A0A093H1N3_STRCA Loading...

Anaphase-promoting complex subunit 13

Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. The APC/C complex catalyzes assembly of branched 'Lys-11'-/'Lys-48'-linked branched ubiquitin chains on target proteins.

AlphaFold DB (U3ICR0), UniProt , Accession A0A093H1N3, Species STRCA (Struthio camelus australis), Gene n/a, Length 74 aa.

						>A0A093H1N3_STRCA|A0A093H1N3
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPTGN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	75.1	Confident	90.9	Very high	197 Å²	197	133.1 Å²	133.1	97%	0.97	68%	0.68	S	S	*	*				0	117.2	0	-154.6	132.3	79.6	0	0	105.6	S3 E4	M1-S3 PolarHBondContact O-N 3.09Å; M1-S3 VanDerWaalsContact O-N 3.14Å; M1-E4 PolarHBondContact O-N 2.91Å
2	D	86.5	Confident	91.2	Very high	175 Å²	175	130.6 Å²	130.6	94%	0.936	67%	0.668	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.8	-4.5	-166.6	-53.8	-27.7	0	0	0	113.4	E4	D2-E4 VanDerWaalsContact C-N 3.33Å
3	S	92.6	Very high	91.5	Very high	106 Å²	106	132 Å²	132	74%	0.741	68%	0.678	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.3	-15	174.8	58.1	0	0	0	0	114.1	M1	M1-S3 PolarHBondContact O-N 3.09Å; M1-S3 VanDerWaalsContact O-N 3.14Å
4	E	91.6	Very high	92	Very high	124 Å²	124	130.8 Å²	130.8	58%	0.579	67%	0.673	S	S	*	*	S	Bend	trans	-115.1	123.4	-178.8	-173.6	157.9	-154	0	0	111.9	M1 D2 Q6	M1-E4 PolarHBondContact O-N 2.91Å; D2-E4 VanDerWaalsContact C-N 3.33Å; E4-Q6 PolarHBondContact O-N 3.09Å
5	V	91.8	Very high	92.2	Very high	106 Å²	106	125.9 Å²	125.9	64%	0.642	65%	0.648	S	S	*	*	P	Polyproline II helix	trans	-72.6	125.5	175.4	65.9	0	0	0	0	110.1	R7	V5-R7 PolarHBondContact O-N 3.47Å
6	Q	91.8	Very high	92.5	Very high	166 Å²	166	124.1 Å²	124.1	78%	0.776	64%	0.639	S	S	*	*	P	Polyproline II helix	trans	-70.4	122.6	171.3	-62.5	-61.9	-56.5	0	0	108.9	E4	E4-Q6 PolarHBondContact O-N 3.09Å
7	R	90.5	Very high	92.8	Very high	164 Å²	164	124.2 Å²	124.2	62%	0.619	64%	0.641	S	S	*	*	P	Polyproline II helix	trans	-89.7	143.4	176.3	-64.5	178	177.5	84.1	-2	109.6	V5 G9 L12	V5-R7 PolarHBondContact O-N 3.47Å; R7-G9 PolarHBondContact O-N 3.15Å; R7-L12 HydrophobicContact CB-CD1 4.07Å
8	D	95.4	Very high	93.1	Very high	100 Å²	100	121.2 Å²	121.2	54%	0.535	64%	0.638	S	S	.	*			trans	-72.8	113.2	175	-173.7	-16.8	0	0	0	110.1	R10 I11 L12	D8-R10 PolarHBondContact O-N 3.35Å; D8-R10 WeakPolarHBondContact OD1-CB 3.09Å; D8-R10 PolarHBondContact OD1-N 3.39Å; D8-I11 HydrophobicContact CB-CB 4.17Å; D8-I11 HydrophobicContact CB-CG1 3.79Å; D8-I11 PolarHBondContact O-N 3.29Å; D8-I11 VanDerWaalsContact O-N 3.12Å; D8-L12 PolarHBondContact O-N 3.04Å; D8-L12 VanDerWaalsContact O-N 3.16Å
9	G	93.6	Very high	93.3	Very high	51 Å²	51	123.7 Å²	123.7	53%	0.526	64%	0.638	S	S	.	*	H	α-helix	trans	-61.1	-30.1	-179.5	0	0	0	0	0	113.7	R7 I11 L12 D13	R7-G9 PolarHBondContact O-N 3.15Å; G9-I11 VanDerWaalsContact C-N 3.34Å; G9-L12 PolarHBondContact O-N 3.09Å; G9-D13 PolarHBondContact O-N 3.03Å; G9-D13 VanDerWaalsContact O-N 3.12Å
10	R	95.9	Very high	93.4	Very high	190 Å²	190	126.4 Å²	126.4	72%	0.717	64%	0.64	S	S	*	*	H	α-helix	trans	-68.2	-36.7	176	-179.6	-179.8	176.3	-178.9	-1.1	111.4	D8 D13 L14	D8-R10 PolarHBondContact O-N 3.35Å; D8-R10 WeakPolarHBondContact OD1-CB 3.09Å; D8-R10 PolarHBondContact OD1-N 3.39Å; R10-D13 PolarHBondContact O-N 3.04Å; R10-L14 HydrophobicContact CG-CD1 4.23Å; R10-L14 WeakPolarHBondContact O-CG 3.41Å; R10-L14 PolarHBondContact O-N 3.48Å
11	I	95.5	Very high	93.6	Very high	85 Å²	85	126.6 Å²	126.6	44%	0.436	64%	0.638	S	S	.	*	H	α-helix	trans	-69.3	-39.2	177.4	-60	-60.8	0	0	0	110.1	D8 G9 D13 L14 I15	D8-I11 HydrophobicContact CB-CB 4.17Å; D8-I11 HydrophobicContact CB-CG1 3.79Å; D8-I11 PolarHBondContact O-N 3.29Å; D8-I11 VanDerWaalsContact O-N 3.12Å; G9-I11 VanDerWaalsContact C-N 3.34Å; I11-D13 VanDerWaalsContact C-N 3.29Å; I11-D13 PolarHBondContact O-N 3.44Å; I11-L14 PolarHBondContact O-N 3.46Å; I11-I15 HydrophobicContact CG2-CD1 3.56Å; I11-I15 HydrophobicContact CG2-CG1 4.34Å; I11-I15 WeakPolarHBondContact O-CG1 3.23Å; I11-I15 PolarHBondContact O-N 2.89Å
12	L	94	Very high	94.7	Very high	103 Å²	103	122.5 Å²	122.5	54%	0.539	62%	0.62	S	S	.	*	H	α-helix	trans	-64.8	-30.6	175.9	-66.2	179.7	0	0	0	113.5	R7 D8 G9	R7-L12 HydrophobicContact CB-CD1 4.07Å; D8-L12 PolarHBondContact O-N 3.04Å; D8-L12 VanDerWaalsContact O-N 3.16Å; G9-L12 PolarHBondContact O-N 3.09Å
13	D	95.8	Very high	95.2	Very high	149 Å²	149	122.5 Å²	122.5	80%	0.797	61%	0.612	S	S	*	*	H	α-helix	trans	-78.9	-22.4	177.9	-164.9	46.6	0	0	0	112.9	G9 R10 I11	G9-D13 PolarHBondContact O-N 3.03Å; G9-D13 VanDerWaalsContact O-N 3.12Å; R10-D13 PolarHBondContact O-N 3.04Å; I11-D13 VanDerWaalsContact C-N 3.29Å; I11-D13 PolarHBondContact O-N 3.44Å
14	L	97.4	Very high	95.4	Very high	115 Å²	115	124.8 Å²	124.8	60%	0.602	62%	0.615	S	S	*	*	H	α-helix	trans	-87.5	-28.1	179.6	-74.3	170.5	0	0	0	113.7	R10 I11	R10-L14 HydrophobicContact CG-CD1 4.23Å; R10-L14 WeakPolarHBondContact O-CG 3.41Å; R10-L14 PolarHBondContact O-N 3.48Å; I11-L14 PolarHBondContact O-N 3.46Å
15	I	96	Very high	95.7	Very high	58 Å²	58	123.3 Å²	123.3	30%	0.297	62%	0.616	S	S	.	*			trans	-88.7	118.5	-176.8	-61.3	168.6	0	0	0	108.8	I11 W19 R20	I11-I15 HydrophobicContact CG2-CD1 3.56Å; I11-I15 HydrophobicContact CG2-CG1 4.34Å; I11-I15 WeakPolarHBondContact O-CG1 3.23Å; I11-I15 PolarHBondContact O-N 2.89Å; I15-W19 HydrophobicContact CB-CE3 4.14Å; I15-W19 HydrophobicContact CG1-CE3 3.78Å; I15-W19 HydrophobicContact CG1-CH2 4.4Å; I15-W19 HydrophobicContact CG1-CZ3 3.69Å; I15-W19 HydrophobicContact CG2-CB 4.28Å; I15-W19 HydrophobicContact CG2-CD2 4.26Å; I15-W19 HydrophobicContact CG2-CE3 3.99Å; I15-W19 HydrophobicContact CG2-CG 4.42Å; I15-R20 HydrophobicContact CG2-CB 4.02Å
16	D	96.8	Very high	95.9	Very high	96 Å²	96	129.4 Å²	129.4	51%	0.513	63%	0.63	S	S	.	*			trans	-80.7	167.1	172.5	68.9	4.8	0	0	0	112.2	A18 W19 R20	D16-A18 PolarHBondContact O-N 2.99Å; D16-A18 PolarHBondContact OD1-N 3.48Å; D16-W19 PolarHBondContact O-N 3.21Å; D16-W19 WeakPolarHBondContact OD1-CB 3.47Å; D16-W19 PolarHBondContact OD1-N 3.3Å; D16-R20 WeakPolarHBondContact O-CB 3.44Å; D16-R20 PolarHBondContact O-N 3.5Å
17	D	97.1	Very high	96.1	Very high	126 Å²	126	129.2 Å²	129.2	67%	0.674	63%	0.629	S	S	*	*	H	α-helix	trans	-63.3	-29.2	-178.8	-68.4	-31.3	0	0	0	112.1	E21	D17-E21 WeakPolarHBondContact O-CG 3.42Å; D17-E21 PolarHBondContact O-N 3.48Å
18	A	97.6	Very high	96.4	Very high	71 Å²	71	129 Å²	129	59%	0.587	64%	0.64	S	S	*	*	H	α-helix	trans	-67.1	-48.4	178.6	0	0	0	0	0	111.5	D16 R20 E21 D22	D16-A18 PolarHBondContact O-N 2.99Å; D16-A18 PolarHBondContact OD1-N 3.48Å; A18-R20 VanDerWaalsContact C-N 3.34Å; A18-E21 PolarHBondContact O-N 3.42Å; A18-D22 PolarHBondContact O-N 3.03Å; A18-D22 VanDerWaalsContact O-N 3.11Å
19	W	96.9	Very high	96.3	Very high	169 Å²	169	129.8 Å²	129.8	64%	0.64	65%	0.648	S	S	*	*	H	α-helix	trans	-68.9	-35.3	177.5	-175.6	19.7	0	0	0	111.9	I15 D16 E21 D22	I15-W19 HydrophobicContact CB-CE3 4.14Å; I15-W19 HydrophobicContact CG1-CE3 3.78Å; I15-W19 HydrophobicContact CG1-CH2 4.4Å; I15-W19 HydrophobicContact CG1-CZ3 3.69Å; I15-W19 HydrophobicContact CG2-CB 4.28Å; I15-W19 HydrophobicContact CG2-CD2 4.26Å; I15-W19 HydrophobicContact CG2-CE3 3.99Å; I15-W19 HydrophobicContact CG2-CG 4.42Å; D16-W19 PolarHBondContact O-N 3.21Å; D16-W19 WeakPolarHBondContact OD1-CB 3.47Å; D16-W19 PolarHBondContact OD1-N 3.3Å; W19-E21 VanDerWaalsContact C-N 3.29Å; W19-E21 PolarHBondContact O-N 3.26Å; W19-D22 WeakPolarHBondContact O-CB 3.38Å; W19-D22 PolarHBondContact O-N 3.37Å
20	R	95.8	Very high	96.5	Very high	177 Å²	177	132 Å²	132	67%	0.668	66%	0.661	S	S	*	*	H	α-helix	trans	-61.4	-37.2	177.4	-175.7	175.8	177.9	-179.2	-1.9	113.1	I15 D16 A18	I15-R20 HydrophobicContact CG2-CB 4.02Å; D16-R20 WeakPolarHBondContact O-CB 3.44Å; D16-R20 PolarHBondContact O-N 3.5Å; A18-R20 VanDerWaalsContact C-N 3.34Å
21	E	97.8	Very high	96.4	Very high	131 Å²	131	127.3 Å²	127.3	61%	0.612	65%	0.649	S	S	*	*	H	α-helix	trans	-94.9	-3.6	-178.6	-61.1	-58.2	141.7	0	0	113.3	D17 A18 W19	D17-E21 WeakPolarHBondContact O-CG 3.42Å; D17-E21 PolarHBondContact O-N 3.48Å; A18-E21 PolarHBondContact O-N 3.42Å; W19-E21 VanDerWaalsContact C-N 3.29Å; W19-E21 PolarHBondContact O-N 3.26Å
22	D	97.5	Very high	96.4	Very high	111 Å²	111	127.2 Å²	127.2	59%	0.594	66%	0.655	S	S	*	*			trans	-64.1	140	-179.1	-171.8	48.9	0	0	0	111.9	A18 W19	A18-D22 PolarHBondContact O-N 3.03Å; A18-D22 VanDerWaalsContact O-N 3.11Å; W19-D22 WeakPolarHBondContact O-CB 3.38Å; W19-D22 PolarHBondContact O-N 3.37Å
23	K	97.6	Very high	96.2	Very high	174 Å²	174	128.1 Å²	128.1	76%	0.757	66%	0.659	S	S	*	*			trans	-135	130.4	179.6	-65.5	-178.5	-174.3	179.1	0	109.1
24	L	96.8	Very high	96.1	Very high	155 Å²	155	125.8 Å²	125.8	81%	0.812	65%	0.647	S	S	*	*	P	Polyproline II helix	trans	-61.3	143.5	172.5	-65.5	176.5	0	0	0	110.4
25	P	97.1	Very high	95.8	Very high	93 Å²	93	124.9 Å²	124.9	60%	0.604	64%	0.639	S	S	*	*	P	Polyproline II helix	trans	-66	161.1	174.1	29.5	-35	0	0	0	111.2
26	Y	96.5	Very high	95.6	Very high	234 Å²	234	125.9 Å²	125.9	92%	0.918	65%	0.645	S	S	*	*	P	Polyproline II helix	trans	-77.6	121.2	166.8	-67.3	-78.3	0	0	0	108.7
27	E	96.6	Very high	95.3	Very high	162 Å²	162	124.6 Å²	124.6	76%	0.757	64%	0.642	S	S	*	*	P	Polyproline II helix	trans	-91.8	144.3	173.5	-70.2	-66.4	159.7	0	0	110.2
28	D	96.4	Very high	94.8	Very high	160 Å²	160	122.9 Å²	122.9	86%	0.856	63%	0.63	S	S	*	*	P	Polyproline II helix	trans	-79.1	149.3	177.3	-69.9	-36.1	0	0	0	111.5
29	V	94.6	Very high	93.9	Very high	116 Å²	116	125.1 Å²	125.1	70%	0.703	64%	0.638	S	S	*	*	P	Polyproline II helix	trans	-84.4	134.6	174.1	-177.3	0	0	0	0	109.3	I31	V29-I31 HydrophobicContact CB-CD1 4.01Å; V29-I31 HydrophobicContact CG1-CD1 3.89Å; V29-I31 WeakPolarHBondContact O-CG1 2.93Å; V29-I31 PolarHBondContact O-N 3.11Å; V29-I31 VanDerWaalsContact O-N 3.11Å
30	A	96.1	Very high	92.6	Very high	98 Å²	98	125 Å²	125	81%	0.81	65%	0.645	S	S	*	*			trans	-68.2	108.2	171.7	0	0	0	0	0	110.3
31	I	94.4	Very high	91.2	Very high	90 Å²	90	120 Å²	120	46%	0.462	63%	0.629	S	S	.	*			trans	-97.5	131.5	-178.5	-52.5	-56.7	0	0	0	110.5	V29 L33 L36	V29-I31 HydrophobicContact CB-CD1 4.01Å; V29-I31 HydrophobicContact CG1-CD1 3.89Å; V29-I31 WeakPolarHBondContact O-CG1 2.93Å; V29-I31 PolarHBondContact O-N 3.11Å; V29-I31 VanDerWaalsContact O-N 3.11Å; I31-L33 VanDerWaalsContact C-N 3.35Å; I31-L33 PolarHBondContact O-N 3.06Å; I31-L36 HydrophobicContact CG2-CD1 3.68Å; I31-L36 HydrophobicContact CG2-CD2 4.39Å; I31-L36 HydrophobicContact CG2-CG 4.12Å
32	P	94.9	Very high	89.3	Confident	84 Å²	84	121.6 Å²	121.6	55%	0.545	64%	0.642	S	S	.	*			trans	-73.8	88.5	172.1	31.2	-34.3	0	0	0	109.9	N34 E35	P32-N34 PolarHBondContact O-N 2.8Å; P32-N34 VanDerWaalsContact O-N 3.08Å; P32-E35 HydrophobicContact CB-CB 4.43Å; P32-E35 HydrophobicContact CB-CG 4Å; P32-E35 HydrophobicContact CG-CB 4.26Å; P32-E35 HydrophobicContact CG-CG 4.13Å; P32-E35 WeakPolarHBondContact O-CB 3.38Å; P32-E35 PolarHBondContact O-N 2.95Å
33	L	91.4	Very high	87.3	Confident	121 Å²	121	124.1 Å²	124.1	63%	0.634	66%	0.655	S	S	*	*	G	3₁₀ helix	trans	-54.5	-32	-174.7	-63.8	177.7	0	0	0	113.5	I31 E35 L36	I31-L33 VanDerWaalsContact C-N 3.35Å; I31-L33 PolarHBondContact O-N 3.06Å; L33-E35 PolarHBondContact O-N 3.24Å; L33-L36 HydrophobicContact CD2-CD1 4.19Å; L33-L36 WeakPolarHBondContact O-CB 3.39Å; L33-L36 PolarHBondContact O-N 2.57Å
34	N	92.2	Very high	85.3	Confident	100 Å²	100	119.5 Å²	119.5	54%	0.535	66%	0.657	S	S	.	*	G	3₁₀ helix	trans	-66.5	-20.6	179.1	-60.8	13.2	0	0	0	113.5	P32 L36 S49 V50 K51	P32-N34 PolarHBondContact O-N 2.8Å; P32-N34 VanDerWaalsContact O-N 3.08Å; N34-L36 VanDerWaalsContact C-N 3.34Å; N34-S49 WeakPolarHBondContact O-CB 3.43Å; N34-V50 PolarHBondContact O-N 2.85Å; N34-K51 HydrophobicContact CB-CB 4.25Å; N34-K51 WeakPolarHBondContact O-CB 3.36Å; N34-K51 PolarHBondContact O-N 3.11Å
35	E	92.6	Very high	83.4	Confident	96 Å²	96	113.8 Å²	113.8	45%	0.449	64%	0.635	S	S	.	*	G	3₁₀ helix	trans	-89.8	-3.2	176	-56.7	-70.2	165.7	0	0	111.4	P32 L33 S49 K51	P32-E35 HydrophobicContact CB-CB 4.43Å; P32-E35 HydrophobicContact CB-CG 4Å; P32-E35 HydrophobicContact CG-CB 4.26Å; P32-E35 HydrophobicContact CG-CG 4.13Å; P32-E35 WeakPolarHBondContact O-CB 3.38Å; P32-E35 PolarHBondContact O-N 2.95Å; L33-E35 PolarHBondContact O-N 3.24Å; E35-S49 VanDerWaalsContact C-CB 3.42Å; E35-S49 WeakPolarHBondContact O-CB 3.45Å; E35-K51 WeakPolarHBondContact OE1-CD 3.45Å; E35-K51 IonicContact OE1-NZ 2.8Å; E35-K51 PolarHBondContact OE1-NZ 2.82Å
36	L	91.1	Very high	81.8	Confident	79 Å²	79	113 Å²	113	41%	0.414	63%	0.629	S	S	.	*	S	Bend	trans	-95.3	153	174.8	-60.1	-173.9	0	0	0	111.2	I31 L33 N34 S49 V50	I31-L36 HydrophobicContact CG2-CD1 3.68Å; I31-L36 HydrophobicContact CG2-CD2 4.39Å; I31-L36 HydrophobicContact CG2-CG 4.12Å; L33-L36 HydrophobicContact CD2-CD1 4.19Å; L33-L36 WeakPolarHBondContact O-CB 3.39Å; L33-L36 PolarHBondContact O-N 2.57Å; N34-L36 VanDerWaalsContact C-N 3.34Å; L36-S49 WeakPolarHBondContact O-CA 3.2Å; L36-V50 PolarHBondContact O-N 2.94Å; L36-V50 VanDerWaalsContact O-N 3.1Å
37	P	89.9	Confident	80.9	Confident	69 Å²	69	108.6 Å²	108.6	45%	0.448	63%	0.627	S	S	.	*	P	Polyproline II helix	trans	-66.8	155.1	167.8	-17.8	31.3	0	0	0	112.5	E48	P37-E48 WeakPolarHBondContact CA-O 3.4Å
38	E	87.4	Confident	80.4	Confident	90 Å²	90	102.7 Å²	102.7	42%	0.421	60%	0.599	S	S	.	*	P	Polyproline II helix	trans	-59.6	131.1	171.3	-75.1	-84.9	152.4	0	0	111.3	E40 Q41 V50	E38-E40 PolarHBondContact O-N 3.08Å; E38-Q41 HydrophobicContact CB-CG 3.84Å; E38-V50 HydrophobicContact CG-CG2 3.97Å
39	P	78.3	Confident	80.2	Confident	118 Å²	118	95.3 Å²	95.3	77%	0.766	56%	0.56	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72	-27	-177.5	26.2	-32.4	0	0	0	114	Q41	P39-Q41 PolarHBondContact O-N 2.99Å
40	E	70.5	Confident	80	Confident	168 Å²	168	91.1 Å²	91.1	79%	0.785	53%	0.534	S	S	*	.	T	Hydrogen-bonded Turn	trans	-95.7	24.2	-170.2	-63.3	-64.4	148.2	0	0	114	E38 D42	E38-E40 PolarHBondContact O-N 3.08Å; E40-D42 VanDerWaalsContact C-N 3.3Å; E40-D42 PolarHBondContact O-N 3Å
41	Q	65.6	Low	79.9	Confident	72 Å²	72	90.2 Å²	90.2	34%	0.336	51%	0.512	S	S	.	.			trans	-78.4	80.6	177.5	-58.3	-140.3	-21.1	0	0	111.3	E38 P39 N43 T46	E38-Q41 HydrophobicContact CB-CG 3.84Å; P39-Q41 PolarHBondContact O-N 2.99Å; Q41-N43 PolarHBondContact O-N 3.25Å; Q41-T46 VanDerWaalsContact OE1-N 3.08Å
42	D	57.5	Low	79.9	Confident	163 Å²	163	90.4 Å²	90.4	87%	0.872	51%	0.511	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.4	-11	177.1	-168.8	28.4	0	0	0	113.8	E40	E40-D42 VanDerWaalsContact C-N 3.3Å; E40-D42 PolarHBondContact O-N 3Å
43	N	55.4	Low	79.6	Confident	165 Å²	165	90.6 Å²	90.6	88%	0.882	51%	0.505	S	S	*	.	T	Hydrogen-bonded Turn	trans	-124.2	50.1	-172.3	-134.9	19.9	0	0	0	114	Q41	Q41-N43 PolarHBondContact O-N 3.25Å
44	G	55.5	Low	79.6	Confident	77 Å²	77	91.9 Å²	91.9	79%	0.794	51%	0.508	S	S	*	.	T	Hydrogen-bonded Turn	trans	69.1	55.6	171.8	0	0	0	0	0	112.7
45	G	57.7	Low	79.8	Confident	34 Å²	34	93.9 Å²	93.9	35%	0.351	52%	0.516	S	S	.	.			trans	-52.5	147.5	-165.2	0	0	0	0	0	116.6	T47	G45-T47 PolarHBondContact O-N 3.24Å
46	T	62.5	Low	79.8	Confident	76 Å²	76	94.4 Å²	94.4	47%	0.466	52%	0.516	S	S	.	.			trans	-57.8	133.4	176.3	-39.1	0	0	0	0	108.6	Q41 E48	Q41-T46 VanDerWaalsContact OE1-N 3.08Å; T46-E48 HydrophobicContact CG2-CB 3.63Å; T46-E48 PolarHBondContact O-N 3.46Å
47	T	78.1	Confident	80	Confident	143 Å²	143	101.4 Å²	101.4	88%	0.877	54%	0.537	S	S	*	.	S	Bend	trans	-70.8	22.9	176.3	59.3	0	0	0	0	113.2	G45	G45-T47 PolarHBondContact O-N 3.24Å
48	E	87	Confident	80.1	Confident	38 Å²	38	103.9 Å²	103.9	18%	0.178	55%	0.552	C	S	.	*	S	Bend	trans	-108.6	144.7	-167.9	-177.6	175.8	-135.4	0	0	109.6	P37 T46 E52 K56	P37-E48 WeakPolarHBondContact CA-O 3.4Å; T46-E48 HydrophobicContact CG2-CB 3.63Å; T46-E48 PolarHBondContact O-N 3.46Å; E48-E52 HydrophobicContact CG-CB 3.31Å; E48-E52 HydrophobicContact CG-CG 4.26Å; E48-E52 WeakPolarHBondContact CG-OE2 3.41Å; E48-E52 WeakPolarHBondContact OE1-CB 3.47Å; E48-K56 WeakPolarHBondContact OE1-CE 3.37Å; E48-K56 IonicContact OE1-NZ 2.57Å; E48-K56 PolarHBondContact OE1-NZ 3.27Å; E48-K56 WeakPolarHBondContact OE2-CE 3.16Å; E48-K56 IonicContact OE2-NZ 2.72Å; E48-K56 PolarHBondContact OE2-NZ 3.13Å
49	S	91.6	Very high	80.4	Confident	5 Å²	5	104.2 Å²	104.2	4%	0.035	56%	0.556	C	S	.	*			trans	-71	155.6	178	65	0	0	0	0	112.3	N34 E35 L36 K51 E52 Q53	N34-S49 WeakPolarHBondContact O-CB 3.43Å; E35-S49 VanDerWaalsContact C-CB 3.42Å; E35-S49 WeakPolarHBondContact O-CB 3.45Å; L36-S49 WeakPolarHBondContact O-CA 3.2Å; S49-K51 PolarHBondContact O-N 3.01Å; S49-E52 WeakPolarHBondContact CB-OE2 3.42Å; S49-E52 PolarHBondContact N-OE2 3.1Å; S49-E52 PolarHBondContact O-N 3.36Å; S49-E52 VanDerWaalsContact O-N 3.13Å; S49-E52 WeakPolarHBondContact OG-CB 3.33Å; S49-E52 WeakPolarHBondContact OG-CG 3.47Å; S49-E52 PolarHBondContact OG-N 3.11Å; S49-E52 PolarHBondContact OG-OE2 2.76Å; S49-Q53 PolarHBondContact O-N 3.47Å
50	V	90.8	Very high	81	Confident	27 Å²	27	104.9 Å²	104.9	16%	0.164	55%	0.552	C	S	.	*	H	α-helix	trans	-51.1	-45.2	173.4	174.3	0	0	0	0	110.9	N34 L36 E38 E52 Q53 E54	N34-V50 PolarHBondContact O-N 2.85Å; L36-V50 PolarHBondContact O-N 2.94Å; L36-V50 VanDerWaalsContact O-N 3.1Å; E38-V50 HydrophobicContact CG-CG2 3.97Å; V50-E52 PolarHBondContact O-N 2.87Å; V50-Q53 WeakPolarHBondContact O-CB 3.48Å; V50-Q53 PolarHBondContact O-N 3.45Å; V50-E54 WeakPolarHBondContact O-CG 3.21Å; V50-E54 PolarHBondContact O-N 2.72Å
51	K	93.9	Very high	81.9	Confident	79 Å²	79	98.8 Å²	98.8	34%	0.343	53%	0.531	S	S	.	.	H	α-helix	trans	-59.9	-43.8	179.9	177.5	178.7	167	-171.4	0	113	N34 E35 S49 Q53 E54 M55	N34-K51 HydrophobicContact CB-CB 4.25Å; N34-K51 WeakPolarHBondContact O-CB 3.36Å; N34-K51 PolarHBondContact O-N 3.11Å; E35-K51 WeakPolarHBondContact OE1-CD 3.45Å; E35-K51 IonicContact OE1-NZ 2.8Å; E35-K51 PolarHBondContact OE1-NZ 2.82Å; S49-K51 PolarHBondContact O-N 3.01Å; K51-Q53 VanDerWaalsContact C-N 3.34Å; K51-E54 PolarHBondContact O-N 3.27Å; K51-M55 HydrophobicContact CG-CE 3.88Å; K51-M55 WeakPolarHBondContact O-CG 3.37Å; K51-M55 PolarHBondContact O-N 3.39Å
52	E	93.3	Very high	83	Confident	94 Å²	94	100.4 Å²	100.4	44%	0.439	54%	0.541	S	S	.	.	H	α-helix	trans	-67.5	-37.3	178.6	-73.6	164.6	143.3	0	0	111.2	E48 S49 V50 M55	E48-E52 HydrophobicContact CG-CB 3.31Å; E48-E52 HydrophobicContact CG-CG 4.26Å; E48-E52 WeakPolarHBondContact CG-OE2 3.41Å; E48-E52 WeakPolarHBondContact OE1-CB 3.47Å; S49-E52 WeakPolarHBondContact CB-OE2 3.42Å; S49-E52 PolarHBondContact N-OE2 3.1Å; S49-E52 PolarHBondContact O-N 3.36Å; S49-E52 VanDerWaalsContact O-N 3.13Å; S49-E52 WeakPolarHBondContact OG-CB 3.33Å; S49-E52 WeakPolarHBondContact OG-CG 3.47Å; S49-E52 PolarHBondContact OG-N 3.11Å; S49-E52 PolarHBondContact OG-OE2 2.76Å; V50-E52 PolarHBondContact O-N 2.87Å; E52-M55 PolarHBondContact O-N 3.17Å
53	Q	90.1	Very high	84.4	Confident	89 Å²	89	98.8 Å²	98.8	42%	0.416	53%	0.529	S	S	.	.	H	α-helix	trans	-62.6	-43.4	175.7	-171.5	176.9	20.2	0	0	112.2	S49 V50 K51 M55 K56	S49-Q53 PolarHBondContact O-N 3.47Å; V50-Q53 WeakPolarHBondContact O-CB 3.48Å; V50-Q53 PolarHBondContact O-N 3.45Å; K51-Q53 VanDerWaalsContact C-N 3.34Å; Q53-M55 PolarHBondContact O-N 3.23Å; Q53-K56 WeakPolarHBondContact O-CB 3.49Å; Q53-K56 PolarHBondContact O-N 3.46Å; Q53-K56 VanDerWaalsContact O-N 3.11Å
54	E	91.4	Very high	85.9	Confident	148 Å²	148	97.7 Å²	97.7	69%	0.692	51%	0.513	S	S	*	.	H	α-helix	trans	-63.5	-26.4	177.7	-71.5	178.2	166.7	0	0	113.3	V50 K51 K56	V50-E54 WeakPolarHBondContact O-CG 3.21Å; V50-E54 PolarHBondContact O-N 2.72Å; K51-E54 PolarHBondContact O-N 3.27Å; E54-K56 VanDerWaalsContact C-N 3.27Å; E54-K56 PolarHBondContact O-N 3.31Å
55	M	94.9	Very high	87.2	Confident	142 Å²	142	99.9 Å²	99.9	70%	0.7	51%	0.506	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.2	-8.5	177.2	-68.3	-177.7	-176	0	0	113.3	K51 E52 Q53	K51-M55 HydrophobicContact CG-CE 3.88Å; K51-M55 WeakPolarHBondContact O-CG 3.37Å; K51-M55 PolarHBondContact O-N 3.39Å; E52-M55 PolarHBondContact O-N 3.17Å; Q53-M55 PolarHBondContact O-N 3.23Å
56	K	93.1	Very high	87.7	Confident	107 Å²	107	106 Å²	106	47%	0.465	53%	0.525	S	S	.	.			trans	-82.3	132.7	177.7	-70.7	178.7	172.8	171.4	0	111.2	E48 Q53 E54 T58	E48-K56 WeakPolarHBondContact OE1-CE 3.37Å; E48-K56 IonicContact OE1-NZ 2.57Å; E48-K56 PolarHBondContact OE1-NZ 3.27Å; E48-K56 WeakPolarHBondContact OE2-CE 3.16Å; E48-K56 IonicContact OE2-NZ 2.72Å; E48-K56 PolarHBondContact OE2-NZ 3.13Å; Q53-K56 WeakPolarHBondContact O-CB 3.49Å; Q53-K56 PolarHBondContact O-N 3.46Å; Q53-K56 VanDerWaalsContact O-N 3.11Å; E54-K56 VanDerWaalsContact C-N 3.27Å; E54-K56 PolarHBondContact O-N 3.31Å; K56-T58 HydrophobicContact CB-CG2 4.25Å; K56-T58 PolarHBondContact O-N 3.28Å
57	W	95.2	Very high	87.7	Confident	225 Å²	225	110.2 Å²	110.2	85%	0.852	54%	0.539	S	S	*	.			trans	-88.8	106.3	166.7	-170.1	18.2	0	0	0	109.5
58	T	91.3	Very high	86.8	Confident	122 Å²	122	109.8 Å²	109.8	75%	0.748	53%	0.532	S	S	*	.			trans	-99.5	-6.2	-176.5	54.9	0	0	0	0	113.7	K56 L60	K56-T58 HydrophobicContact CB-CG2 4.25Å; K56-T58 PolarHBondContact O-N 3.28Å; T58-L60 PolarHBondContact O-N 3.12Å
59	D	93.9	Very high	85.6	Confident	96 Å²	96	112.7 Å²	112.7	51%	0.513	55%	0.552	S	S	.	*			trans	-80	118.1	179.2	176.9	38.5	0	0	0	111.2	A61	D59-A61 PolarHBondContact OD1-N 3.4Å
60	L	92.3	Very high	84.3	Confident	132 Å²	132	117.1 Å²	117.1	69%	0.691	58%	0.58	S	S	*	*			trans	-103.9	1.2	179.4	-64.4	175.1	0	0	0	112.6	T58 L62	T58-L60 PolarHBondContact O-N 3.12Å; L60-L62 HydrophobicContact CB-CD1 3.99Å; L60-L62 HydrophobicContact CB-CD2 4.36Å; L60-L62 HydrophobicContact CB-CG 3.7Å; L60-L62 HydrophobicContact CD1-CD1 3.99Å; L60-L62 PolarHBondContact O-N 3.45Å
61	A	89.8	Confident	83.1	Confident	41 Å²	41	121.9 Å²	121.9	34%	0.339	61%	0.612	S	S	.	*			trans	53.6	23.8	-177.4	0	0	0	0	0	115	D59 Q63 Y64	D59-A61 PolarHBondContact OD1-N 3.4Å; A61-Q63 PolarHBondContact O-N 3.39Å; A61-Q63 VanDerWaalsContact O-N 3.09Å; A61-Y64 HydrophobicContact CB-CD2 4Å; A61-Y64 HydrophobicContact CB-CE2 4.02Å; A61-Y64 VanDerWaalsContact O-CD2 3.23Å; A61-Y64 WeakPolarHBondContact O-CD2 3.32Å; A61-Y64 PolarHBondContact O-N 3.3Å
62	L	87.8	Confident	81.6	Confident	105 Å²	105	124.7 Å²	124.7	55%	0.55	64%	0.636	S	S	.	*	T	Hydrogen-bonded Turn	trans	-66.3	-14.6	-175.8	-62.6	174.5	0	0	0	113.6	L60 Y64 L65	L60-L62 HydrophobicContact CB-CD1 3.99Å; L60-L62 HydrophobicContact CB-CD2 4.36Å; L60-L62 HydrophobicContact CB-CG 3.7Å; L60-L62 HydrophobicContact CD1-CD1 3.99Å; L60-L62 PolarHBondContact O-N 3.45Å; L62-Y64 PolarHBondContact O-N 3.27Å; L62-Y64 VanDerWaalsContact O-N 3.15Å; L62-L65 HydrophobicContact CD2-CD1 3.66Å; L62-L65 WeakPolarHBondContact O-CB 3.33Å; L62-L65 PolarHBondContact O-N 3.16Å
63	Q	87.4	Confident	80.1	Confident	130 Å²	130	123.6 Å²	123.6	61%	0.607	65%	0.65	S	S	*	*	H	α-helix	trans	-52.1	-34	174.4	62.1	-176.9	52.5	0	0	113.1	A61 L65 H66	A61-Q63 PolarHBondContact O-N 3.39Å; A61-Q63 VanDerWaalsContact O-N 3.09Å; Q63-L65 PolarHBondContact O-N 3.12Å; Q63-H66 PolarHBondContact O-N 2.93Å
64	Y	85.9	Confident	77.8	Confident	142 Å²	142	131.1 Å²	131.1	56%	0.557	69%	0.693	S	S	*	*	H	α-helix	trans	-72.4	-14.3	-178.8	-60	-64.8	0	0	0	114.1	A61 L62 N68	A61-Y64 HydrophobicContact CB-CD2 4Å; A61-Y64 HydrophobicContact CB-CE2 4.02Å; A61-Y64 VanDerWaalsContact O-CD2 3.23Å; A61-Y64 WeakPolarHBondContact O-CD2 3.32Å; A61-Y64 PolarHBondContact O-N 3.3Å; L62-Y64 PolarHBondContact O-N 3.27Å; L62-Y64 VanDerWaalsContact O-N 3.15Å; Y64-N68 PolarHBondContact O-ND2 3.47Å; Y64-N68 VanDerWaalsContact O-ND2 3.09Å
65	L	83.7	Confident	77.1	Confident	123 Å²	123	130.3 Å²	130.3	64%	0.644	69%	0.693	S	S	*	*	H	α-helix	trans	-77.7	-29.5	177.6	-66	171.8	0	0	0	112.2	L62 Q63	L62-L65 HydrophobicContact CD2-CD1 3.66Å; L62-L65 WeakPolarHBondContact O-CB 3.33Å; L62-L65 PolarHBondContact O-N 3.16Å; Q63-L65 PolarHBondContact O-N 3.12Å
66	H	68.1	Low	76.2	Confident	162 Å²	162	129.7 Å²	129.7	75%	0.75	69%	0.693	S	S	*	*	H	α-helix	trans	-77.4	-32	-176.1	-171.8	-114	0	0	0	112.7	Q63 N68	Q63-H66 PolarHBondContact O-N 2.93Å; H66-N68 VanDerWaalsContact C-N 3.32Å; H66-N68 PolarHBondContact O-N 3.39Å
67	E	61.8	Low	75.2	Confident	164 Å²	164	130.9 Å²	130.9	77%	0.766	71%	0.706	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.4	-15.2	-179.6	-66	-175.4	162.4	0	0	113.9
68	N	59.1	Low	74	Confident	135 Å²	135	125.4 Å²	125.4	72%	0.722	70%	0.697	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.3	8.5	179.8	-82.5	-60.5	0	0	0	114.2	Y64 H66 P70	Y64-N68 PolarHBondContact O-ND2 3.47Å; Y64-N68 VanDerWaalsContact O-ND2 3.09Å; H66-N68 VanDerWaalsContact C-N 3.32Å; H66-N68 PolarHBondContact O-N 3.39Å; N68-P70 WeakPolarHBondContact O-CD 3.42Å
69	V	63.2	Low	73	Confident	99 Å²	99	125.6 Å²	125.6	60%	0.6	69%	0.694	S	S	*	*			trans	-82.8	106.1	172.2	-177.1	0	0	0	0	107.9
70	P	64.1	Low	71.6	Confident	97 Å²	97	127.6 Å²	127.6	63%	0.63	71%	0.706	S	S	*	*			trans	-59	139.7	174.4	24.4	-32.2	0	0	0	108.8	N68 T72	N68-P70 WeakPolarHBondContact O-CD 3.42Å; P70-T72 PolarHBondContact O-N 3.33Å
71	P	65.1	Low	70.1	Confident	128 Å²	128	127.3 Å²	127.3	83%	0.831	71%	0.707	S	S	*	*			trans	-58	111.2	173.8	23.2	-30.7	0	0	0	107.8	G73	P71-G73 PolarHBondContact O-N 3.14Å; P71-G73 VanDerWaalsContact O-N 3.09Å
72	T	63.2	Low	68.6	Low	137 Å²	137	133.9 Å²	133.9	84%	0.84	74%	0.735	S	S	*	*			trans	-60.3	115.3	169	46.5	0	0	0	0	106.8	P70	P70-T72 PolarHBondContact O-N 3.33Å
73	G	60.9	Low	67	Low	72 Å²	72	136.3 Å²	136.3	74%	0.742	75%	0.751	S	S	*	*			trans	-63.8	167.1	-160.9	0	0	0	0	0	116.7	P71	P71-G73 PolarHBondContact O-N 3.14Å; P71-G73 VanDerWaalsContact O-N 3.09Å
74	N	41.2	Very low	65.1	Low	247 Å²	247	136.9 Å²	136.9	100%	1.321	76%	0.764	S	S	*	*			trans	-127.5	0	158.5	-110.9	6.4	0	0	0	107.9

Retrieved 74 of 74 residues in 70.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).