A0A093H4X7_STRCA Loading...

Cytochrome b-c1 complex subunit 10

AlphaFold DB , UniProt , Accession A0A093H4X7, Species STRCA (Struthio camelus australis), Gene n/a, Length 56 aa.

						>A0A093H4X7_STRCA|A0A093H4X7
MLSRLVGPRYVQLLQNWTPTLVTWGGVAGTGVIWFTDWKLVLQYVPYIGGKYKKED
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	77.8	Confident	85.4	Confident	205 Å²	205	125 Å²	125	100%	1.01	64%	0.636	S	S	*	*				0	-50.3	0	-73.1	-178.6	170.9	0	0	112	S3 R4	M1-S3 VanDerWaalsContact C-N 3.26Å; M1-S3 PolarHBondContact O-N 2.62Å; M1-R4 PolarHBondContact O-N 3.1Å
2	L	81.4	Confident	86.2	Confident	142 Å²	142	124.3 Å²	124.3	74%	0.743	63%	0.629	S	S	*	*	G	3₁₀ helix	trans	-58.8	-28.7	176	-82.5	145.9	0	0	0	115.2	R4 L5	L2-R4 PolarHBondContact O-N 3.11Å; L2-L5 HydrophobicContact CD2-CD1 4.41Å; L2-L5 WeakPolarHBondContact O-CB 3.44Å; L2-L5 PolarHBondContact O-N 2.89Å
3	S	79.7	Confident	87	Confident	93 Å²	93	121 Å²	121	65%	0.65	61%	0.613	S	S	*	*	G	3₁₀ helix	trans	-57.5	-22	176	51.5	0	0	0	0	114	M1 L5 V6	M1-S3 VanDerWaalsContact C-N 3.26Å; M1-S3 PolarHBondContact O-N 2.62Å; S3-L5 PolarHBondContact O-N 3.46Å; S3-V6 PolarHBondContact O-N 2.92Å
4	R	78.8	Confident	87.6	Confident	202 Å²	202	120.3 Å²	120.3	76%	0.762	61%	0.611	S	S	*	*	G	3₁₀ helix	trans	-70.8	-17.8	175.1	-64.7	-175.1	178.4	178.4	-0.7	113.5	M1 L2 Y10	M1-R4 PolarHBondContact O-N 3.1Å; L2-R4 PolarHBondContact O-N 3.11Å; R4-Y10 WeakPolarHBondContact O-CE2 3.45Å
5	L	80.5	Confident	88.1	Confident	111 Å²	111	120.4 Å²	120.4	58%	0.581	61%	0.608	S	S	*	*	G	3₁₀ helix	trans	-92.4	-3.3	177.8	-60.1	174.8	0	0	0	112.4	L2 S3 Y10	L2-L5 HydrophobicContact CD2-CD1 4.41Å; L2-L5 WeakPolarHBondContact O-CB 3.44Å; L2-L5 PolarHBondContact O-N 2.89Å; S3-L5 PolarHBondContact O-N 3.46Å; L5-Y10 WeakPolarHBondContact O-CB 3.27Å
6	V	82.9	Confident	88.7	Confident	123 Å²	123	120.5 Å²	120.5	75%	0.745	61%	0.611	S	S	*	*			trans	-103.5	100.4	-179.1	-174.9	0	0	0	0	107.9	S3	S3-V6 PolarHBondContact O-N 2.92Å
7	G	90.3	Very high	89.2	Confident	21 Å²	21	121.7 Å²	121.7	22%	0.216	61%	0.606	C	S	.	*	S	Bend	trans	-173.1	158.9	176.4	0	0	0	0	0	112.8	R9 Y10 V11	G7-R9 PolarHBondContact O-N 3.39Å; G7-R9 VanDerWaalsContact O-N 3.14Å; G7-Y10 PolarHBondContact O-N 3.34Å; G7-V11 PolarHBondContact O-N 3.04Å; G7-V11 VanDerWaalsContact O-N 3.15Å
8	P	91.6	Very high	89.7	Confident	107 Å²	107	118.8 Å²	118.8	70%	0.695	60%	0.596	S	S	*	*	H	α-helix	trans	-54.4	-37.8	-173.6	-27.8	34.8	0	0	0	114	Y10 V11 Q12	P8-Y10 PolarHBondContact O-N 3.01Å; P8-V11 PolarHBondContact O-N 3.3Å; P8-Q12 WeakPolarHBondContact O-CG 3.48Å; P8-Q12 PolarHBondContact O-N 3.44Å
9	R	93	Very high	90.1	Very high	193 Å²	193	116.7 Å²	116.7	73%	0.728	59%	0.592	S	S	*	*	H	α-helix	trans	-62.4	-41.3	176.2	179.5	-179.5	174.5	177.7	-0.2	113	G7 Q12 L13	G7-R9 PolarHBondContact O-N 3.39Å; G7-R9 VanDerWaalsContact O-N 3.14Å; R9-Q12 PolarHBondContact O-N 3.22Å; R9-L13 WeakPolarHBondContact O-CB 3.49Å; R9-L13 PolarHBondContact O-N 2.88Å
10	Y	91.6	Very high	90.5	Very high	98 Å²	98	113.9 Å²	113.9	38%	0.384	58%	0.581	S	S	.	*	H	α-helix	trans	-73.9	-32.2	-179	-66.4	-74.7	0	0	0	111.5	R4 L5 G7 P8 L13 L14	R4-Y10 WeakPolarHBondContact O-CE2 3.45Å; L5-Y10 WeakPolarHBondContact O-CB 3.27Å; G7-Y10 PolarHBondContact O-N 3.34Å; P8-Y10 PolarHBondContact O-N 3.01Å; Y10-L13 PolarHBondContact O-N 3.49Å; Y10-L14 WeakPolarHBondContact O-CB 3.43Å; Y10-L14 WeakPolarHBondContact O-CG 3.41Å; Y10-L14 PolarHBondContact O-N 3.27Å
11	V	92.6	Very high	90.9	Very high	80 Å²	80	113.7 Å²	113.7	49%	0.485	58%	0.581	S	S	.	*	H	α-helix	trans	-63.4	-46.9	171.2	177.3	0	0	0	0	110.8	G7 P8 L13 L14 Q15	G7-V11 PolarHBondContact O-N 3.04Å; G7-V11 VanDerWaalsContact O-N 3.15Å; P8-V11 PolarHBondContact O-N 3.3Å; V11-L13 VanDerWaalsContact C-N 3.34Å; V11-L13 PolarHBondContact O-N 3.33Å; V11-L14 PolarHBondContact O-N 3.15Å; V11-Q15 WeakPolarHBondContact O-CG 3.48Å; V11-Q15 PolarHBondContact O-N 2.95Å
12	Q	94.7	Very high	91.9	Very high	116 Å²	116	108.7 Å²	108.7	54%	0.542	56%	0.561	S	S	.	*	H	α-helix	trans	-61.9	-41.4	175.7	-72.2	171.7	-5.5	0	0	112.1	P8 R9 Q15 N16	P8-Q12 WeakPolarHBondContact O-CG 3.48Å; P8-Q12 PolarHBondContact O-N 3.44Å; R9-Q12 PolarHBondContact O-N 3.22Å; Q12-Q15 PolarHBondContact O-N 3.2Å; Q12-N16 VanDerWaalsContact O-CG 3.25Å; Q12-N16 PolarHBondContact O-N 3.32Å; Q12-N16 PolarHBondContact O-ND2 3.28Å
13	L	96	Very high	92.7	Very high	82 Å²	82	106.1 Å²	106.1	43%	0.429	55%	0.552	S	S	.	*	H	α-helix	trans	-60.3	-49	175.3	-174.4	66.3	0	0	0	110.6	R9 Y10 V11 Q15 N16 W17	R9-L13 WeakPolarHBondContact O-CB 3.49Å; R9-L13 PolarHBondContact O-N 2.88Å; Y10-L13 PolarHBondContact O-N 3.49Å; V11-L13 VanDerWaalsContact C-N 3.34Å; V11-L13 PolarHBondContact O-N 3.33Å; L13-Q15 VanDerWaalsContact C-N 3.33Å; L13-Q15 PolarHBondContact O-N 2.94Å; L13-N16 PolarHBondContact O-N 2.87Å; L13-N16 VanDerWaalsContact O-N 3.16Å; L13-W17 PolarHBondContact O-N 3.35Å
14	L	95.5	Very high	93.6	Very high	111 Å²	111	110 Å²	110	58%	0.581	55%	0.552	S	S	*	*	H	α-helix	trans	-57.4	-47.1	177	-76.1	171.9	0	0	0	111.3	Y10 V11 N16 W17 T18	Y10-L14 WeakPolarHBondContact O-CB 3.43Å; Y10-L14 WeakPolarHBondContact O-CG 3.41Å; Y10-L14 PolarHBondContact O-N 3.27Å; V11-L14 PolarHBondContact O-N 3.15Å; L14-N16 VanDerWaalsContact C-N 3.28Å; L14-N16 PolarHBondContact O-N 3.42Å; L14-W17 CarbonylContact O-C 3.52Å; L14-W17 PolarHBondContact O-N 2.8Å; L14-T18 PolarHBondContact O-N 3.28Å; L14-T18 PolarHBondContact O-OG1 3.38Å
15	Q	95.5	Very high	94.5	Very high	122 Å²	122	102.5 Å²	102.5	57%	0.57	54%	0.538	S	S	*	.	H	α-helix	trans	-55.9	-41.8	176.9	-73.9	174.2	-23.4	0	0	112.7	V11 Q12 L13 W17 T18 P19	V11-Q15 WeakPolarHBondContact O-CG 3.48Å; V11-Q15 PolarHBondContact O-N 2.95Å; Q12-Q15 PolarHBondContact O-N 3.2Å; L13-Q15 VanDerWaalsContact C-N 3.33Å; L13-Q15 PolarHBondContact O-N 2.94Å; Q15-W17 VanDerWaalsContact C-N 3.34Å; Q15-W17 PolarHBondContact O-N 2.93Å; Q15-T18 PolarHBondContact O-N 3.14Å; Q15-P19 WeakPolarHBondContact O-CD 3.25Å
16	N	97.5	Very high	95.4	Very high	122 Å²	122	99 Å²	99	65%	0.652	53%	0.529	S	S	*	.	H	α-helix	trans	-67.9	-33.2	177.7	-67.6	-17	0	0	0	112.7	Q12 L13 L14 P19	Q12-N16 VanDerWaalsContact O-CG 3.25Å; Q12-N16 PolarHBondContact O-N 3.32Å; Q12-N16 PolarHBondContact O-ND2 3.28Å; L13-N16 PolarHBondContact O-N 2.87Å; L13-N16 VanDerWaalsContact O-N 3.16Å; L14-N16 VanDerWaalsContact C-N 3.28Å; L14-N16 PolarHBondContact O-N 3.42Å; N16-P19 WeakPolarHBondContact O-CD 3.41Å
17	W	97.4	Very high	96.1	Very high	141 Å²	141	97.1 Å²	97.1	53%	0.534	52%	0.517	S	S	.	.	H	α-helix	trans	-88.2	-14.9	178.8	-76.2	97	0	0	0	113.8	L13 L14 Q15 P19 T20 L21	L13-W17 PolarHBondContact O-N 3.35Å; L14-W17 CarbonylContact O-C 3.52Å; L14-W17 PolarHBondContact O-N 2.8Å; Q15-W17 VanDerWaalsContact C-N 3.34Å; Q15-W17 PolarHBondContact O-N 2.93Å; W17-P19 VanDerWaalsContact C-CD 3.5Å; W17-T20 HydrophobicContact CE3-CG2 4.21Å; W17-T20 HydrophobicContact CZ3-CG2 4.27Å; W17-T20 PolarHBondContact O-N 3.2Å; W17-T20 VanDerWaalsContact O-N 3.13Å; W17-L21 PolarHBondContact O-N 3.21Å
18	T	97.6	Very high	96.5	Very high	69 Å²	69	99 Å²	99	42%	0.423	53%	0.531	S	S	.	.	H	α-helix	trans	-51.6	-47.7	-179.9	-62.7	0	0	0	0	112.5	L14 Q15 T20 L21 V22	L14-T18 PolarHBondContact O-N 3.28Å; L14-T18 PolarHBondContact O-OG1 3.38Å; Q15-T18 PolarHBondContact O-N 3.14Å; T18-T20 VanDerWaalsContact C-N 3.35Å; T18-T20 PolarHBondContact O-N 2.89Å; T18-L21 PolarHBondContact O-N 3.46Å; T18-V22 HydrophobicContact CG2-CG2 4.11Å; T18-V22 WeakPolarHBondContact O-CB 3.48Å; T18-V22 VanDerWaalsContact O-CG2 3.27Å; T18-V22 WeakPolarHBondContact O-CG2 3.37Å; T18-V22 PolarHBondContact O-N 2.91Å
19	P	98.1	Very high	96.8	Very high	80 Å²	80	95.4 Å²	95.4	52%	0.519	51%	0.514	S	S	.	.	H	α-helix	trans	-58.7	-46.8	179.2	-22.9	34.2	0	0	0	112	Q15 N16 W17 L21 V22 T23	Q15-P19 WeakPolarHBondContact O-CD 3.25Å; N16-P19 WeakPolarHBondContact O-CD 3.41Å; W17-P19 VanDerWaalsContact C-CD 3.5Å; P19-L21 PolarHBondContact O-N 3.37Å; P19-V22 PolarHBondContact O-N 3Å; P19-T23 PolarHBondContact O-N 3.29Å; P19-T23 PolarHBondContact O-OG1 2.69Å
20	T	98.3	Very high	97.1	Very high	59 Å²	59	90.8 Å²	90.8	36%	0.362	51%	0.507	S	S	.	.	H	α-helix	trans	-60.7	-45.3	178.8	-54.1	0	0	0	0	111.8	W17 T18 T23 W24	W17-T20 HydrophobicContact CE3-CG2 4.21Å; W17-T20 HydrophobicContact CZ3-CG2 4.27Å; W17-T20 PolarHBondContact O-N 3.2Å; W17-T20 VanDerWaalsContact O-N 3.13Å; T18-T20 VanDerWaalsContact C-N 3.35Å; T18-T20 PolarHBondContact O-N 2.89Å; T20-T23 PolarHBondContact O-N 2.85Å; T20-W24 PolarHBondContact O-N 2.96Å
21	L	98.4	Very high	97.4	Very high	110 Å²	110	87.7 Å²	87.7	58%	0.576	51%	0.505	S	S	*	.	H	α-helix	trans	-64.5	-41.5	178.6	-70.8	175.3	0	0	0	112.1	W17 T18 P19 G25	W17-L21 PolarHBondContact O-N 3.21Å; T18-L21 PolarHBondContact O-N 3.46Å; P19-L21 PolarHBondContact O-N 3.37Å; L21-G25 PolarHBondContact O-N 3.29Å
22	V	98.4	Very high	97.7	Very high	100 Å²	100	87.6 Å²	87.6	61%	0.606	50%	0.504	S	S	*	.	H	α-helix	trans	-64.1	-43.9	176.4	171.3	0	0	0	0	110.5	T18 P19 G25 G26	T18-V22 HydrophobicContact CG2-CG2 4.11Å; T18-V22 WeakPolarHBondContact O-CB 3.48Å; T18-V22 VanDerWaalsContact O-CG2 3.27Å; T18-V22 WeakPolarHBondContact O-CG2 3.37Å; T18-V22 PolarHBondContact O-N 2.91Å; P19-V22 PolarHBondContact O-N 3Å; V22-G25 PolarHBondContact O-N 3.17Å; V22-G26 PolarHBondContact O-N 2.86Å
23	T	98.5	Very high	97.8	Very high	89 Å²	89	83.8 Å²	83.8	55%	0.546	49%	0.487	S	S	.	.	H	α-helix	trans	-61.2	-51.9	177.4	-59.3	0	0	0	0	111.6	P19 T20 G25 G26 V27	P19-T23 PolarHBondContact O-N 3.29Å; P19-T23 PolarHBondContact O-OG1 2.69Å; T20-T23 PolarHBondContact O-N 2.85Å; T23-G25 VanDerWaalsContact C-N 3.34Å; T23-G25 PolarHBondContact O-N 3.47Å; T23-G26 PolarHBondContact O-N 3.46Å; T23-V27 WeakPolarHBondContact O-CG2 3.44Å; T23-V27 PolarHBondContact O-N 3.08Å
24	W	98.4	Very high	97.8	Very high	174 Å²	174	88.8 Å²	88.8	66%	0.659	50%	0.5	S	S	*	.	H	α-helix	trans	-67.9	-34.1	-179.8	-77.1	109.5	0	0	0	112.8	T20 G26 V27 A28	T20-W24 PolarHBondContact O-N 2.96Å; W24-G26 VanDerWaalsContact C-N 3.33Å; W24-V27 HydrophobicContact CE3-CB 4.38Å; W24-V27 HydrophobicContact CE3-CG1 4.36Å; W24-V27 HydrophobicContact CZ3-CG1 4.42Å; W24-V27 PolarHBondContact O-N 2.91Å; W24-A28 WeakPolarHBondContact O-CB 3.43Å; W24-A28 PolarHBondContact O-N 2.94Å
25	G	98.4	Very high	97.9	Very high	45 Å²	45	91.3 Å²	91.3	46%	0.464	51%	0.507	S	S	.	.	H	α-helix	trans	-61.9	-41.5	170.7	0	0	0	0	0	112	L21 V22 T23 G29	L21-G25 PolarHBondContact O-N 3.29Å; V22-G25 PolarHBondContact O-N 3.17Å; T23-G25 VanDerWaalsContact C-N 3.34Å; T23-G25 PolarHBondContact O-N 3.47Å; G25-G29 PolarHBondContact O-N 3.17Å
26	G	98.4	Very high	98	Very high	38 Å²	38	89.2 Å²	89.2	39%	0.392	50%	0.503	S	S	.	.	H	α-helix	trans	-61.2	-49	172.3	0	0	0	0	0	112.3	V22 T23 W24 A28 G29 T30	V22-G26 PolarHBondContact O-N 2.86Å; T23-G26 PolarHBondContact O-N 3.46Å; W24-G26 VanDerWaalsContact C-N 3.33Å; G26-A28 PolarHBondContact O-N 3.37Å; G26-G29 PolarHBondContact O-N 3.14Å; G26-T30 WeakPolarHBondContact O-CB 3.29Å; G26-T30 PolarHBondContact O-N 2.97Å; G26-T30 PolarHBondContact O-OG1 3.39Å; G26-T30 VanDerWaalsContact O-OG1 3.08Å
27	V	98.7	Very high	97.8	Very high	82 Å²	82	87.6 Å²	87.6	50%	0.497	49%	0.494	S	S	.	.	H	α-helix	trans	-58	-49.8	177.4	171.5	0	0	0	0	111.2	T23 W24 T30 G31	T23-V27 WeakPolarHBondContact O-CG2 3.44Å; T23-V27 PolarHBondContact O-N 3.08Å; W24-V27 HydrophobicContact CE3-CB 4.38Å; W24-V27 HydrophobicContact CE3-CG1 4.36Å; W24-V27 HydrophobicContact CZ3-CG1 4.42Å; W24-V27 PolarHBondContact O-N 2.91Å; V27-T30 PolarHBondContact O-N 2.84Å; V27-G31 PolarHBondContact O-N 2.95Å
28	A	98.4	Very high	97.8	Very high	61 Å²	61	86.6 Å²	86.6	50%	0.504	49%	0.49	S	S	.	.	H	α-helix	trans	-63.2	-44.1	178.7	0	0	0	0	0	111.6	W24 G26 G31 V32	W24-A28 WeakPolarHBondContact O-CB 3.43Å; W24-A28 PolarHBondContact O-N 2.94Å; G26-A28 PolarHBondContact O-N 3.37Å; A28-G31 PolarHBondContact O-N 3.36Å; A28-V32 WeakPolarHBondContact O-CG2 3.33Å; A28-V32 PolarHBondContact O-N 3.3Å
29	G	98.3	Very high	97.6	Very high	32 Å²	32	87.5 Å²	87.5	33%	0.33	49%	0.488	S	S	.	.	H	α-helix	trans	-59.9	-48.4	177	0	0	0	0	0	112.5	G25 G26 G31 V32 I33	G25-G29 PolarHBondContact O-N 3.17Å; G26-G29 PolarHBondContact O-N 3.14Å; G29-G31 VanDerWaalsContact C-N 3.3Å; G29-G31 PolarHBondContact O-N 2.91Å; G29-V32 PolarHBondContact O-N 2.91Å; G29-I33 WeakPolarHBondContact O-CD1 3.2Å; G29-I33 VanDerWaalsContact O-CG1 3.3Å; G29-I33 WeakPolarHBondContact O-CG1 3.3Å; G29-I33 PolarHBondContact O-N 3.19Å
30	T	97.8	Very high	97.5	Very high	95 Å²	95	89.1 Å²	89.1	58%	0.583	49%	0.492	S	S	*	.	H	α-helix	trans	-61.3	-40	174.2	-59.1	0	0	0	0	111.5	G26 V27 V32 I33 W34	G26-T30 WeakPolarHBondContact O-CB 3.29Å; G26-T30 PolarHBondContact O-N 2.97Å; G26-T30 PolarHBondContact O-OG1 3.39Å; G26-T30 VanDerWaalsContact O-OG1 3.08Å; V27-T30 PolarHBondContact O-N 2.84Å; T30-V32 PolarHBondContact O-N 3.01Å; T30-I33 PolarHBondContact O-N 3.36Å; T30-W34 WeakPolarHBondContact O-CB 3.3Å; T30-W34 PolarHBondContact O-N 3.13Å
31	G	98.3	Very high	97.4	Very high	34 Å²	34	89.1 Å²	89.1	35%	0.351	49%	0.492	S	S	.	.	H	α-helix	trans	-59.4	-44.9	175.4	0	0	0	0	0	112.7	V27 A28 G29 W34 F35	V27-G31 PolarHBondContact O-N 2.95Å; A28-G31 PolarHBondContact O-N 3.36Å; G29-G31 VanDerWaalsContact C-N 3.3Å; G29-G31 PolarHBondContact O-N 2.91Å; G31-W34 PolarHBondContact O-N 3.46Å; G31-F35 VanDerWaalsContact O-CB 3.27Å; G31-F35 WeakPolarHBondContact O-CB 3.49Å; G31-F35 PolarHBondContact O-N 3.03Å
32	V	98.6	Very high	97.2	Very high	77 Å²	77	84.6 Å²	84.6	47%	0.467	47%	0.468	S	S	.	.	H	α-helix	trans	-63.6	-46.5	175.7	171.3	0	0	0	0	111.3	A28 G29 T30 W34 F35 T36 W38	A28-V32 WeakPolarHBondContact O-CG2 3.33Å; A28-V32 PolarHBondContact O-N 3.3Å; G29-V32 PolarHBondContact O-N 2.91Å; T30-V32 PolarHBondContact O-N 3.01Å; V32-W34 VanDerWaalsContact C-N 3.29Å; V32-W34 PolarHBondContact O-N 3.16Å; V32-F35 PolarHBondContact O-N 2.8Å; V32-T36 HydrophobicContact CG1-CG2 4.47Å; V32-T36 WeakPolarHBondContact O-CB 3.47Å; V32-T36 PolarHBondContact O-N 3.45Å; V32-T36 PolarHBondContact O-OG1 2.83Å; V32-W38 HydrophobicContact CG1-CE3 4.38Å; V32-W38 HydrophobicContact CG1-CZ3 4.32Å
33	I	97.7	Very high	97	Very high	36 Å²	36	83 Å²	83	19%	0.185	45%	0.454	C	S	.	.	H	α-helix	trans	-56.1	-46.1	177.8	-70.7	159.9	0	0	0	110.8	G29 T30 D37 W38 V41 L42	G29-I33 WeakPolarHBondContact O-CD1 3.2Å; G29-I33 VanDerWaalsContact O-CG1 3.3Å; G29-I33 WeakPolarHBondContact O-CG1 3.3Å; G29-I33 PolarHBondContact O-N 3.19Å; T30-I33 PolarHBondContact O-N 3.36Å; I33-D37 PolarHBondContact O-N 3.45Å; I33-W38 HydrophobicContact CG1-CE3 4.04Å; I33-W38 HydrophobicContact CG2-CB 4.29Å; I33-W38 PolarHBondContact O-N 3.29Å; I33-V41 HydrophobicContact CD1-CB 4.41Å; I33-V41 HydrophobicContact CD1-CG1 3.99Å; I33-V41 HydrophobicContact CD1-CG2 4.29Å; I33-V41 HydrophobicContact CG1-CB 4.45Å; I33-V41 HydrophobicContact CG1-CG2 4.32Å; I33-V41 HydrophobicContact CG2-CB 4.13Å; I33-V41 HydrophobicContact CG2-CG1 4.19Å; I33-L42 HydrophobicContact CG2-CD1 4.31Å; I33-L42 HydrophobicContact CG2-CD2 3.64Å; I33-L42 HydrophobicContact CG2-CG 3.68Å
34	W	95.3	Very high	96.8	Very high	187 Å²	187	87.4 Å²	87.4	71%	0.708	46%	0.462	S	S	*	.	H	α-helix	trans	-67.3	-49.4	178.5	175.4	78.6	0	0	0	112.2	T30 G31 V32 T36 D37	T30-W34 WeakPolarHBondContact O-CB 3.3Å; T30-W34 PolarHBondContact O-N 3.13Å; G31-W34 PolarHBondContact O-N 3.46Å; V32-W34 VanDerWaalsContact C-N 3.29Å; V32-W34 PolarHBondContact O-N 3.16Å; W34-T36 VanDerWaalsContact C-N 3.28Å; W34-T36 PolarHBondContact O-N 3.05Å; W34-D37 PolarHBondContact O-N 3.41Å; W34-D37 VanDerWaalsContact O-N 3.15Å
35	F	97.8	Very high	96.6	Very high	165 Å²	165	81.6 Å²	81.6	72%	0.724	45%	0.445	S	S	*	.	H	α-helix	trans	-63.5	-34.5	-175.1	-177.1	-100.7	0	0	0	113	G31 V32	G31-F35 VanDerWaalsContact O-CB 3.27Å; G31-F35 WeakPolarHBondContact O-CB 3.49Å; G31-F35 PolarHBondContact O-N 3.03Å; V32-F35 PolarHBondContact O-N 2.8Å
36	T	97.1	Very high	96.4	Very high	78 Å²	78	84.9 Å²	84.9	48%	0.479	46%	0.459	S	S	.	.	T	Hydrogen-bonded Turn	trans	-92.6	1.4	-179.2	57.8	0	0	0	0	113.3	V32 W34 W38	V32-T36 HydrophobicContact CG1-CG2 4.47Å; V32-T36 WeakPolarHBondContact O-CB 3.47Å; V32-T36 PolarHBondContact O-N 3.45Å; V32-T36 PolarHBondContact O-OG1 2.83Å; W34-T36 VanDerWaalsContact C-N 3.28Å; W34-T36 PolarHBondContact O-N 3.05Å; T36-W38 PolarHBondContact O-N 3.3Å
37	D	94.3	Very high	96	Very high	87 Å²	87	94.5 Å²	94.5	47%	0.465	49%	0.485	S	S	.	.	T	Hydrogen-bonded Turn	trans	47.1	47.7	-170.8	-94.6	-46.9	0	0	0	112.1	I33 W34 K39 K51 Y52	I33-D37 PolarHBondContact O-N 3.45Å; W34-D37 PolarHBondContact O-N 3.41Å; W34-D37 VanDerWaalsContact O-N 3.15Å; D37-K39 PolarHBondContact O-N 3.5Å; D37-K51 IonicContact OD1-NZ 2.62Å; D37-K51 PolarHBondContact OD1-NZ 3.07Å; D37-Y52 PolarHBondContact O-OH 2.86Å
38	W	96.8	Very high	95.7	Very high	120 Å²	120	94 Å²	94	46%	0.455	48%	0.479	S	S	.	.			trans	-65.9	95.5	-167	-161.8	-12.2	0	0	0	112.2	V32 I33 T36 L40 V41 L42	V32-W38 HydrophobicContact CG1-CE3 4.38Å; V32-W38 HydrophobicContact CG1-CZ3 4.32Å; I33-W38 HydrophobicContact CG1-CE3 4.04Å; I33-W38 HydrophobicContact CG2-CB 4.29Å; I33-W38 PolarHBondContact O-N 3.29Å; T36-W38 PolarHBondContact O-N 3.3Å; W38-L40 VanDerWaalsContact C-N 3.29Å; W38-L40 PolarHBondContact O-N 3.43Å; W38-V41 PolarHBondContact O-N 2.95Å; W38-V41 VanDerWaalsContact O-N 3.17Å; W38-L42 WeakPolarHBondContact O-CB 3.35Å; W38-L42 WeakPolarHBondContact O-CG 3.38Å; W38-L42 PolarHBondContact O-N 2.93Å
39	K	94.3	Very high	95.2	Very high	89 Å²	89	91.5 Å²	91.5	39%	0.387	46%	0.459	S	S	.	.	H	α-helix	trans	-52.2	-42.6	-175.9	177.1	171.3	177	161.6	0	113.7	D37 V41 L42 Q43 Y52	D37-K39 PolarHBondContact O-N 3.5Å; K39-V41 PolarHBondContact O-N 3.42Å; K39-V41 VanDerWaalsContact O-N 3.14Å; K39-L42 PolarHBondContact O-N 3.47Å; K39-Q43 VanDerWaalsContact O-CB 3.29Å; K39-Q43 WeakPolarHBondContact O-CB 3.27Å; K39-Q43 WeakPolarHBondContact O-CG 3.47Å; K39-Q43 PolarHBondContact O-N 3.03Å; K39-Y52 HydrophobicContact CB-CD1 3.99Å; K39-Y52 HydrophobicContact CB-CE1 3.7Å; K39-Y52 HydrophobicContact CD-CD1 3.68Å; K39-Y52 HydrophobicContact CD-CE1 4.22Å; K39-Y52 HydrophobicContact CD-CG 4.24Å; K39-Y52 HydrophobicContact CG-CD1 3.59Å; K39-Y52 HydrophobicContact CG-CE1 3.87Å; K39-Y52 HydrophobicContact CG-CG 3.91Å
40	L	95.1	Very high	94.7	Very high	113 Å²	113	92 Å²	92	59%	0.592	47%	0.465	S	S	*	.	H	α-helix	trans	-54.1	-37.7	-175.8	-171.5	73.1	0	0	0	112	W38 Q43 Y44	W38-L40 VanDerWaalsContact C-N 3.29Å; W38-L40 PolarHBondContact O-N 3.43Å; L40-Q43 PolarHBondContact O-NE2 3.35Å; L40-Y44 VanDerWaalsContact O-CD2 3.3Å; L40-Y44 WeakPolarHBondContact O-CD2 3.06Å; L40-Y44 WeakPolarHBondContact O-CE2 3.42Å
41	V	95.7	Very high	94.3	Very high	59 Å²	59	93.2 Å²	93.2	36%	0.358	46%	0.462	S	S	.	.	H	α-helix	trans	-91.5	-50.7	177.7	-176.2	0	0	0	0	110.7	I33 W38 K39 Q43 Y44	I33-V41 HydrophobicContact CD1-CB 4.41Å; I33-V41 HydrophobicContact CD1-CG1 3.99Å; I33-V41 HydrophobicContact CD1-CG2 4.29Å; I33-V41 HydrophobicContact CG1-CB 4.45Å; I33-V41 HydrophobicContact CG1-CG2 4.32Å; I33-V41 HydrophobicContact CG2-CB 4.13Å; I33-V41 HydrophobicContact CG2-CG1 4.19Å; W38-V41 PolarHBondContact O-N 2.95Å; W38-V41 VanDerWaalsContact O-N 3.17Å; K39-V41 PolarHBondContact O-N 3.42Å; K39-V41 VanDerWaalsContact O-N 3.14Å; V41-Q43 VanDerWaalsContact C-N 3.27Å; V41-Q43 PolarHBondContact O-N 2.9Å; V41-Y44 PolarHBondContact O-N 3.46Å; V41-Y44 VanDerWaalsContact O-N 3.14Å
42	L	95.4	Very high	93.8	Very high	15 Å²	15	93.5 Å²	93.5	8%	0.079	45%	0.452	C	S	.	.	H	α-helix	trans	-66.2	-23.6	-170.6	-68.9	177.4	0	0	0	114.1	I33 W38 K39 Y44 V45 I48 G49 Y52	I33-L42 HydrophobicContact CG2-CD1 4.31Å; I33-L42 HydrophobicContact CG2-CD2 3.64Å; I33-L42 HydrophobicContact CG2-CG 3.68Å; W38-L42 WeakPolarHBondContact O-CB 3.35Å; W38-L42 WeakPolarHBondContact O-CG 3.38Å; W38-L42 PolarHBondContact O-N 2.93Å; K39-L42 PolarHBondContact O-N 3.47Å; L42-Y44 PolarHBondContact O-N 3.29Å; L42-V45 HydrophobicContact CD2-CG2 4.32Å; L42-V45 PolarHBondContact O-N 3.03Å; L42-I48 HydrophobicContact CB-CG2 4.35Å; L42-I48 HydrophobicContact CD2-CG2 4.33Å; L42-G49 VanDerWaalsContact O-CA 3.25Å; L42-G49 WeakPolarHBondContact O-CA 3.49Å; L42-G49 PolarHBondContact O-N 2.95Å; L42-Y52 HydrophobicContact CB-CE2 3.55Å; L42-Y52 WeakPolarHBondContact CD1-OH 3.38Å
43	Q	94.6	Very high	93.2	Very high	66 Å²	66	98 Å²	98	31%	0.308	47%	0.466	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63	-25.8	175.7	70.8	-172.6	-19	0	0	113.5	K39 L40 V41 Y52	K39-Q43 VanDerWaalsContact O-CB 3.29Å; K39-Q43 WeakPolarHBondContact O-CB 3.27Å; K39-Q43 WeakPolarHBondContact O-CG 3.47Å; K39-Q43 PolarHBondContact O-N 3.03Å; L40-Q43 PolarHBondContact O-NE2 3.35Å; V41-Q43 VanDerWaalsContact C-N 3.27Å; V41-Q43 PolarHBondContact O-N 2.9Å; Q43-Y52 HydrophobicContact CB-CD2 4.12Å; Q43-Y52 HydrophobicContact CB-CG 4.4Å
44	Y	94.3	Very high	92.5	Very high	182 Å²	182	104.6 Å²	104.6	71%	0.714	49%	0.493	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92	-9	179.4	-62.2	-68.7	0	0	0	113.2	L40 V41 L42 P46	L40-Y44 VanDerWaalsContact O-CD2 3.3Å; L40-Y44 WeakPolarHBondContact O-CD2 3.06Å; L40-Y44 WeakPolarHBondContact O-CE2 3.42Å; V41-Y44 PolarHBondContact O-N 3.46Å; V41-Y44 VanDerWaalsContact O-N 3.14Å; L42-Y44 PolarHBondContact O-N 3.29Å; Y44-P46 WeakPolarHBondContact O-CD 3.42Å
45	V	94.3	Very high	91.7	Very high	52 Å²	52	104.8 Å²	104.8	32%	0.315	50%	0.502	S	S	.	.	S	Bend	trans	-77.2	122.3	179.9	-179.7	0	0	0	0	109	L42 I48 G49	L42-V45 HydrophobicContact CD2-CG2 4.32Å; L42-V45 PolarHBondContact O-N 3.03Å; V45-I48 HydrophobicContact CB-CB 4.33Å; V45-I48 HydrophobicContact CG1-CB 4.26Å; V45-I48 HydrophobicContact CG1-CD1 3.96Å; V45-I48 HydrophobicContact CG1-CG1 4.28Å; V45-I48 PolarHBondContact O-N 3.32Å; V45-G49 PolarHBondContact O-N 3.14Å
46	P	93.5	Very high	90.1	Very high	115 Å²	115	108.2 Å²	108.2	75%	0.747	53%	0.528	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.8	147.8	173.9	-24.5	34.3	0	0	0	110.9	Y44 I48	Y44-P46 WeakPolarHBondContact O-CD 3.42Å; P46-I48 PolarHBondContact O-N 3.39Å
47	Y	89.8	Confident	89.7	Confident	239 Å²	239	109.8 Å²	109.8	94%	0.937	53%	0.53	S	S	*	.	T	Hydrogen-bonded Turn	trans	70.1	-41.1	-175.8	-166.3	-106.7	0	0	0	115.8
48	I	91.8	Very high	89.5	Confident	71 Å²	71	110.9 Å²	110.9	36%	0.364	53%	0.534	S	S	.	.	T	Hydrogen-bonded Turn	trans	-85.3	-39.4	-179.2	-59.5	174.1	0	0	0	111.9	L42 V45 P46 G50 K51	L42-I48 HydrophobicContact CB-CG2 4.35Å; L42-I48 HydrophobicContact CD2-CG2 4.33Å; V45-I48 HydrophobicContact CB-CB 4.33Å; V45-I48 HydrophobicContact CG1-CB 4.26Å; V45-I48 HydrophobicContact CG1-CD1 3.96Å; V45-I48 HydrophobicContact CG1-CG1 4.28Å; V45-I48 PolarHBondContact O-N 3.32Å; P46-I48 PolarHBondContact O-N 3.39Å; I48-G50 PolarHBondContact O-N 3.15Å; I48-K51 WeakPolarHBondContact O-CG 3.44Å; I48-K51 PolarHBondContact O-N 2.97Å
49	G	89.8	Confident	89.1	Confident	9 Å²	9	110.4 Å²	110.4	9%	0.093	54%	0.538	C	S	.	.	G	3₁₀ helix	trans	-62.2	-16.4	-171.6	0	0	0	0	0	115.4	L42 V45 K51 Y52	L42-G49 VanDerWaalsContact O-CA 3.25Å; L42-G49 WeakPolarHBondContact O-CA 3.49Å; L42-G49 PolarHBondContact O-N 2.95Å; V45-G49 PolarHBondContact O-N 3.14Å; G49-K51 PolarHBondContact O-N 3.49Å; G49-Y52 PolarHBondContact O-N 3.22Å; G49-Y52 VanDerWaalsContact O-N 3.1Å
50	G	87.9	Confident	88.8	Confident	44 Å²	44	111.7 Å²	111.7	45%	0.454	55%	0.547	S	S	.	.	G	3₁₀ helix	trans	-55.3	-34.5	177.1	0	0	0	0	0	113.7	I48 Y52 K53	I48-G50 PolarHBondContact O-N 3.15Å; G50-Y52 PolarHBondContact O-N 3.27Å; G50-Y52 VanDerWaalsContact O-N 3.11Å; G50-K53 PolarHBondContact O-N 3.39Å
51	K	87.7	Confident	88.4	Confident	119 Å²	119	111.6 Å²	111.6	52%	0.517	54%	0.544	S	S	.	.	G	3₁₀ helix	trans	-66.3	-11.8	179.5	75	-175.7	-178.8	170	0	114.7	D37 I48 G49	D37-K51 IonicContact OD1-NZ 2.62Å; D37-K51 PolarHBondContact OD1-NZ 3.07Å; I48-K51 WeakPolarHBondContact O-CG 3.44Å; I48-K51 PolarHBondContact O-N 2.97Å; G49-K51 PolarHBondContact O-N 3.49Å
52	Y	89.3	Confident	87.9	Confident	40 Å²	40	115.1 Å²	115.1	16%	0.157	56%	0.557	C	S	.	*	G	3₁₀ helix	trans	-108.1	-2.4	-178.1	-59.5	-69	0	0	0	114	D37 K39 L42 Q43 G49 G50	D37-Y52 PolarHBondContact O-OH 2.86Å; K39-Y52 HydrophobicContact CB-CD1 3.99Å; K39-Y52 HydrophobicContact CB-CE1 3.7Å; K39-Y52 HydrophobicContact CD-CD1 3.68Å; K39-Y52 HydrophobicContact CD-CE1 4.22Å; K39-Y52 HydrophobicContact CD-CG 4.24Å; K39-Y52 HydrophobicContact CG-CD1 3.59Å; K39-Y52 HydrophobicContact CG-CE1 3.87Å; K39-Y52 HydrophobicContact CG-CG 3.91Å; L42-Y52 HydrophobicContact CB-CE2 3.55Å; L42-Y52 WeakPolarHBondContact CD1-OH 3.38Å; Q43-Y52 HydrophobicContact CB-CD2 4.12Å; Q43-Y52 HydrophobicContact CB-CG 4.4Å; G49-Y52 PolarHBondContact O-N 3.22Å; G49-Y52 VanDerWaalsContact O-N 3.1Å; G50-Y52 PolarHBondContact O-N 3.27Å; G50-Y52 VanDerWaalsContact O-N 3.11Å
53	K	86	Confident	87.4	Confident	172 Å²	172	122.3 Å²	122.3	75%	0.748	59%	0.591	S	S	*	*	P	Polyproline II helix	trans	-63.9	136	174.6	-67.4	-176.5	176.7	-176.7	0	108.9	G50	G50-K53 PolarHBondContact O-N 3.39Å
54	K	82.9	Confident	86.8	Confident	174 Å²	174	126.6 Å²	126.6	76%	0.757	61%	0.613	S	S	*	*	P	Polyproline II helix	trans	-88.2	140.3	167.3	-65.3	-179.4	-178.7	171.8	0	107.1
55	E	77.9	Confident	86.2	Confident	192 Å²	192	122 Å²	122	90%	0.897	60%	0.604	S	S	*	*	P	Polyproline II helix	trans	-73.8	129.9	163.2	-62.3	178.6	179.3	0	0	106.2
56	D	63.6	Low	85.5	Confident	237 Å²	237	128.4 Å²	128.4	100%	1.267	63%	0.631	S	S	*	*			trans	-70	0	172.3	-73.7	-34.6	0	0	0	110.5

Retrieved 56 of 56 residues in 66.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).