A0A093H925_STRCA Loading...

Mitochondrial import inner membrane translocase subunit

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.

AlphaFold DB , UniProt , Accession A0A093H925, Species STRCA (Struthio camelus australis), Gene n/a, Length 89 aa.

						>A0A093H925_STRCA|A0A093H925
MAGQISESDQIKQFKEFLGTYNKLTETCFLDCVKDFTSREVKPEEMTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.2	Very low	75.2	Confident	242 Å²	242	113.5 Å²	113.5	100%	1.192	64%	0.64	S	S	*	*				0	108.3	0	-64.5	176.8	179.5	0	0	106.6	G3	M1-G3 PolarHBondContact O-N 3.12Å
2	A	48.3	Very low	76.8	Confident	105 Å²	105	113.8 Å²	113.8	87%	0.868	63%	0.629	S	S	*	*			trans	-68.1	103	172.3	0	0	0	0	0	106.6	Q4	A2-Q4 PolarHBondContact O-N 3.28Å
3	G	59.7	Low	78.1	Confident	67 Å²	67	113.6 Å²	113.6	69%	0.691	62%	0.621	S	S	*	*	P	Polyproline II helix	trans	-58.1	127.1	177.3	0	0	0	0	0	108.9	M1 I5	M1-G3 PolarHBondContact O-N 3.12Å; G3-I5 PolarHBondContact O-N 3.41Å
4	Q	64.7	Low	79.3	Confident	194 Å²	194	114.9 Å²	114.9	91%	0.907	62%	0.618	S	S	*	*	P	Polyproline II helix	trans	-58.7	120.8	170.5	-70.9	173.3	-23.9	0	0	107.5	A2 S6	A2-Q4 PolarHBondContact O-N 3.28Å; Q4-S6 PolarHBondContact O-N 3.13Å
5	I	72.1	Confident	80.4	Confident	98 Å²	98	118.1 Å²	118.1	50%	0.503	62%	0.624	S	S	.	*	P	Polyproline II helix	trans	-59.5	120.7	168.6	-55.2	171.6	0	0	0	105.3	G3 D9 Q10	G3-I5 PolarHBondContact O-N 3.41Å; I5-D9 HydrophobicContact CG2-CB 3.83Å; I5-Q10 HydrophobicContact CB-CG 4.25Å; I5-Q10 HydrophobicContact CG2-CG 3.63Å
6	S	84.8	Confident	81.4	Confident	44 Å²	44	118.9 Å²	118.9	31%	0.308	62%	0.623	S	S	.	*	P	Polyproline II helix	trans	-62.8	149.3	179.4	71.1	0	0	0	0	109.4	Q4 S8 D9 Q10	Q4-S6 PolarHBondContact O-N 3.13Å; S6-S8 PolarHBondContact O-N 3.34Å; S6-S8 VanDerWaalsContact O-N 3.13Å; S6-S8 PolarHBondContact OG-OG 2.92Å; S6-D9 PolarHBondContact O-N 3.5Å; S6-D9 VanDerWaalsContact OG-CG 3.23Å; S6-D9 PolarHBondContact OG-N 2.86Å; S6-D9 VanDerWaalsContact OG-N 3.1Å; S6-D9 PolarHBondContact OG-OD2 3.32Å; S6-Q10 PolarHBondContact O-N 3.3Å
7	E	87.9	Confident	82.2	Confident	153 Å²	153	119.2 Å²	119.2	72%	0.715	62%	0.618	S	S	*	*	H	α-helix	trans	-52.6	-36.6	174.3	-171.8	-178.8	91.4	0	0	111.2	D9 Q10 I11	E7-D9 PolarHBondContact O-N 3.12Å; E7-Q10 PolarHBondContact O-N 3.39Å; E7-I11 HydrophobicContact CG-CD1 4.28Å; E7-I11 VanDerWaalsContact O-CG1 3.31Å; E7-I11 WeakPolarHBondContact O-CG1 3.4Å; E7-I11 PolarHBondContact O-N 3.35Å
8	S	90.1	Very high	83	Confident	66 Å²	66	116.8 Å²	116.8	46%	0.462	61%	0.606	S	S	.	*	H	α-helix	trans	-63.9	-34.6	175.1	56.3	0	0	0	0	113.9	S6 K12	S6-S8 PolarHBondContact O-N 3.34Å; S6-S8 VanDerWaalsContact O-N 3.13Å; S6-S8 PolarHBondContact OG-OG 2.92Å; S8-K12 VanDerWaalsContact O-CG 3.29Å; S8-K12 WeakPolarHBondContact O-CG 3.38Å; S8-K12 PolarHBondContact O-N 3.12Å; S8-K12 VanDerWaalsContact O-N 3.15Å
9	D	92.3	Very high	83.8	Confident	67 Å²	67	112.9 Å²	112.9	36%	0.358	60%	0.598	S	S	.	*	H	α-helix	trans	-77.5	-33.5	177	-69.9	-23.3	0	0	0	111.9	I5 S6 E7 K12 Q13	I5-D9 HydrophobicContact CG2-CB 3.83Å; S6-D9 PolarHBondContact O-N 3.5Å; S6-D9 VanDerWaalsContact OG-CG 3.23Å; S6-D9 PolarHBondContact OG-N 2.86Å; S6-D9 VanDerWaalsContact OG-N 3.1Å; S6-D9 PolarHBondContact OG-OD2 3.32Å; E7-D9 PolarHBondContact O-N 3.12Å; D9-K12 PolarHBondContact O-N 3.44Å; D9-K12 IonicContact OD1-NZ 2.95Å; D9-K12 PolarHBondContact OD1-NZ 3.47Å; D9-Q13 WeakPolarHBondContact O-CG 3.45Å; D9-Q13 PolarHBondContact O-N 2.83Å
10	Q	91.4	Very high	84.4	Confident	109 Å²	109	110.7 Å²	110.7	51%	0.509	59%	0.589	S	S	.	*	H	α-helix	trans	-62.5	-43.6	170.9	-65	-177	-52.8	0	0	111.6	I5 S6 E7 K12 Q13 F14	I5-Q10 HydrophobicContact CB-CG 4.25Å; I5-Q10 HydrophobicContact CG2-CG 3.63Å; S6-Q10 PolarHBondContact O-N 3.3Å; E7-Q10 PolarHBondContact O-N 3.39Å; Q10-K12 VanDerWaalsContact C-N 3.34Å; Q10-K12 PolarHBondContact O-N 3.06Å; Q10-Q13 PolarHBondContact O-N 3.27Å; Q10-F14 PolarHBondContact O-N 3.27Å
11	I	93.6	Very high	85	Confident	104 Å²	104	111.8 Å²	111.8	53%	0.533	59%	0.586	S	S	.	*	H	α-helix	trans	-62.1	-41.7	176.6	-69.1	166.1	0	0	0	111	E7 F14 K15	E7-I11 HydrophobicContact CG-CD1 4.28Å; E7-I11 VanDerWaalsContact O-CG1 3.31Å; E7-I11 WeakPolarHBondContact O-CG1 3.4Å; E7-I11 PolarHBondContact O-N 3.35Å; I11-F14 PolarHBondContact O-N 2.97Å; I11-K15 WeakPolarHBondContact O-CB 3.38Å; I11-K15 PolarHBondContact O-N 3.43Å
12	K	94.5	Very high	87.6	Confident	117 Å²	117	105.1 Å²	105.1	51%	0.509	56%	0.555	S	S	.	*	H	α-helix	trans	-61.6	-49	175.8	-72.5	170.4	-162.8	159.7	0	111.6	S8 D9 Q10 F14 K15 E16	S8-K12 VanDerWaalsContact O-CG 3.29Å; S8-K12 WeakPolarHBondContact O-CG 3.38Å; S8-K12 PolarHBondContact O-N 3.12Å; S8-K12 VanDerWaalsContact O-N 3.15Å; D9-K12 PolarHBondContact O-N 3.44Å; D9-K12 IonicContact OD1-NZ 2.95Å; D9-K12 PolarHBondContact OD1-NZ 3.47Å; Q10-K12 VanDerWaalsContact C-N 3.34Å; Q10-K12 PolarHBondContact O-N 3.06Å; K12-F14 VanDerWaalsContact C-N 3.28Å; K12-F14 PolarHBondContact O-N 3.33Å; K12-K15 WeakPolarHBondContact O-CB 3.38Å; K12-K15 PolarHBondContact O-N 3.02Å; K12-K15 VanDerWaalsContact O-N 3.12Å; K12-E16 WeakPolarHBondContact O-CG 3.47Å; K12-E16 PolarHBondContact O-N 3.02Å
13	Q	94.3	Very high	89.9	Confident	111 Å²	111	105.2 Å²	105.2	52%	0.519	54%	0.536	S	S	.	.	H	α-helix	trans	-57.9	-42	178.3	-74.4	179.4	-0.8	0	0	111.7	D9 Q10 E16 F17	D9-Q13 WeakPolarHBondContact O-CG 3.45Å; D9-Q13 PolarHBondContact O-N 2.83Å; Q10-Q13 PolarHBondContact O-N 3.27Å; Q13-E16 PolarHBondContact O-N 3.11Å; Q13-F17 WeakPolarHBondContact O-CB 3.4Å; Q13-F17 PolarHBondContact O-N 3.05Å
14	F	94.7	Very high	91.7	Very high	131 Å²	131	102.7 Å²	102.7	58%	0.575	51%	0.507	S	S	*	.	H	α-helix	trans	-65.6	-40.7	177.2	-167.8	-107.2	0	0	0	112.3	Q10 I11 K12 F17 L18	Q10-F14 PolarHBondContact O-N 3.27Å; I11-F14 PolarHBondContact O-N 2.97Å; K12-F14 VanDerWaalsContact C-N 3.28Å; K12-F14 PolarHBondContact O-N 3.33Å; F14-F17 WeakPolarHBondContact O-CB 3.26Å; F14-F17 PolarHBondContact O-N 3.37Å; F14-L18 HydrophobicContact CD1-CD1 3.92Å; F14-L18 HydrophobicContact CD1-CG 4.33Å; F14-L18 HydrophobicContact CE1-CD1 3.57Å; F14-L18 HydrophobicContact CE1-CD2 4.41Å; F14-L18 HydrophobicContact CE1-CG 4.05Å; F14-L18 HydrophobicContact CZ-CD1 4.26Å; F14-L18 HydrophobicContact CZ-CD2 4.29Å; F14-L18 HydrophobicContact CZ-CG 4.35Å; F14-L18 WeakPolarHBondContact O-CG 2.9Å; F14-L18 PolarHBondContact O-N 3.46Å
15	K	96.2	Very high	93.3	Very high	163 Å²	163	96.9 Å²	96.9	71%	0.709	48%	0.484	S	S	*	.	H	α-helix	trans	-62.8	-42.9	175.7	-171.5	178.3	179.9	-179.7	0	112	I11 K12 F17 L18 G19	I11-K15 WeakPolarHBondContact O-CB 3.38Å; I11-K15 PolarHBondContact O-N 3.43Å; K12-K15 WeakPolarHBondContact O-CB 3.38Å; K12-K15 PolarHBondContact O-N 3.02Å; K12-K15 VanDerWaalsContact O-N 3.12Å; K15-F17 VanDerWaalsContact C-N 3.34Å; K15-L18 PolarHBondContact O-N 3.36Å; K15-G19 PolarHBondContact O-N 2.86Å
16	E	95.1	Very high	94.5	Very high	132 Å²	132	96.9 Å²	96.9	62%	0.617	48%	0.482	S	S	*	.	H	α-helix	trans	-64.3	-39.9	175.6	-72.5	178.7	148	0	0	111.9	K12 Q13 G19 T20	K12-E16 WeakPolarHBondContact O-CG 3.47Å; K12-E16 PolarHBondContact O-N 3.02Å; Q13-E16 PolarHBondContact O-N 3.11Å; E16-G19 PolarHBondContact O-N 3.2Å; E16-T20 WeakPolarHBondContact O-CB 3.42Å; E16-T20 PolarHBondContact O-N 3.22Å; E16-T20 PolarHBondContact O-OG1 3.36Å
17	F	95.7	Very high	95.2	Very high	123 Å²	123	96.3 Å²	96.3	54%	0.539	48%	0.477	S	S	.	.	H	α-helix	trans	-59.1	-49.8	174.1	171	-99.4	0	0	0	111.5	Q13 F14 K15 G19 T20 Y21	Q13-F17 WeakPolarHBondContact O-CB 3.4Å; Q13-F17 PolarHBondContact O-N 3.05Å; F14-F17 WeakPolarHBondContact O-CB 3.26Å; F14-F17 PolarHBondContact O-N 3.37Å; K15-F17 VanDerWaalsContact C-N 3.34Å; F17-G19 VanDerWaalsContact C-N 3.31Å; F17-G19 PolarHBondContact O-N 2.95Å; F17-T20 PolarHBondContact O-N 3.02Å; F17-Y21 WeakPolarHBondContact O-CB 3.44Å; F17-Y21 PolarHBondContact O-N 3.1Å
18	L	96.9	Very high	95.7	Very high	76 Å²	76	89.6 Å²	89.6	40%	0.398	45%	0.446	S	S	.	.	H	α-helix	trans	-62.4	-39.2	178.4	-68.1	177.6	0	0	0	112.2	F14 K15 T20 Y21 N22	F14-L18 HydrophobicContact CD1-CD1 3.92Å; F14-L18 HydrophobicContact CD1-CG 4.33Å; F14-L18 HydrophobicContact CE1-CD1 3.57Å; F14-L18 HydrophobicContact CE1-CD2 4.41Å; F14-L18 HydrophobicContact CE1-CG 4.05Å; F14-L18 HydrophobicContact CZ-CD1 4.26Å; F14-L18 HydrophobicContact CZ-CD2 4.29Å; F14-L18 HydrophobicContact CZ-CG 4.35Å; F14-L18 WeakPolarHBondContact O-CG 2.9Å; F14-L18 PolarHBondContact O-N 3.46Å; K15-L18 PolarHBondContact O-N 3.36Å; L18-T20 VanDerWaalsContact C-N 3.35Å; L18-Y21 PolarHBondContact O-N 3.37Å; L18-N22 PolarHBondContact O-N 2.91Å; L18-N22 PolarHBondContact O-ND2 3.32Å
19	G	97.1	Very high	96	Very high	43 Å²	43	91.6 Å²	91.6	44%	0.443	45%	0.447	S	S	.	.	H	α-helix	trans	-60.3	-45.3	174.2	0	0	0	0	0	112.2	K15 E16 F17 N22 K23	K15-G19 PolarHBondContact O-N 2.86Å; E16-G19 PolarHBondContact O-N 3.2Å; F17-G19 VanDerWaalsContact C-N 3.31Å; F17-G19 PolarHBondContact O-N 2.95Å; G19-N22 PolarHBondContact O-N 3.37Å; G19-K23 PolarHBondContact O-N 3.29Å; G19-K23 VanDerWaalsContact O-N 3.07Å
20	T	95.7	Very high	96.3	Very high	69 Å²	69	94.2 Å²	94.2	42%	0.423	46%	0.46	S	S	.	.	H	α-helix	trans	-66.8	-41.2	178.1	-54.7	0	0	0	0	111.7	E16 F17 L18 N22 K23 L24 Y56	E16-T20 WeakPolarHBondContact O-CB 3.42Å; E16-T20 PolarHBondContact O-N 3.22Å; E16-T20 PolarHBondContact O-OG1 3.36Å; F17-T20 PolarHBondContact O-N 3.02Å; L18-T20 VanDerWaalsContact C-N 3.35Å; T20-N22 PolarHBondContact O-N 3.36Å; T20-K23 PolarHBondContact O-N 3.44Å; T20-L24 VanDerWaalsContact O-CB 3.29Å; T20-L24 WeakPolarHBondContact O-CB 3.41Å; T20-L24 PolarHBondContact O-N 2.68Å; T20-Y56 HydrophobicContact CG2-CE1 4.46Å
21	Y	97.1	Very high	96.6	Very high	133 Å²	133	94.7 Å²	94.7	52%	0.522	47%	0.466	S	S	.	.	H	α-helix	trans	-57	-50.1	175.7	173.2	-96.3	0	0	0	111	F17 L18 K23 L24 T25	F17-Y21 WeakPolarHBondContact O-CB 3.44Å; F17-Y21 PolarHBondContact O-N 3.1Å; L18-Y21 PolarHBondContact O-N 3.37Å; Y21-K23 VanDerWaalsContact C-N 3.34Å; Y21-K23 PolarHBondContact O-N 2.89Å; Y21-L24 PolarHBondContact O-N 2.98Å; Y21-T25 PolarHBondContact O-N 3.39Å; Y21-T25 PolarHBondContact O-OG1 3.41Å; Y21-T25 VanDerWaalsContact O-OG1 3.06Å
22	N	97.6	Very high	96.8	Very high	103 Å²	103	89.9 Å²	89.9	55%	0.551	44%	0.442	S	S	*	.	H	α-helix	trans	-62	-42.6	178.7	-70.7	-17.3	0	0	0	111.8	L18 G19 T20 L24 T25 E26	L18-N22 PolarHBondContact O-N 2.91Å; L18-N22 PolarHBondContact O-ND2 3.32Å; G19-N22 PolarHBondContact O-N 3.37Å; T20-N22 PolarHBondContact O-N 3.36Å; N22-L24 VanDerWaalsContact C-N 3.33Å; N22-L24 PolarHBondContact O-N 3.2Å; N22-T25 PolarHBondContact O-N 2.95Å; N22-E26 PolarHBondContact O-N 3.13Å
23	K	97.1	Very high	97	Very high	106 Å²	106	85.7 Å²	85.7	46%	0.461	43%	0.426	S	S	.	.	H	α-helix	trans	-64	-40.3	179.3	-176.6	62.2	-165.8	166.6	0	112.4	G19 T20 Y21 E26 T27	G19-K23 PolarHBondContact O-N 3.29Å; G19-K23 VanDerWaalsContact O-N 3.07Å; T20-K23 PolarHBondContact O-N 3.44Å; Y21-K23 VanDerWaalsContact C-N 3.34Å; Y21-K23 PolarHBondContact O-N 2.89Å; K23-E26 IonicContact NZ-OE2 3.39Å; K23-E26 PolarHBondContact NZ-OE2 3.47Å; K23-T27 WeakPolarHBondContact O-CB 3.26Å; K23-T27 PolarHBondContact O-N 3.33Å; K23-T27 PolarHBondContact O-OG1 3.49Å
24	L	97.5	Very high	97.1	Very high	15 Å²	15	87.7 Å²	87.7	8%	0.079	43%	0.433	C	S	.	.	H	α-helix	trans	-66.2	-46.4	178.3	179.4	48.3	0	0	0	111.6	T20 Y21 N22 E26 T27 C28 L53 Y56 L57	T20-L24 VanDerWaalsContact O-CB 3.29Å; T20-L24 WeakPolarHBondContact O-CB 3.41Å; T20-L24 PolarHBondContact O-N 2.68Å; Y21-L24 PolarHBondContact O-N 2.98Å; N22-L24 VanDerWaalsContact C-N 3.33Å; N22-L24 PolarHBondContact O-N 3.2Å; L24-E26 VanDerWaalsContact C-N 3.34Å; L24-E26 PolarHBondContact O-N 2.85Å; L24-T27 PolarHBondContact O-N 3.38Å; L24-C28 PolarHBondContact O-N 3.44Å; L24-L53 HydrophobicContact CD2-CD1 3.28Å; L24-L53 HydrophobicContact CG-CD1 4.1Å; L24-Y56 HydrophobicContact CB-CE1 4.43Å; L24-Y56 HydrophobicContact CD1-CD1 3.52Å; L24-Y56 HydrophobicContact CD1-CD2 3.92Å; L24-Y56 HydrophobicContact CD1-CE1 4.16Å; L24-Y56 HydrophobicContact CD1-CG 3.38Å; L24-Y56 HydrophobicContact CD2-CD1 3.93Å; L24-Y56 HydrophobicContact CD2-CE1 4.42Å; L24-Y56 HydrophobicContact CG-CD1 4.21Å; L24-L57 HydrophobicContact CD2-CD2 4.32Å
25	T	97.6	Very high	97.1	Very high	71 Å²	71	83.6 Å²	83.6	44%	0.436	42%	0.417	S	S	.	.	H	α-helix	trans	-58.5	-45.9	176.2	-61.2	0	0	0	0	111.4	Y21 N22 T27 F29	Y21-T25 PolarHBondContact O-N 3.39Å; Y21-T25 PolarHBondContact O-OG1 3.41Å; Y21-T25 VanDerWaalsContact O-OG1 3.06Å; N22-T25 PolarHBondContact O-N 2.95Å; T25-T27 PolarHBondContact O-N 3.19Å; T25-F29 VanDerWaalsContact O-CB 3.26Å; T25-F29 WeakPolarHBondContact O-CB 3.32Å; T25-F29 PolarHBondContact O-N 3.43Å
26	E	98.2	Very high	97.1	Very high	99 Å²	99	83 Å²	83	46%	0.463	42%	0.415	S	S	.	.	H	α-helix	trans	-58.9	-48.3	175.3	179.1	-172.6	-123.5	0	0	111.7	N22 K23 L24 F29 L30	N22-E26 PolarHBondContact O-N 3.13Å; K23-E26 IonicContact NZ-OE2 3.39Å; K23-E26 PolarHBondContact NZ-OE2 3.47Å; L24-E26 VanDerWaalsContact C-N 3.34Å; L24-E26 PolarHBondContact O-N 2.85Å; E26-F29 PolarHBondContact O-N 2.93Å; E26-L30 HydrophobicContact CG-CD1 3.96Å; E26-L30 WeakPolarHBondContact O-CG 3.37Å; E26-L30 PolarHBondContact O-N 2.99Å
27	T	97.9	Very high	97.2	Very high	32 Å²	32	82.3 Å²	82.3	20%	0.196	42%	0.42	C	S	.	.	H	α-helix	trans	-61.5	-49	-177.5	-55	0	0	0	0	111.1	K23 L24 T25 F29 L30 D31	K23-T27 WeakPolarHBondContact O-CB 3.26Å; K23-T27 PolarHBondContact O-N 3.33Å; K23-T27 PolarHBondContact O-OG1 3.49Å; L24-T27 PolarHBondContact O-N 3.38Å; T25-T27 PolarHBondContact O-N 3.19Å; T27-F29 VanDerWaalsContact C-N 3.35Å; T27-F29 PolarHBondContact O-N 3.41Å; T27-L30 PolarHBondContact O-N 3.02Å; T27-D31 WeakPolarHBondContact O-CB 3.3Å; T27-D31 PolarHBondContact O-N 2.77Å
28	C	98.3	Very high	97.2	Very high	11 Å²	11	79 Å²	79	7%	0.074	41%	0.412	C	S	.	.	H	α-helix	trans	-69.4	-33.3	-179.7	-64.1	0	0	0	0	112.6	L24 C32 C52	L24-C28 PolarHBondContact O-N 3.44Å; C28-C32 WeakPolarHBondContact O-CB 3.44Å; C28-C32 PolarHBondContact O-N 2.85Å; C28-C52 WeakPolarHBondContact CA-SG 3.47Å; C28-C52 HydrophobicContact CB-CB 3.82Å; C28-C52 WeakPolarHBondContact CB-SG 3.29Å; C28-C52 WeakPolarHBondContact SG-CB 3.35Å; C28-C52 CovalentContact SG-SG 2.05Å; C28-C52 PolarHBondContact SG-SG 3.4Å
29	F	98.1	Very high	97.1	Very high	108 Å²	108	87.8 Å²	87.8	47%	0.474	44%	0.44	S	S	.	.	H	α-helix	trans	-62	-49	173.5	-179	-93.6	0	0	0	111.2	T25 E26 T27 D31 V33 F36	T25-F29 VanDerWaalsContact O-CB 3.26Å; T25-F29 WeakPolarHBondContact O-CB 3.32Å; T25-F29 PolarHBondContact O-N 3.43Å; E26-F29 PolarHBondContact O-N 2.93Å; T27-F29 VanDerWaalsContact C-N 3.35Å; T27-F29 PolarHBondContact O-N 3.41Å; F29-D31 VanDerWaalsContact C-N 3.33Å; F29-D31 PolarHBondContact O-N 2.85Å; F29-V33 HydrophobicContact CD2-CB 3.87Å; F29-V33 HydrophobicContact CD2-CG1 4.33Å; F29-V33 HydrophobicContact CD2-CG2 3.63Å; F29-V33 HydrophobicContact CE2-CB 3.83Å; F29-V33 HydrophobicContact CE2-CG1 3.79Å; F29-V33 HydrophobicContact CE2-CG2 3.94Å; F29-V33 HydrophobicContact CG-CB 4.4Å; F29-V33 HydrophobicContact CG-CG2 4.34Å; F29-V33 HydrophobicContact CZ-CB 4.33Å; F29-V33 HydrophobicContact CZ-CG1 4.19Å; F29-V33 WeakPolarHBondContact O-CB 3.33Å; F29-V33 PolarHBondContact O-N 3.45Å; F29-F36 HydrophobicContact CZ-CE1 4.15Å; F29-F36 HydrophobicContact CZ-CZ 4.43Å
30	L	98	Very high	97.1	Very high	122 Å²	122	93.4 Å²	93.4	64%	0.639	45%	0.454	S	S	*	.	H	α-helix	trans	-63.5	-36.2	-179.9	-70.9	174	0	0	0	113.1	E26 T27	E26-L30 HydrophobicContact CG-CD1 3.96Å; E26-L30 WeakPolarHBondContact O-CG 3.37Å; E26-L30 PolarHBondContact O-N 2.99Å; T27-L30 PolarHBondContact O-N 3.02Å
31	D	97.8	Very high	97.1	Very high	119 Å²	119	94 Å²	94	64%	0.636	46%	0.458	S	S	*	.	H	α-helix	trans	-83.8	-31.6	-177.1	-72.5	-15.5	0	0	0	113.2	T27 F29	T27-D31 WeakPolarHBondContact O-CB 3.3Å; T27-D31 PolarHBondContact O-N 2.77Å; F29-D31 VanDerWaalsContact C-N 3.33Å; F29-D31 PolarHBondContact O-N 2.85Å
32	C	98.3	Very high	97	Very high	4 Å²	4	91.2 Å²	91.2	3%	0.027	45%	0.448	C	S	.	.	H	α-helix	trans	-110.2	-32.7	-169.9	-68.1	0	0	0	0	115.1	C28 K34 E45 C48 S49	C28-C32 WeakPolarHBondContact O-CB 3.44Å; C28-C32 PolarHBondContact O-N 2.85Å; C32-K34 PolarHBondContact O-N 2.8Å; C32-E45 WeakPolarHBondContact O-CG 3.32Å; C32-C48 VanDerWaalsContact CA-SG 3.52Å; C32-C48 HydrophobicContact CB-CB 3.59Å; C32-C48 WeakPolarHBondContact CB-SG 3.37Å; C32-C48 WeakPolarHBondContact SG-CB 3.33Å; C32-C48 PolarHBondContact SG-O 3.32Å; C32-C48 VanDerWaalsContact SG-O 3.33Å; C32-C48 CovalentContact SG-SG 2.05Å; C32-C48 PolarHBondContact SG-SG 3.4Å; C32-S49 PolarHBondContact SG-N 2.83Å; C32-S49 VanDerWaalsContact SG-N 3.45Å
33	V	97.6	Very high	97	Very high	28 Å²	28	90.6 Å²	90.6	17%	0.17	45%	0.45	C	S	.	.			trans	-90.2	103.7	-177.7	-175.3	0	0	0	0	108.8	F29 F36 E45	F29-V33 HydrophobicContact CD2-CB 3.87Å; F29-V33 HydrophobicContact CD2-CG1 4.33Å; F29-V33 HydrophobicContact CD2-CG2 3.63Å; F29-V33 HydrophobicContact CE2-CB 3.83Å; F29-V33 HydrophobicContact CE2-CG1 3.79Å; F29-V33 HydrophobicContact CE2-CG2 3.94Å; F29-V33 HydrophobicContact CG-CB 4.4Å; F29-V33 HydrophobicContact CG-CG2 4.34Å; F29-V33 HydrophobicContact CZ-CB 4.33Å; F29-V33 HydrophobicContact CZ-CG1 4.19Å; F29-V33 WeakPolarHBondContact O-CB 3.33Å; F29-V33 PolarHBondContact O-N 3.45Å; V33-F36 HydrophobicContact CG1-CE1 4.15Å; V33-F36 HydrophobicContact CG1-CZ 4.17Å; V33-E45 WeakPolarHBondContact CA-OE1 3.4Å
34	K	96.3	Very high	97	Very high	154 Å²	154	92.3 Å²	92.3	67%	0.67	46%	0.46	S	S	*	.			trans	-125.4	-16.4	-170.6	62.8	-175.3	177.3	-177.5	0	112.8	C32 E45	C32-K34 PolarHBondContact O-N 2.8Å; K34-E45 PolarHBondContact N-OE1 3.49Å
35	D	95.1	Very high	97	Very high	45 Å²	45	91.8 Å²	91.8	24%	0.241	46%	0.457	C	S	.	.			trans	-106.6	113.2	-179.5	-163	-40.1	0	0	0	111.2	T37 K42 E45	D35-T37 VanDerWaalsContact OD1-CB 3.26Å; D35-T37 WeakPolarHBondContact OD1-CB 3.13Å; D35-T37 VanDerWaalsContact OD1-CG2 3.32Å; D35-T37 WeakPolarHBondContact OD1-CG2 3.15Å; D35-T37 PolarHBondContact OD1-N 3.08Å; D35-T37 PolarHBondContact OD1-OG1 3.42Å; D35-K42 HydrophobicContact CB-CD 4.12Å; D35-K42 VanDerWaalsContact CG-NZ 3.32Å; D35-K42 IonicContact OD1-NZ 3.77Å; D35-K42 VanDerWaalsContact OD2-CE 3.26Å; D35-K42 WeakPolarHBondContact OD2-CE 3.41Å; D35-K42 IonicContact OD2-NZ 2.59Å; D35-K42 PolarHBondContact OD2-NZ 2.98Å; D35-E45 PolarHBondContact N-OE1 3.43Å
36	F	96.6	Very high	97	Very high	150 Å²	150	93 Å²	93	66%	0.658	46%	0.459	S	S	*	.			trans	-107.3	22.4	-179.1	-60.6	-84.2	0	0	0	112.6	F29 V33	F29-F36 HydrophobicContact CZ-CE1 4.15Å; F29-F36 HydrophobicContact CZ-CZ 4.43Å; V33-F36 HydrophobicContact CG1-CE1 4.15Å; V33-F36 HydrophobicContact CG1-CZ 4.17Å
37	T	96.8	Very high	97	Very high	118 Å²	118	91.6 Å²	91.6	72%	0.724	46%	0.457	S	S	*	.	S	Bend	trans	-83.1	-21.1	179.1	61.8	0	0	0	0	113.4	D35	D35-T37 VanDerWaalsContact OD1-CB 3.26Å; D35-T37 WeakPolarHBondContact OD1-CB 3.13Å; D35-T37 VanDerWaalsContact OD1-CG2 3.32Å; D35-T37 WeakPolarHBondContact OD1-CG2 3.15Å; D35-T37 PolarHBondContact OD1-N 3.08Å; D35-T37 PolarHBondContact OD1-OG1 3.42Å
38	S	95.2	Very high	97	Very high	52 Å²	52	92.4 Å²	92.4	36%	0.364	46%	0.464	S	S	.	.			trans	-129.2	158	177.7	56.6	0	0	0	0	111.5	E40	S38-E40 VanDerWaalsContact C-N 3.32Å; S38-E40 PolarHBondContact OG-O 3.04Å; S38-E40 VanDerWaalsContact OG-O 3.14Å
39	R	95.8	Very high	97	Very high	261 Å²	261	93.6 Å²	93.6	99%	0.985	47%	0.472	S	S	*	.	S	Bend	trans	-79.6	-17.3	170	-67	-176.3	179.1	-175.8	-0.3	113.3
40	E	96.1	Very high	97	Very high	161 Å²	161	94.3 Å²	94.3	75%	0.752	48%	0.477	S	S	*	.	S	Bend	trans	-82.3	141.7	177.2	-62.8	-178.7	171.7	0	0	110.4	S38	S38-E40 VanDerWaalsContact C-N 3.32Å; S38-E40 PolarHBondContact OG-O 3.04Å; S38-E40 VanDerWaalsContact OG-O 3.14Å
41	V	95.9	Very high	97.1	Very high	81 Å²	81	93.9 Å²	93.9	49%	0.491	47%	0.471	S	S	.	.	P	Polyproline II helix	trans	-76.9	122.9	174.5	-174.8	0	0	0	0	108.3	E45 M46	V41-E45 HydrophobicContact CG1-CB 3.79Å; V41-M46 HydrophobicContact CB-CG 4.07Å; V41-M46 HydrophobicContact CG1-CG 3.56Å
42	K	96.3	Very high	97.1	Very high	75 Å²	75	89.2 Å²	89.2	33%	0.326	45%	0.448	S	S	.	.	P	Polyproline II helix	trans	-68	151.1	-178.2	-68.9	-171.7	177.6	-170.5	0	110.6	D35 E44 E45 M46	D35-K42 HydrophobicContact CB-CD 4.12Å; D35-K42 VanDerWaalsContact CG-NZ 3.32Å; D35-K42 IonicContact OD1-NZ 3.77Å; D35-K42 VanDerWaalsContact OD2-CE 3.26Å; D35-K42 WeakPolarHBondContact OD2-CE 3.41Å; D35-K42 IonicContact OD2-NZ 2.59Å; D35-K42 PolarHBondContact OD2-NZ 2.98Å; K42-E44 PolarHBondContact O-N 3.5Å; K42-E44 VanDerWaalsContact O-N 3.16Å; K42-E45 HydrophobicContact CB-CG 4.16Å; K42-E45 PolarHBondContact N-OE2 3.3Å; K42-E45 VanDerWaalsContact N-OE2 3.11Å; K42-E45 WeakPolarHBondContact O-CB 3.36Å; K42-E45 PolarHBondContact O-N 3.01Å; K42-M46 PolarHBondContact O-N 3.37Å
43	P	97.2	Very high	97	Very high	91 Å²	91	92.8 Å²	92.8	59%	0.591	47%	0.466	S	S	*	.	H	α-helix	trans	-56.4	-35.6	-179.8	21.2	-33	0	0	0	112.8	M46 T47	P43-M46 HydrophobicContact CB-CE 4.42Å; P43-M46 PolarHBondContact O-N 2.99Å; P43-T47 PolarHBondContact O-N 2.74Å; P43-T47 PolarHBondContact O-OG1 3.47Å
44	E	96.8	Very high	97.1	Very high	141 Å²	141	96.6 Å²	96.6	66%	0.659	48%	0.482	S	S	*	.	H	α-helix	trans	-63.4	-39.8	174.8	-61.7	-179.2	-171.9	0	0	112.8	K42 C48	K42-E44 PolarHBondContact O-N 3.5Å; K42-E44 VanDerWaalsContact O-N 3.16Å; E44-C48 VanDerWaalsContact O-CB 3.3Å; E44-C48 WeakPolarHBondContact O-CB 3.36Å; E44-C48 PolarHBondContact O-N 3.23Å
45	E	97.8	Very high	97.1	Very high	5 Å²	5	96.9 Å²	96.9	2%	0.023	48%	0.483	C	S	.	.	H	α-helix	trans	-73	-35.3	178.9	-58.7	-179.8	131.5	0	0	111.2	C32 V33 K34 D35 V41 K42 C48 S49	C32-E45 WeakPolarHBondContact O-CG 3.32Å; V33-E45 WeakPolarHBondContact CA-OE1 3.4Å; K34-E45 PolarHBondContact N-OE1 3.49Å; D35-E45 PolarHBondContact N-OE1 3.43Å; V41-E45 HydrophobicContact CG1-CB 3.79Å; K42-E45 HydrophobicContact CB-CG 4.16Å; K42-E45 PolarHBondContact N-OE2 3.3Å; K42-E45 VanDerWaalsContact N-OE2 3.11Å; K42-E45 WeakPolarHBondContact O-CB 3.36Å; K42-E45 PolarHBondContact O-N 3.01Å; E45-C48 PolarHBondContact O-N 3.34Å; E45-S49 WeakPolarHBondContact O-CB 3.33Å; E45-S49 PolarHBondContact O-N 3.45Å; E45-S49 PolarHBondContact O-OG 3.19Å
46	M	97.6	Very high	97.3	Very high	97 Å²	97	97.3 Å²	97.3	48%	0.478	48%	0.482	S	S	.	.	H	α-helix	trans	-61.2	-54	172.2	-69.4	-161.5	-72.6	0	0	111	V41 K42 P43 C48 S49 E50	V41-M46 HydrophobicContact CB-CG 4.07Å; V41-M46 HydrophobicContact CG1-CG 3.56Å; K42-M46 PolarHBondContact O-N 3.37Å; P43-M46 HydrophobicContact CB-CE 4.42Å; P43-M46 PolarHBondContact O-N 2.99Å; M46-C48 VanDerWaalsContact C-N 3.3Å; M46-C48 PolarHBondContact O-N 3.42Å; M46-S49 PolarHBondContact O-N 3.5Å; M46-S49 VanDerWaalsContact O-N 3.15Å; M46-E50 PolarHBondContact O-N 2.92Å
47	T	98.3	Very high	97.3	Very high	68 Å²	68	93.9 Å²	93.9	42%	0.417	47%	0.47	S	S	.	.	H	α-helix	trans	-60.9	-39.7	178.3	-57.5	0	0	0	0	111.8	P43 H51	P43-T47 PolarHBondContact O-N 2.74Å; P43-T47 PolarHBondContact O-OG1 3.47Å; T47-H51 WeakPolarHBondContact O-CB 3.45Å; T47-H51 PolarHBondContact O-N 2.92Å; T47-H51 VanDerWaalsContact O-N 3.09Å
48	C	98.4	Very high	97.3	Very high	50 Å²	50	94.9 Å²	94.9	34%	0.338	46%	0.464	S	S	.	.	H	α-helix	trans	-59.7	-48.1	174.2	-177.9	0	0	0	0	111.6	C32 E44 E45 M46 E50 H51 C52	C32-C48 VanDerWaalsContact CA-SG 3.52Å; C32-C48 HydrophobicContact CB-CB 3.59Å; C32-C48 WeakPolarHBondContact CB-SG 3.37Å; C32-C48 WeakPolarHBondContact SG-CB 3.33Å; C32-C48 PolarHBondContact SG-O 3.32Å; C32-C48 VanDerWaalsContact SG-O 3.33Å; C32-C48 CovalentContact SG-SG 2.05Å; C32-C48 PolarHBondContact SG-SG 3.4Å; E44-C48 VanDerWaalsContact O-CB 3.3Å; E44-C48 WeakPolarHBondContact O-CB 3.36Å; E44-C48 PolarHBondContact O-N 3.23Å; E45-C48 PolarHBondContact O-N 3.34Å; M46-C48 VanDerWaalsContact C-N 3.3Å; M46-C48 PolarHBondContact O-N 3.42Å; C48-E50 PolarHBondContact O-N 3.29Å; C48-H51 PolarHBondContact O-N 3.07Å; C48-C52 WeakPolarHBondContact O-CB 3.45Å; C48-C52 PolarHBondContact O-N 3.31Å
49	S	97.9	Very high	97.5	Very high	35 Å²	35	96.5 Å²	96.5	25%	0.245	47%	0.467	C	S	.	.	H	α-helix	trans	-64.4	-40.3	-176.9	-58.5	0	0	0	0	112.1	C32 E45 M46 C52 L53	C32-S49 PolarHBondContact SG-N 2.83Å; C32-S49 VanDerWaalsContact SG-N 3.45Å; E45-S49 WeakPolarHBondContact O-CB 3.33Å; E45-S49 PolarHBondContact O-N 3.45Å; E45-S49 PolarHBondContact O-OG 3.19Å; M46-S49 PolarHBondContact O-N 3.5Å; M46-S49 VanDerWaalsContact O-N 3.15Å; S49-C52 WeakPolarHBondContact O-CB 3.29Å; S49-C52 PolarHBondContact O-N 2.91Å; S49-L53 PolarHBondContact O-N 2.91Å
50	E	98.1	Very high	97.5	Very high	124 Å²	124	87 Å²	87	58%	0.579	44%	0.438	S	S	*	.	H	α-helix	trans	-62.7	-46	174.3	-72.9	179.9	176	0	0	112.1	M46 C48 L53 Q54	M46-E50 PolarHBondContact O-N 2.92Å; C48-E50 PolarHBondContact O-N 3.29Å; E50-L53 PolarHBondContact O-N 3.01Å; E50-Q54 WeakPolarHBondContact O-CG 3.47Å; E50-Q54 PolarHBondContact O-N 3.41Å
51	H	98.4	Very high	97.5	Very high	113 Å²	113	85.4 Å²	85.4	52%	0.523	43%	0.431	S	S	.	.	H	α-helix	trans	-66.3	-37.4	176.2	-70.3	166.7	0	0	0	112.2	T47 C48 Q54 K55	T47-H51 WeakPolarHBondContact O-CB 3.45Å; T47-H51 PolarHBondContact O-N 2.92Å; T47-H51 VanDerWaalsContact O-N 3.09Å; C48-H51 PolarHBondContact O-N 3.07Å; H51-Q54 PolarHBondContact O-N 3.46Å; H51-K55 WeakPolarHBondContact O-CB 3.09Å; H51-K55 PolarHBondContact O-N 3.34Å
52	C	98.4	Very high	97.6	Very high	21 Å²	21	89.8 Å²	89.8	14%	0.142	44%	0.438	C	S	.	.	H	α-helix	trans	-58.5	-50.6	174.7	173.1	0	0	0	0	110.8	C28 C48 S49 Q54 K55 Y56	C28-C52 WeakPolarHBondContact CA-SG 3.47Å; C28-C52 HydrophobicContact CB-CB 3.82Å; C28-C52 WeakPolarHBondContact CB-SG 3.29Å; C28-C52 WeakPolarHBondContact SG-CB 3.35Å; C28-C52 CovalentContact SG-SG 2.05Å; C28-C52 PolarHBondContact SG-SG 3.4Å; C48-C52 WeakPolarHBondContact O-CB 3.45Å; C48-C52 PolarHBondContact O-N 3.31Å; S49-C52 WeakPolarHBondContact O-CB 3.29Å; S49-C52 PolarHBondContact O-N 2.91Å; C52-Q54 PolarHBondContact O-N 3.34Å; C52-K55 PolarHBondContact O-N 2.98Å; C52-Y56 VanDerWaalsContact O-CB 3.28Å; C52-Y56 WeakPolarHBondContact O-CB 3.48Å; C52-Y56 PolarHBondContact O-N 2.88Å
53	L	97.5	Very high	97.7	Very high	79 Å²	79	91 Å²	91	41%	0.414	45%	0.448	S	S	.	.	H	α-helix	trans	-54.8	-54.4	175.4	170.2	58.4	0	0	0	111.6	L24 S49 E50 K55 Y56 L57	L24-L53 HydrophobicContact CD2-CD1 3.28Å; L24-L53 HydrophobicContact CG-CD1 4.1Å; S49-L53 PolarHBondContact O-N 2.91Å; E50-L53 PolarHBondContact O-N 3.01Å; L53-K55 VanDerWaalsContact C-N 3.34Å; L53-K55 PolarHBondContact O-N 3.12Å; L53-Y56 PolarHBondContact O-N 3.15Å; L53-L57 HydrophobicContact CD1-CD1 3.78Å; L53-L57 HydrophobicContact CD1-CG 4.11Å; L53-L57 HydrophobicContact CG-CD1 4.34Å; L53-L57 WeakPolarHBondContact O-CG 3.36Å; L53-L57 PolarHBondContact O-N 3.1Å
54	Q	97.8	Very high	97.6	Very high	107 Å²	107	89.3 Å²	89.3	50%	0.5	44%	0.437	S	S	.	.	H	α-helix	trans	-61.3	-42.6	-179.1	-71.8	-171.9	-9.2	0	0	112.4	E50 H51 C52 K58	E50-Q54 WeakPolarHBondContact O-CG 3.47Å; E50-Q54 PolarHBondContact O-N 3.41Å; H51-Q54 PolarHBondContact O-N 3.46Å; C52-Q54 PolarHBondContact O-N 3.34Å; Q54-K58 WeakPolarHBondContact O-CB 3.05Å; Q54-K58 VanDerWaalsContact O-CG 3.32Å; Q54-K58 WeakPolarHBondContact O-CG 3.42Å; Q54-K58 PolarHBondContact O-N 3.43Å; Q54-K58 VanDerWaalsContact O-N 3.08Å
55	K	98.3	Very high	97.6	Very high	161 Å²	161	87.1 Å²	87.1	70%	0.7	43%	0.428	S	S	*	.	H	α-helix	trans	-65.1	-44.8	179.3	-175.8	179.1	178.3	-174.1	0	110.9	H51 C52 L53 L57 K58 M59	H51-K55 WeakPolarHBondContact O-CB 3.09Å; H51-K55 PolarHBondContact O-N 3.34Å; C52-K55 PolarHBondContact O-N 2.98Å; L53-K55 VanDerWaalsContact C-N 3.34Å; L53-K55 PolarHBondContact O-N 3.12Å; K55-L57 PolarHBondContact O-N 3.34Å; K55-K58 PolarHBondContact O-N 3.35Å; K55-M59 WeakPolarHBondContact O-CB 3.28Å; K55-M59 PolarHBondContact O-N 2.89Å
56	Y	97.8	Very high	97.6	Very high	53 Å²	53	93.3 Å²	93.3	21%	0.208	45%	0.452	C	S	.	.	H	α-helix	trans	-61.1	-45.2	179	-175.2	-87.6	0	0	0	111.9	T20 L24 C52 L53 M59 T60	T20-Y56 HydrophobicContact CG2-CE1 4.46Å; L24-Y56 HydrophobicContact CB-CE1 4.43Å; L24-Y56 HydrophobicContact CD1-CD1 3.52Å; L24-Y56 HydrophobicContact CD1-CD2 3.92Å; L24-Y56 HydrophobicContact CD1-CE1 4.16Å; L24-Y56 HydrophobicContact CD1-CG 3.38Å; L24-Y56 HydrophobicContact CD2-CD1 3.93Å; L24-Y56 HydrophobicContact CD2-CE1 4.42Å; L24-Y56 HydrophobicContact CG-CD1 4.21Å; C52-Y56 VanDerWaalsContact O-CB 3.28Å; C52-Y56 WeakPolarHBondContact O-CB 3.48Å; C52-Y56 PolarHBondContact O-N 2.88Å; L53-Y56 PolarHBondContact O-N 3.15Å; Y56-M59 HydrophobicContact CD2-CE 3.91Å; Y56-M59 HydrophobicContact CE2-CE 4.13Å; Y56-M59 HydrophobicContact CG-CE 4.48Å; Y56-M59 PolarHBondContact O-N 2.74Å; Y56-T60 WeakPolarHBondContact O-CB 3.33Å; Y56-T60 PolarHBondContact O-N 2.95Å; Y56-T60 PolarHBondContact O-OG1 3.46Å
57	L	96.6	Very high	97.6	Very high	79 Å²	79	94.5 Å²	94.5	41%	0.414	45%	0.454	S	S	.	.	H	α-helix	trans	-64.3	-47.4	178.5	-67.3	175.9	0	0	0	111.7	L24 L53 K55 M59 T60 Q61	L24-L57 HydrophobicContact CD2-CD2 4.32Å; L53-L57 HydrophobicContact CD1-CD1 3.78Å; L53-L57 HydrophobicContact CD1-CG 4.11Å; L53-L57 HydrophobicContact CG-CD1 4.34Å; L53-L57 WeakPolarHBondContact O-CG 3.36Å; L53-L57 PolarHBondContact O-N 3.1Å; K55-L57 PolarHBondContact O-N 3.34Å; L57-M59 VanDerWaalsContact C-N 3.32Å; L57-M59 PolarHBondContact O-N 3.22Å; L57-T60 PolarHBondContact O-N 2.05Å; L57-Q61 WeakPolarHBondContact O-CG 3.06Å; L57-Q61 PolarHBondContact O-N 3.19Å
58	K	98.1	Very high	97.5	Very high	138 Å²	138	96.7 Å²	96.7	60%	0.6	46%	0.46	S	S	*	.	H	α-helix	trans	-61.8	-41.1	176.6	-72.7	175	-178.5	174.3	0	111.8	Q54 K55 R62	Q54-K58 WeakPolarHBondContact O-CB 3.05Å; Q54-K58 VanDerWaalsContact O-CG 3.32Å; Q54-K58 WeakPolarHBondContact O-CG 3.42Å; Q54-K58 PolarHBondContact O-N 3.43Å; Q54-K58 VanDerWaalsContact O-N 3.08Å; K55-K58 PolarHBondContact O-N 3.35Å; K58-R62 WeakPolarHBondContact O-CB 3.32Å; K58-R62 PolarHBondContact O-N 2.84Å
59	M	97.6	Very high	97.4	Very high	87 Å²	87	97.9 Å²	97.9	43%	0.429	46%	0.46	S	S	.	.	H	α-helix	trans	-61.5	-50	175.6	178.2	-166.3	73.8	0	0	110.9	K55 Y56 L57 Q61 R62 I63	K55-M59 WeakPolarHBondContact O-CB 3.28Å; K55-M59 PolarHBondContact O-N 2.89Å; Y56-M59 HydrophobicContact CD2-CE 3.91Å; Y56-M59 HydrophobicContact CE2-CE 4.13Å; Y56-M59 HydrophobicContact CG-CE 4.48Å; Y56-M59 PolarHBondContact O-N 2.74Å; L57-M59 VanDerWaalsContact C-N 3.32Å; L57-M59 PolarHBondContact O-N 3.22Å; M59-Q61 VanDerWaalsContact C-N 3.34Å; M59-Q61 PolarHBondContact O-N 3.45Å; M59-R62 PolarHBondContact O-N 3.33Å; M59-R62 VanDerWaalsContact O-N 3.13Å; M59-I63 HydrophobicContact CE-CD1 4.35Å; M59-I63 HydrophobicContact CG-CD1 3.71Å; M59-I63 HydrophobicContact CG-CG1 4.37Å; M59-I63 WeakPolarHBondContact O-CG1 3.37Å; M59-I63 PolarHBondContact O-N 2.05Å; M59-I63 HydrophobicContact SD-CD1 4.29Å
60	T	96.2	Very high	97.3	Very high	60 Å²	60	103 Å²	103	37%	0.368	48%	0.476	S	S	.	.	H	α-helix	trans	-60.1	-43.4	-179.7	-58	0	0	0	0	111.4	Y56 L57 R62 I63 S64	Y56-T60 WeakPolarHBondContact O-CB 3.33Å; Y56-T60 PolarHBondContact O-N 2.95Å; Y56-T60 PolarHBondContact O-OG1 3.46Å; L57-T60 PolarHBondContact O-N 2.05Å; T60-R62 PolarHBondContact O-N 2.93Å; T60-I63 PolarHBondContact O-N 3.43Å; T60-S64 WeakPolarHBondContact O-CB 3.48Å; T60-S64 PolarHBondContact O-N 3.48Å
61	Q	96.7	Very high	97.1	Very high	128 Å²	128	100.4 Å²	100.4	60%	0.598	46%	0.463	S	S	*	.	H	α-helix	trans	-60.9	-44.8	174.2	-71.6	173.3	29.5	0	0	111.9	L57 M59 S64 M65	L57-Q61 WeakPolarHBondContact O-CG 3.06Å; L57-Q61 PolarHBondContact O-N 3.19Å; M59-Q61 VanDerWaalsContact C-N 3.34Å; M59-Q61 PolarHBondContact O-N 3.45Å; Q61-S64 PolarHBondContact O-N 3.36Å; Q61-M65 PolarHBondContact O-N 3.33Å
62	R	97.8	Very high	96.9	Very high	174 Å²	174	99.4 Å²	99.4	66%	0.657	46%	0.461	S	S	*	.	H	α-helix	trans	-64.4	-42.2	178.8	-172.5	174.8	-178.2	174.2	1	112.4	K58 M59 T60 M65 R66	K58-R62 WeakPolarHBondContact O-CB 3.32Å; K58-R62 PolarHBondContact O-N 2.84Å; M59-R62 PolarHBondContact O-N 3.33Å; M59-R62 VanDerWaalsContact O-N 3.13Å; T60-R62 PolarHBondContact O-N 2.93Å; R62-M65 HydrophobicContact CB-CE 4.38Å; R62-M65 PolarHBondContact O-N 3.4Å; R62-R66 WeakPolarHBondContact O-CG 3.47Å; R62-R66 PolarHBondContact O-N 3.43Å
63	I	97.7	Very high	96.6	Very high	101 Å²	101	104.2 Å²	104.2	52%	0.518	48%	0.481	S	S	.	.	H	α-helix	trans	-61.1	-47.4	175.4	-69.6	168.7	0	0	0	109.8	M59 T60 M65 R66 F67	M59-I63 HydrophobicContact CE-CD1 4.35Å; M59-I63 HydrophobicContact CG-CD1 3.71Å; M59-I63 HydrophobicContact CG-CG1 4.37Å; M59-I63 WeakPolarHBondContact O-CG1 3.37Å; M59-I63 PolarHBondContact O-N 2.05Å; M59-I63 HydrophobicContact SD-CD1 4.29Å; T60-I63 PolarHBondContact O-N 3.43Å; I63-M65 VanDerWaalsContact C-N 3.34Å; I63-M65 PolarHBondContact O-N 2.99Å; I63-R66 PolarHBondContact O-N 2.83Å; I63-F67 WeakPolarHBondContact O-CB 3.39Å; I63-F67 PolarHBondContact O-N 3.19Å
64	S	96.2	Very high	96.4	Very high	54 Å²	54	104.6 Å²	104.6	38%	0.378	48%	0.481	S	S	.	.	H	α-helix	trans	-56.9	-45.2	178.4	-173.5	0	0	0	0	112.2	T60 Q61 R66 F67 Q68	T60-S64 WeakPolarHBondContact O-CB 3.48Å; T60-S64 PolarHBondContact O-N 3.48Å; Q61-S64 PolarHBondContact O-N 3.36Å; S64-R66 PolarHBondContact O-N 2.79Å; S64-F67 PolarHBondContact O-N 3.3Å; S64-Q68 WeakPolarHBondContact O-CG 3.47Å; S64-Q68 PolarHBondContact O-N 3.48Å
65	M	97.1	Very high	96	Very high	95 Å²	95	104.1 Å²	104.1	47%	0.468	48%	0.482	S	S	.	.	H	α-helix	trans	-58	-48.4	175.7	-73.7	-173	-72.4	0	0	112.4	Q61 R62 I63 F67 Q68 E69	Q61-M65 PolarHBondContact O-N 3.33Å; R62-M65 HydrophobicContact CB-CE 4.38Å; R62-M65 PolarHBondContact O-N 3.4Å; I63-M65 VanDerWaalsContact C-N 3.34Å; I63-M65 PolarHBondContact O-N 2.99Å; M65-F67 VanDerWaalsContact C-N 3.31Å; M65-F67 PolarHBondContact O-N 3.04Å; M65-Q68 PolarHBondContact O-N 2.91Å; M65-E69 WeakPolarHBondContact O-CG 3.32Å; M65-E69 PolarHBondContact O-N 2.84Å
66	R	98	Very high	95.6	Very high	135 Å²	135	102 Å²	102	51%	0.509	47%	0.474	S	S	.	.	H	α-helix	trans	-67	-35.5	-179.5	-61.1	-62	135.5	-174.1	-0.8	112.3	R62 I63 S64 E69 Y70	R62-R66 WeakPolarHBondContact O-CG 3.47Å; R62-R66 PolarHBondContact O-N 3.43Å; I63-R66 PolarHBondContact O-N 2.83Å; S64-R66 PolarHBondContact O-N 2.79Å; R66-E69 WeakPolarHBondContact CD-OE2 3.44Å; R66-E69 IonicContact CZ-OE1 3.33Å; R66-E69 IonicContact CZ-OE2 2.77Å; R66-E69 IonicContact NE-OE1 3.71Å; R66-E69 IonicContact NE-OE2 3.6Å; R66-E69 IonicContact NH1-OE1 3.1Å; R66-E69 PolarHBondContact NH1-OE1 3.34Å; R66-E69 IonicContact NH1-OE2 2.85Å; R66-E69 PolarHBondContact NH1-OE2 3.39Å; R66-E69 IonicContact NH2-OE1 2.68Å; R66-E69 PolarHBondContact NH2-OE1 3.05Å; R66-E69 PolarHBondContact O-N 3.06Å; R66-Y70 PolarHBondContact O-N 2.96Å
67	F	97	Very high	95.1	Very high	123 Å²	123	102 Å²	102	54%	0.539	49%	0.486	S	S	.	.	H	α-helix	trans	-65.3	-42.9	175.7	-175.6	-106.9	0	0	0	111.8	I63 S64 M65 Y70 H71	I63-F67 WeakPolarHBondContact O-CB 3.39Å; I63-F67 PolarHBondContact O-N 3.19Å; S64-F67 PolarHBondContact O-N 3.3Å; M65-F67 VanDerWaalsContact C-N 3.31Å; M65-F67 PolarHBondContact O-N 3.04Å; F67-Y70 PolarHBondContact O-N 2.95Å; F67-H71 AromaticContact CD1-CD2 3.66Å; F67-H71 AromaticContact CE1-CD2 3.3Å; F67-H71 WeakPolarHBondContact CE1-CD2 3.26Å; F67-H71 AromaticContact CE1-NE2 3.26Å; F67-H71 VanDerWaalsContact CE1-NE2 3.26Å; F67-H71 WeakPolarHBondContact CE1-NE2 3.4Å; F67-H71 AromaticContact CE2-CD2 3.82Å; F67-H71 AromaticContact CE2-NE2 3.44Å; F67-H71 WeakPolarHBondContact CE2-NE2 3.42Å; F67-H71 AromaticContact CZ-CD2 3.41Å; F67-H71 VanDerWaalsContact CZ-CD2 3.41Å; F67-H71 WeakPolarHBondContact CZ-CD2 3.45Å; F67-H71 AromaticContact CZ-NE2 2.9Å; F67-H71 WeakPolarHBondContact CZ-NE2 3.31Å; F67-H71 PolarHBondContact O-CD2 2.95Å; F67-H71 PolarHBondContact O-N 3.06Å
68	Q	96.1	Very high	94.7	Very high	114 Å²	114	103 Å²	103	53%	0.533	49%	0.49	S	S	.	.	H	α-helix	trans	-63.3	-45.1	174.3	-72.9	175.7	-8.1	0	0	112	S64 M65 Y70 H71 I72	S64-Q68 WeakPolarHBondContact O-CG 3.47Å; S64-Q68 PolarHBondContact O-N 3.48Å; M65-Q68 PolarHBondContact O-N 2.91Å; Q68-Y70 VanDerWaalsContact C-N 3.29Å; Q68-Y70 PolarHBondContact O-N 3.45Å; Q68-H71 PolarHBondContact O-N 3.42Å; Q68-I72 WeakPolarHBondContact O-CG1 3.43Å; Q68-I72 PolarHBondContact O-N 3.01Å
69	E	95.3	Very high	94.2	Very high	74 Å²	74	97.8 Å²	97.8	35%	0.346	47%	0.473	S	S	.	.	H	α-helix	trans	-54.8	-46.1	174.7	-73.9	170.9	-171.2	0	0	111.5	M65 R66 I72 Q73	M65-E69 WeakPolarHBondContact O-CG 3.32Å; M65-E69 PolarHBondContact O-N 2.84Å; R66-E69 WeakPolarHBondContact CD-OE2 3.44Å; R66-E69 IonicContact CZ-OE1 3.33Å; R66-E69 IonicContact CZ-OE2 2.77Å; R66-E69 IonicContact NE-OE1 3.71Å; R66-E69 IonicContact NE-OE2 3.6Å; R66-E69 IonicContact NH1-OE1 3.1Å; R66-E69 PolarHBondContact NH1-OE1 3.34Å; R66-E69 IonicContact NH1-OE2 2.85Å; R66-E69 PolarHBondContact NH1-OE2 3.39Å; R66-E69 IonicContact NH2-OE1 2.68Å; R66-E69 PolarHBondContact NH2-OE1 3.05Å; R66-E69 PolarHBondContact O-N 3.06Å; E69-I72 PolarHBondContact O-N 3.4Å; E69-Q73 WeakPolarHBondContact O-CG 3.02Å; E69-Q73 PolarHBondContact O-N 3.41Å; E69-Q73 VanDerWaalsContact O-N 3.1Å
70	Y	96.2	Very high	93.7	Very high	144 Å²	144	96.1 Å²	96.1	57%	0.565	47%	0.473	S	S	*	.	H	α-helix	trans	-62.9	-44.3	178	-179.2	-100.2	0	0	0	112.6	R66 F67 Q68 I72 Q73 Q74	R66-Y70 PolarHBondContact O-N 2.96Å; F67-Y70 PolarHBondContact O-N 2.95Å; Q68-Y70 VanDerWaalsContact C-N 3.29Å; Q68-Y70 PolarHBondContact O-N 3.45Å; Y70-I72 VanDerWaalsContact C-N 3.34Å; Y70-I72 PolarHBondContact O-N 2.81Å; Y70-Q73 PolarHBondContact O-N 3Å; Y70-Q74 PolarHBondContact O-N 3.41Å
71	H	93.9	Very high	93.2	Very high	69 Å²	69	102 Å²	102	32%	0.319	49%	0.494	S	S	.	.	H	α-helix	trans	-62.8	-38.9	177	-91	-65.4	0	0	0	113.1	F67 Q68 Q74 N75	F67-H71 AromaticContact CD1-CD2 3.66Å; F67-H71 AromaticContact CE1-CD2 3.3Å; F67-H71 WeakPolarHBondContact CE1-CD2 3.26Å; F67-H71 AromaticContact CE1-NE2 3.26Å; F67-H71 VanDerWaalsContact CE1-NE2 3.26Å; F67-H71 WeakPolarHBondContact CE1-NE2 3.4Å; F67-H71 AromaticContact CE2-CD2 3.82Å; F67-H71 AromaticContact CE2-NE2 3.44Å; F67-H71 WeakPolarHBondContact CE2-NE2 3.42Å; F67-H71 AromaticContact CZ-CD2 3.41Å; F67-H71 VanDerWaalsContact CZ-CD2 3.41Å; F67-H71 WeakPolarHBondContact CZ-CD2 3.45Å; F67-H71 AromaticContact CZ-NE2 2.9Å; F67-H71 WeakPolarHBondContact CZ-NE2 3.31Å; F67-H71 PolarHBondContact O-CD2 2.95Å; F67-H71 PolarHBondContact O-N 3.06Å; Q68-H71 PolarHBondContact O-N 3.42Å; H71-Q74 PolarHBondContact O-N 2.98Å; H71-N75 WeakPolarHBondContact O-CB 3.2Å; H71-N75 VanDerWaalsContact O-CG 3.27Å; H71-N75 PolarHBondContact O-N 3.13Å
72	I	94.5	Very high	92.7	Very high	92 Å²	92	99.1 Å²	99.1	47%	0.472	49%	0.492	S	S	.	.	H	α-helix	trans	-63.2	-48.5	176.4	-68.9	165.5	0	0	0	110.1	Q68 E69 Y70 Q74 N75 E76	Q68-I72 WeakPolarHBondContact O-CG1 3.43Å; Q68-I72 PolarHBondContact O-N 3.01Å; E69-I72 PolarHBondContact O-N 3.4Å; Y70-I72 VanDerWaalsContact C-N 3.34Å; Y70-I72 PolarHBondContact O-N 2.81Å; I72-Q74 VanDerWaalsContact C-N 3.29Å; I72-Q74 PolarHBondContact O-N 3.02Å; I72-N75 PolarHBondContact O-N 3.34Å; I72-N75 VanDerWaalsContact O-N 3.11Å; I72-E76 HydrophobicContact CG2-CG 4.31Å; I72-E76 WeakPolarHBondContact O-CG 3.49Å; I72-E76 PolarHBondContact O-N 2.71Å
73	Q	92.9	Very high	91.5	Very high	121 Å²	121	93.7 Å²	93.7	57%	0.565	49%	0.49	S	S	*	.	H	α-helix	trans	-58.7	-41.2	178.4	-70.5	173.4	19.4	0	0	112.3	E69 Y70 E76 A77	E69-Q73 WeakPolarHBondContact O-CG 3.02Å; E69-Q73 PolarHBondContact O-N 3.41Å; E69-Q73 VanDerWaalsContact O-N 3.1Å; Y70-Q73 PolarHBondContact O-N 3Å; Q73-E76 PolarHBondContact O-N 2.98Å; Q73-A77 WeakPolarHBondContact O-CB 3.46Å; Q73-A77 PolarHBondContact O-N 2.98Å
74	Q	92.7	Very high	90.2	Very high	88 Å²	88	95.5 Å²	95.5	41%	0.411	50%	0.5	S	S	.	.	H	α-helix	trans	-63.6	-44.1	176.3	-170.9	-179.5	22.8	0	0	111.4	Y70 H71 I72 A77 L78	Y70-Q74 PolarHBondContact O-N 3.41Å; H71-Q74 PolarHBondContact O-N 2.98Å; I72-Q74 VanDerWaalsContact C-N 3.29Å; I72-Q74 PolarHBondContact O-N 3.02Å; Q74-A77 PolarHBondContact O-N 2.91Å; Q74-L78 HydrophobicContact CG-CD1 4.27Å; Q74-L78 VanDerWaalsContact O-CG 3.26Å; Q74-L78 WeakPolarHBondContact O-CG 3.32Å; Q74-L78 PolarHBondContact O-N 3.49Å
75	N	90.3	Very high	88.5	Confident	97 Å²	97	98.2 Å²	98.2	52%	0.519	51%	0.51	S	S	.	.	H	α-helix	trans	-65.7	-40.1	178.5	-73.2	-10	0	0	0	112.3	H71 I72 L78 A79	H71-N75 WeakPolarHBondContact O-CB 3.2Å; H71-N75 VanDerWaalsContact O-CG 3.27Å; H71-N75 PolarHBondContact O-N 3.13Å; I72-N75 PolarHBondContact O-N 3.34Å; I72-N75 VanDerWaalsContact O-N 3.11Å; N75-L78 PolarHBondContact O-N 3.06Å; N75-A79 WeakPolarHBondContact O-CB 3.3Å; N75-A79 PolarHBondContact O-N 3.15Å
76	E	89.2	Confident	86.4	Confident	116 Å²	116	96.9 Å²	96.9	54%	0.542	52%	0.52	S	S	.	.	H	α-helix	trans	-61.5	-44.2	174.2	-73.6	175.9	174.2	0	0	111.4	I72 Q73 L78 A79 A80	I72-E76 HydrophobicContact CG2-CG 4.31Å; I72-E76 WeakPolarHBondContact O-CG 3.49Å; I72-E76 PolarHBondContact O-N 2.71Å; Q73-E76 PolarHBondContact O-N 2.98Å; E76-L78 VanDerWaalsContact C-N 3.32Å; E76-L78 PolarHBondContact O-N 2.96Å; E76-A79 PolarHBondContact O-N 3.28Å; E76-A80 WeakPolarHBondContact O-CB 3.26Å; E76-A80 PolarHBondContact O-N 3.37Å
77	A	87.8	Confident	83.9	Confident	54 Å²	54	98.9 Å²	98.9	45%	0.446	54%	0.535	S	S	.	.	H	α-helix	trans	-63.3	-37.5	175.8	0	0	0	0	0	112.3	Q73 Q74 K81	Q73-A77 WeakPolarHBondContact O-CB 3.46Å; Q73-A77 PolarHBondContact O-N 2.98Å; Q74-A77 PolarHBondContact O-N 2.91Å; A77-K81 WeakPolarHBondContact O-CG 3.26Å; A77-K81 PolarHBondContact O-N 3.01Å; A77-K81 VanDerWaalsContact O-N 3.12Å
78	L	88.3	Confident	82	Confident	98 Å²	98	98.8 Å²	98.8	51%	0.513	55%	0.547	S	S	.	.	H	α-helix	trans	-68	-42.4	174.2	-70.7	168.8	0	0	0	111.6	Q74 N75 E76 A80 K81 A82	Q74-L78 HydrophobicContact CG-CD1 4.27Å; Q74-L78 VanDerWaalsContact O-CG 3.26Å; Q74-L78 WeakPolarHBondContact O-CG 3.32Å; Q74-L78 PolarHBondContact O-N 3.49Å; N75-L78 PolarHBondContact O-N 3.06Å; E76-L78 VanDerWaalsContact C-N 3.32Å; E76-L78 PolarHBondContact O-N 2.96Å; L78-A80 VanDerWaalsContact C-N 3.35Å; L78-A80 PolarHBondContact O-N 3.09Å; L78-K81 PolarHBondContact O-N 2.55Å; L78-A82 WeakPolarHBondContact O-CB 3.49Å; L78-A82 PolarHBondContact O-N 2.91Å
79	A	87.9	Confident	79.6	Confident	29 Å²	29	108.2 Å²	108.2	24%	0.24	58%	0.578	C	S	.	*	H	α-helix	trans	-64.7	-38.1	176.9	0	0	0	0	0	112.2	N75 E76 A82 G83 L84 L85	N75-A79 WeakPolarHBondContact O-CB 3.3Å; N75-A79 PolarHBondContact O-N 3.15Å; E76-A79 PolarHBondContact O-N 3.28Å; A79-A82 PolarHBondContact O-N 2.59Å; A79-G83 PolarHBondContact O-N 3.16Å; A79-L84 PolarHBondContact O-N 3.46Å; A79-L84 VanDerWaalsContact O-N 3.12Å; A79-L85 HydrophobicContact CB-CG 4.45Å
80	A	86.9	Confident	78.9	Confident	52 Å²	52	110 Å²	110	43%	0.43	59%	0.59	S	S	.	*	H	α-helix	trans	-60.5	-48.3	172.5	0	0	0	0	0	111.3	E76 L78 A82 G83 L85	E76-A80 WeakPolarHBondContact O-CB 3.26Å; E76-A80 PolarHBondContact O-N 3.37Å; L78-A80 VanDerWaalsContact C-N 3.35Å; L78-A80 PolarHBondContact O-N 3.09Å; A80-A82 VanDerWaalsContact C-N 3.28Å; A80-A82 PolarHBondContact O-N 3.11Å; A80-G83 PolarHBondContact O-N 3.18Å; A80-G83 VanDerWaalsContact O-N 3.13Å; A80-L85 HydrophobicContact CB-CD1 3.73Å
81	K	84	Confident	77.9	Confident	184 Å²	184	108.2 Å²	108.2	80%	0.8	59%	0.591	S	S	*	*	H	α-helix	trans	-65.1	-30.8	177.3	-74.9	-176.9	179.5	-174.5	0	113.2	A77 L78 G83	A77-K81 WeakPolarHBondContact O-CG 3.26Å; A77-K81 PolarHBondContact O-N 3.01Å; A77-K81 VanDerWaalsContact O-N 3.12Å; L78-K81 PolarHBondContact O-N 2.55Å; K81-G83 PolarHBondContact O-N 3.02Å
82	A	86.2	Confident	77.1	Confident	67 Å²	67	110.3 Å²	110.3	55%	0.554	61%	0.606	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.3	-1.1	176.2	0	0	0	0	0	113.7	L78 A79 A80 L84	L78-A82 WeakPolarHBondContact O-CB 3.49Å; L78-A82 PolarHBondContact O-N 2.91Å; A79-A82 PolarHBondContact O-N 2.59Å; A80-A82 VanDerWaalsContact C-N 3.28Å; A80-A82 PolarHBondContact O-N 3.11Å; A82-L84 HydrophobicContact CB-CD1 3.99Å; A82-L84 HydrophobicContact CB-CG 4.17Å; A82-L84 PolarHBondContact O-N 2.95Å
83	G	74.1	Confident	76	Confident	61 Å²	61	111.4 Å²	111.4	63%	0.629	61%	0.614	S	S	*	*	T	Hydrogen-bonded Turn	trans	69.5	15.3	-179.5	0	0	0	0	0	114.3	A79 A80 K81	A79-G83 PolarHBondContact O-N 3.16Å; A80-G83 PolarHBondContact O-N 3.18Å; A80-G83 VanDerWaalsContact O-N 3.13Å; K81-G83 PolarHBondContact O-N 3.02Å
84	L	69	Low	75	Confident	139 Å²	139	110.8 Å²	110.8	73%	0.728	62%	0.617	S	S	*	*			trans	-84.2	-18.2	-179.2	-69.3	168	0	0	0	112.7	A79 A82 G86	A79-L84 PolarHBondContact O-N 3.46Å; A79-L84 VanDerWaalsContact O-N 3.12Å; A82-L84 HydrophobicContact CB-CD1 3.99Å; A82-L84 HydrophobicContact CB-CG 4.17Å; A82-L84 PolarHBondContact O-N 2.95Å; L84-G86 PolarHBondContact O-N 3.41Å
85	L	60.5	Low	73.8	Confident	111 Å²	111	112.3 Å²	112.3	58%	0.581	63%	0.631	S	S	*	*	S	Bend	trans	-80.3	94.8	166.4	-66.3	177.8	0	0	0	108	A79 A80 Q87	A79-L85 HydrophobicContact CB-CG 4.45Å; A80-L85 HydrophobicContact CB-CD1 3.73Å; L85-Q87 PolarHBondContact O-N 2.96Å
86	G	53.4	Low	72.6	Confident	66 Å²	66	113.4 Å²	113.4	68%	0.68	64%	0.639	S	S	*	*	P	Polyproline II helix	trans	-50.2	129.1	-177.6	0	0	0	0	0	112.3	L84	L84-G86 PolarHBondContact O-N 3.41Å
87	Q	46	Very low	71.3	Confident	177 Å²	177	113.2 Å²	113.2	83%	0.827	65%	0.646	S	S	*	*	P	Polyproline II helix	trans	-47.4	123	166.3	-171.4	166.7	50.6	0	0	109.3	L85 R89	L85-Q87 PolarHBondContact O-N 2.96Å; Q87-R89 PolarHBondContact O-N 3.14Å; Q87-R89 VanDerWaalsContact O-N 3.12Å
88	P	56.4	Low	70	Confident	122 Å²	122	118.2 Å²	118.2	79%	0.792	66%	0.663	S	S	*	*	P	Polyproline II helix	trans	-64	118.7	169.6	26.2	-29.4	0	0	0	106.6
89	R	47	Very low	68.3	Low	312 Å²	312	120 Å²	120	100%	1.177	68%	0.676	S	S	*	*			trans	-78.9	0	154.9	-83.8	-160.9	171.1	132.7	0.3	108.6	Q87	Q87-R89 PolarHBondContact O-N 3.14Å; Q87-R89 VanDerWaalsContact O-N 3.12Å

Retrieved 89 of 89 residues in 357.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).