalsContact C-N 3.34Å; G104-T106 VanDerWaalsContact C-N 3.3Å
105	F	95.2	Very high	88.6	Confident	160 Å²	160	101.8 Å²	101.8	70%	0.702	60%	0.602	S	S	*	*	S	Bend	trans	-71.4	-26.4	172.5	-63.5	-54.4	0	0	0	112.5	E100 L103	E100-F105 HydrophobicContact CB-CB 4.24Å; E100-F105 PolarHBondContact O-N 3.25Å; L103-F105 VanDerWaalsContact C-N 3.34Å; L103-F105 HydrophobicContact CB-CD2 3.75Å; L103-F105 HydrophobicContact CB-CE2 3.69Å; L103-F105 HydrophobicContact CD1-CD2 4.35Å; L103-F105 HydrophobicContact CD1-CE2 3.77Å; L103-F105 HydrophobicContact CG-CE2 4.39Å; L103-F105 PolarHBondContact O-N 3.46Å
106	T	93.3	Very high	88.3	Confident	65 Å²	65	101.3 Å²	101.3	40%	0.399	61%	0.611	S	S	.	*	S	Bend	trans	-122.9	145.5	174.2	54.8	0	0	0	0	110.9	E100 Q101 G104	E100-T106 HydrophobicContact CB-CG2 4.16Å; E100-T106 PolarHBondContact O-N 3.34Å; Q101-T106 WeakPolarHBondContact CA-OG1 3.33Å; Q101-T106 PolarHBondContact N-OG1 2.64Å; G104-T106 VanDerWaalsContact C-N 3.3Å
107	P	86.8	Confident	88.1	Confident	118 Å²	118	97.6 Å²	97.6	77%	0.766	61%	0.607	S	S	*	*	P	Polyproline II helix	trans	-64.5	142.6	174.6	28.2	-34.3	0	0	0	109.9	S109	P107-S109 PolarHBondContact O-N 3.18Å
108	S	80	Confident	87.8	Confident	75 Å²	75	95.7 Å²	95.7	52%	0.524	61%	0.613	S	S	.	*	P	Polyproline II helix	trans	-66	120	174.5	-173.9	0	0	0	0	110	Q101 G110	Q101-S108 PolarHBondContact NE2-OG 3.05Å; S108-G110 PolarHBondContact O-N 2.92Å; S108-G110 VanDerWaalsContact O-N 3.1Å
109	S	70.3	Confident	87.5	Confident	108 Å²	108	98.6 Å²	98.6	76%	0.755	63%	0.631	S	S	*	*	P	Polyproline II helix	trans	-54.1	117	159.7	-54.5	0	0	0	0	107.9	P107	P107-S109 PolarHBondContact O-N 3.18Å
110	G	60	Low	87	Confident	149 Å²	149	98.9 Å²	98.9	100%	1.536	64%	0.644	S	S	*	*			trans	-95.9	0	178.4	0	0	0	0	0	111.7	S108	S108-G110 PolarHBondContact O-N 2.92Å; S108-G110 VanDerWaalsContact O-N 3.1Å

Retrieved 110 of 110 residues in 77 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).