A0A093HBB6_STRCA Loading...

Small nuclear ribonucleoprotein E

Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs. As part of the U7 snRNP it is involved in histone 3'-end processing.

AlphaFold DB , UniProt , Accession A0A093HBB6, Species STRCA (Struthio camelus australis), Gene n/a, Length 65 aa.

						>A0A093HBB6_STRCA|A0A093HBB6
RSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	R	71.9	Confident	92.2	Very high	219 Å²	219	84 Å²	84	83%	0.826	38%	0.376	S	S	*	.				0	128.6	0	-77.3	179.8	174.6	-171.9	-4.8	106.9	R3 D32	R1-R3 PolarHBondContact O-N 2.71Å; R1-D32 IonicContact NH1-OD2 3.7Å; R1-D32 PolarHBondContact NH1-OD2 3.37Å; R1-D32 VanDerWaalsContact NH1-OD2 3.16Å
2	S	86.1	Confident	92.1	Very high	97 Å²	97	84.9 Å²	84.9	68%	0.678	39%	0.393	S	S	*	.			trans	-76	123.2	179.1	-55.4	0	0	0	0	109.2
3	R	94	Very high	92.3	Very high	56 Å²	56	84.2 Å²	84.2	21%	0.211	39%	0.394	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.6	139.3	173.9	-158.3	172.7	-152.3	-148.6	11.4	108.9	R1 E17 G18 D33 E35 R44 V63	R1-R3 PolarHBondContact O-N 2.71Å; R3-E17 IonicContact CZ-OE2 3.21Å; R3-E17 IonicContact NH1-OE2 2.76Å; R3-E17 PolarHBondContact NH1-OE2 3.5Å; R3-G18 WeakPolarHBondContact CG-O 3.35Å; R3-D33 PolarHBondContact NH2-O 2.85Å; R3-E35 IonicContact CZ-OE2 2.79Å; R3-E35 IonicContact NH1-OE2 3.16Å; R3-E35 PolarHBondContact NH1-OE2 2.93Å; R3-E35 IonicContact NH2-OE2 3.16Å; R3-E35 PolarHBondContact NH2-OE2 3.05Å; R3-R44 VanDerWaalsContact NH1-NH2 3.14Å; R3-V63 HydrophobicContact CB-CG2 4.47Å; R3-V63 PolarHBondContact O-N 3.14Å
4	I	96.4	Very high	92.5	Very high	20 Å²	20	81.2 Å²	81.2	10%	0.103	38%	0.38	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.1	153.8	174.5	59	147.9	0	0	0	110.2	V6 E17 G18 I20 L29 L31 L60 Q61	I4-V6 HydrophobicContact CD1-CG2 3.75Å; I4-E17 CarbonylContact O-C 3.5Å; I4-E17 WeakPolarHBondContact O-CA 3.15Å; I4-G18 WeakPolarHBondContact CG1-O 3.42Å; I4-G18 PolarHBondContact N-O 2.79Å; I4-G18 PolarHBondContact O-N 2.89Å; I4-I20 HydrophobicContact CD1-CD1 3.65Å; I4-I20 HydrophobicContact CD1-CG1 3.5Å; I4-I20 HydrophobicContact CG1-CD1 4.27Å; I4-I20 HydrophobicContact CG1-CG1 3.86Å; I4-I20 HydrophobicContact CG2-CD1 4.43Å; I4-L29 HydrophobicContact CD1-CD1 4.43Å; I4-L31 HydrophobicContact CD1-CD2 4.1Å; I4-L31 HydrophobicContact CG1-CD2 4.44Å; I4-L60 HydrophobicContact CD1-CD2 3.87Å; I4-Q61 CarbonylContact C-O 3.52Å; I4-Q61 VanDerWaalsContact CA-O 3.26Å; I4-Q61 WeakPolarHBondContact CA-O 3.41Å
5	Q	96.7	Very high	92.7	Very high	36 Å²	36	76.9 Å²	76.9	17%	0.168	36%	0.359	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.4	126.2	166.4	-172.2	179.9	98.6	0	0	108.9	W7 R15 I16 E17 Q61 V63	Q5-W7 VanDerWaalsContact OE1-NE1 3.07Å; Q5-R15 HydrophobicContact CG-CB 3.78Å; Q5-R15 HydrophobicContact CG-CG 4.23Å; Q5-I16 CarbonylContact C-O 3.58Å; Q5-I16 WeakPolarHBondContact CA-O 3.26Å; Q5-E17 HydrophobicContact CB-CG 3.88Å; Q5-E17 HydrophobicContact CG-CG 3.85Å; Q5-E17 PolarHBondContact NE2-OE1 2.89Å; Q5-Q61 PolarHBondContact N-O 2.83Å; Q5-Q61 PolarHBondContact O-N 3.29Å; Q5-V63 HydrophobicContact CB-CG2 3.87Å
6	V	97.1	Very high	93	Very high	0 Å²	0	72.6 Å²	72.6	0%	0	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.2	126.4	177.9	-170.4	0	0	0	0	109	I4 L8 R15 I16 L31 L52 I57 L59 L60	I4-V6 HydrophobicContact CD1-CG2 3.75Å; V6-L8 HydrophobicContact CG1-CD2 4.32Å; V6-R15 WeakPolarHBondContact O-CA 3.3Å; V6-I16 HydrophobicContact CB-CB 4.26Å; V6-I16 PolarHBondContact N-O 2.76Å; V6-I16 PolarHBondContact O-N 2.95Å; V6-I16 VanDerWaalsContact O-N 3.08Å; V6-L31 HydrophobicContact CG2-CD1 4.13Å; V6-L52 HydrophobicContact CB-CD1 4.22Å; V6-L52 HydrophobicContact CG1-CD1 4.07Å; V6-L52 HydrophobicContact CG2-CD1 3.96Å; V6-I57 HydrophobicContact CG1-CB 4.43Å; V6-I57 HydrophobicContact CG1-CD1 4.48Å; V6-I57 HydrophobicContact CG1-CG1 4Å; V6-I57 HydrophobicContact CG1-CG2 3.97Å; V6-L59 WeakPolarHBondContact CA-O 3.5Å; V6-L60 HydrophobicContact CB-CD2 4.19Å; V6-L60 HydrophobicContact CG1-CD2 3.94Å; V6-L60 HydrophobicContact CG2-CD2 3.68Å
7	W	96.8	Very high	93.3	Very high	91 Å²	91	69.1 Å²	69.1	35%	0.345	32%	0.323	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.2	128.7	172.1	-69.1	41.7	0	0	0	108.3	Q5 R15 T58 L59	Q5-W7 VanDerWaalsContact OE1-NE1 3.07Å; W7-R15 VanDerWaalsContact CD2-NE 3.34Å; W7-R15 VanDerWaalsContact CD2-NH2 3.27Å; W7-T58 PolarHBondContact O-N 2.92Å; W7-L59 HydrophobicContact CB-CB 3.93Å; W7-L59 HydrophobicContact CD2-CD2 4.34Å; W7-L59 HydrophobicContact CG-CB 4.07Å; W7-L59 HydrophobicContact CG-CD2 4.08Å; W7-L59 PolarHBondContact N-O 3.22Å
8	L	96.2	Very high	93.5	Very high	23 Å²	23	65.2 Å²	65.2	12%	0.12	31%	0.305	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.8	144.7	-176.9	-59.1	174.3	0	0	0	111	V6 Q11 M14 I16 N56	V6-L8 HydrophobicContact CG1-CD2 4.32Å; L8-Q11 HydrophobicContact CB-CB 3.88Å; L8-Q11 HydrophobicContact CD1-CB 4.35Å; L8-M14 HydrophobicContact CD1-CE 3.26Å; L8-I16 HydrophobicContact CD1-CG1 4.13Å; L8-I16 HydrophobicContact CD2-CG1 4.45Å; L8-N56 CarbonylContact C-O 3.59Å; L8-N56 VanDerWaalsContact CA-O 3.29Å; L8-N56 WeakPolarHBondContact CA-O 3.24Å
9	Y	94.3	Very high	93.6	Very high	133 Å²	133	62.5 Å²	62.5	52%	0.522	29%	0.294	S	S	.	.	S	Bend	trans	-62.2	134.5	171.9	-177.3	-103.7	0	0	0	109.9	Q11 N56 T58	Y9-Q11 PolarHBondContact O-N 3.08Å; Y9-N56 PolarHBondContact N-O 2.89Å; Y9-T58 VanDerWaalsContact CA-OG1 3.32Å; Y9-T58 WeakPolarHBondContact CA-OG1 3.47Å; Y9-T58 PolarHBondContact N-OG1 2.85Å
10	E	92.9	Very high	93.8	Very high	143 Å²	143	63 Å²	63	67%	0.668	30%	0.297	S	S	*	.	S	Bend	trans	59.1	-22.2	-175.4	-70.7	175.5	-175	0	0	117	V12	E10-V12 PolarHBondContact O-N 3.06Å; E10-V12 VanDerWaalsContact O-N 3.14Å
11	Q	91.8	Very high	94	Very high	106 Å²	106	63.4 Å²	63.4	50%	0.495	30%	0.301	S	S	.	.			trans	-89.7	68.6	179.7	-124.1	70.2	5.2	0	0	112.5	L8 Y9 N13 M14	L8-Q11 HydrophobicContact CB-CB 3.88Å; L8-Q11 HydrophobicContact CD1-CB 4.35Å; Y9-Q11 PolarHBondContact O-N 3.08Å; Q11-N13 VanDerWaalsContact C-N 3.29Å; Q11-N13 PolarHBondContact O-N 3.42Å; Q11-M14 HydrophobicContact CB-CE 4.48Å; Q11-M14 HydrophobicContact CG-CB 4.26Å; Q11-M14 HydrophobicContact CG-CE 3.97Å; Q11-M14 PolarHBondContact O-N 2.87Å
12	V	91.4	Very high	95.2	Very high	95 Å²	95	54.1 Å²	54.1	58%	0.576	27%	0.273	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.6	-24.3	-175.5	-66.3	0	0	0	0	115.1	E10 M14 R15	E10-V12 PolarHBondContact O-N 3.06Å; E10-V12 VanDerWaalsContact O-N 3.14Å; V12-M14 VanDerWaalsContact C-N 3.33Å; V12-R15 PolarHBondContact O-NH2 3.21Å
13	N	93.6	Very high	95.7	Very high	76 Å²	76	57.1 Å²	57.1	41%	0.406	27%	0.274	S	S	.	.	T	Hydrogen-bonded Turn	trans	-87	-6.2	-176.9	-64.4	-53.3	0	0	0	113.4	Q11 H38 S39 K40	Q11-N13 VanDerWaalsContact C-N 3.29Å; Q11-N13 PolarHBondContact O-N 3.42Å; N13-H38 CarbonylContact O-C 3.53Å; N13-H38 WeakPolarHBondContact O-CA 3.46Å; N13-S39 PolarHBondContact O-N 2.72Å; N13-K40 WeakPolarHBondContact OD1-CE 3.21Å
14	M	95.4	Very high	95.8	Very high	42 Å²	42	57 Å²	57	21%	0.207	28%	0.278	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128	139.9	-172.1	-173	174	84	0	0	110.1	L8 Q11 V12 E36 I37	L8-M14 HydrophobicContact CD1-CE 3.26Å; Q11-M14 HydrophobicContact CB-CE 4.48Å; Q11-M14 HydrophobicContact CG-CB 4.26Å; Q11-M14 HydrophobicContact CG-CE 3.97Å; Q11-M14 PolarHBondContact O-N 2.87Å; V12-M14 VanDerWaalsContact C-N 3.33Å; M14-E36 HydrophobicContact CG-CG 3.62Å; M14-E36 VanDerWaalsContact SD-CD 3.52Å; M14-E36 HydrophobicContact SD-CG 3.63Å; M14-I37 CarbonylContact C-O 3.57Å; M14-I37 WeakPolarHBondContact CA-O 3.41Å
15	R	96.4	Very high	95.9	Very high	17 Å²	17	64 Å²	64	6%	0.064	31%	0.31	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.5	150.1	175.4	-56.8	-64.2	176.1	-137.6	6	108.7	Q5 V6 W7 V12 I37	Q5-R15 HydrophobicContact CG-CB 3.78Å; Q5-R15 HydrophobicContact CG-CG 4.23Å; V6-R15 WeakPolarHBondContact O-CA 3.3Å; W7-R15 VanDerWaalsContact CD2-NE 3.34Å; W7-R15 VanDerWaalsContact CD2-NH2 3.27Å; V12-R15 PolarHBondContact O-NH2 3.21Å; R15-I37 HydrophobicContact CB-CB 4.5Å; R15-I37 PolarHBondContact N-O 2.78Å; R15-I37 PolarHBondContact O-N 2.81Å
16	I	97.3	Very high	95.9	Very high	8 Å²	8	69.9 Å²	69.9	4%	0.041	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.3	128.7	170.8	-57.9	-60.7	0	0	0	107.8	Q5 V6 L8 L31 A34 E35 E36 L47 I50 L52	Q5-I16 CarbonylContact C-O 3.58Å; Q5-I16 WeakPolarHBondContact CA-O 3.26Å; V6-I16 HydrophobicContact CB-CB 4.26Å; V6-I16 PolarHBondContact N-O 2.76Å; V6-I16 PolarHBondContact O-N 2.95Å; V6-I16 VanDerWaalsContact O-N 3.08Å; L8-I16 HydrophobicContact CD1-CG1 4.13Å; L8-I16 HydrophobicContact CD2-CG1 4.45Å; I16-L31 HydrophobicContact CG2-CD1 3.68Å; I16-A34 HydrophobicContact CG2-CB 4.5Å; I16-E35 CarbonylContact C-O 3.57Å; I16-E35 WeakPolarHBondContact CA-O 3.19Å; I16-E36 HydrophobicContact CD1-CB 4.16Å; I16-E36 HydrophobicContact CD1-CG 4.25Å; I16-L47 HydrophobicContact CD1-CD1 4Å; I16-I50 HydrophobicContact CG2-CD1 3.94Å; I16-L52 HydrophobicContact CB-CD1 4.3Å; I16-L52 HydrophobicContact CG1-CD2 4.42Å; I16-L52 HydrophobicContact CG2-CD1 4.15Å
17	E	97.1	Very high	95.8	Very high	12 Å²	12	74.8 Å²	74.8	6%	0.056	36%	0.356	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.4	143.7	170	-71.2	-173.8	-179.3	0	0	110.7	R3 I4 Q5 A34 E35 I37 R44	R3-E17 IonicContact CZ-OE2 3.21Å; R3-E17 IonicContact NH1-OE2 2.76Å; R3-E17 PolarHBondContact NH1-OE2 3.5Å; I4-E17 CarbonylContact O-C 3.5Å; I4-E17 WeakPolarHBondContact O-CA 3.15Å; Q5-E17 HydrophobicContact CB-CG 3.88Å; Q5-E17 HydrophobicContact CG-CG 3.85Å; Q5-E17 PolarHBondContact NE2-OE1 2.89Å; E17-A34 CarbonylContact O-C 3.6Å; E17-A34 WeakPolarHBondContact O-CA 3.28Å; E17-E35 PolarHBondContact N-O 3.35Å; E17-E35 PolarHBondContact O-N 2.75Å; E17-I37 HydrophobicContact CB-CD1 4.34Å; E17-I37 HydrophobicContact CG-CD1 3.81Å; E17-I37 HydrophobicContact CG-CG1 4.33Å; E17-I37 WeakPolarHBondContact OE1-CD1 3.44Å; E17-I37 VanDerWaalsContact OE2-CD1 3.28Å; E17-I37 WeakPolarHBondContact OE2-CD1 3.31Å; E17-R44 IonicContact OE2-CZ 3.97Å; E17-R44 IonicContact OE2-NH2 2.75Å; E17-R44 PolarHBondContact OE2-NH2 2.89Å
18	G	96.7	Very high	95.9	Very high	0 Å²	0	72 Å²	72	0%	0	35%	0.348	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-177.9	177.1	179	0	0	0	0	0	112.7	R3 I4	R3-G18 WeakPolarHBondContact CG-O 3.35Å; I4-G18 WeakPolarHBondContact CG1-O 3.42Å; I4-G18 PolarHBondContact N-O 2.79Å; I4-G18 PolarHBondContact O-N 2.89Å
19	C	96.9	Very high	95.9	Very high	14 Å²	14	71.1 Å²	71.1	10%	0.095	34%	0.343	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.5	124	172.2	-66	0	0	0	0	109.5	I21 L31 D32	C19-I21 PolarHBondContact O-N 2.82Å; C19-L31 CarbonylContact O-C 3.6Å; C19-L31 WeakPolarHBondContact O-CA 3.18Å; C19-D32 PolarHBondContact N-O 2.87Å; C19-D32 PolarHBondContact O-N 2.87Å
20	I	96.5	Very high	96.1	Very high	71 Å²	71	67 Å²	67	36%	0.364	33%	0.332	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-65.7	128.2	174	-52.4	175.8	0	0	0	109.1	I4 L31	I4-I20 HydrophobicContact CD1-CD1 3.65Å; I4-I20 HydrophobicContact CD1-CG1 3.5Å; I4-I20 HydrophobicContact CG1-CD1 4.27Å; I4-I20 HydrophobicContact CG1-CG1 3.86Å; I4-I20 HydrophobicContact CG2-CD1 4.43Å; I20-L31 HydrophobicContact CB-CD2 4.39Å; I20-L31 HydrophobicContact CG1-CD2 3.85Å
21	I	97.4	Very high	96.3	Very high	72 Å²	72	60.2 Å²	60.2	37%	0.369	30%	0.3	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119	-10.1	172.7	58.9	167.1	0	0	0	113.2	C19 V30 D32 R49	C19-I21 PolarHBondContact O-N 2.82Å; I21-V30 HydrophobicContact CD1-CB 4.49Å; I21-V30 HydrophobicContact CD1-CG1 3.65Å; I21-V30 HydrophobicContact CG1-CB 3.91Å; I21-V30 HydrophobicContact CG1-CG1 3.58Å; I21-V30 WeakPolarHBondContact CG1-O 3.49Å; I21-V30 PolarHBondContact N-O 3.3Å; I21-D32 HydrophobicContact CD1-CB 4.15Å; I21-D32 HydrophobicContact CG1-CB 4.43Å; I21-D32 HydrophobicContact CG2-CB 3.72Å; I21-R49 HydrophobicContact CD1-CG 4.35Å
22	G	97.1	Very high	96.6	Very high	24 Å²	24	56.1 Å²	56.1	25%	0.247	28%	0.282	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-167.3	154.5	174.2	0	0	0	0	0	111.6	V30	G22-V30 PolarHBondContact O-N 3.16Å
23	F	97.4	Very high	96.8	Very high	160 Å²	160	56 Å²	56	70%	0.702	28%	0.278	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-150.1	163.3	174	67.4	-85.4	0	0	0	110.4	N28 L29	F23-N28 VanDerWaalsContact CA-O 3.23Å; F23-N28 WeakPolarHBondContact CA-O 3.43Å; F23-L29 HydrophobicContact CB-CD2 3.63Å
24	D	97.3	Very high	97	Very high	55 Å²	55	52.4 Å²	52.4	29%	0.294	26%	0.259	S	S	.	.			trans	-130.3	-178.6	175.8	68.4	15.3	0	0	0	112.5	Y26 M27 N28	D24-Y26 PolarHBondContact O-N 2.86Å; D24-Y26 WeakPolarHBondContact OD1-CA 3.38Å; D24-Y26 WeakPolarHBondContact OD1-CB 3.45Å; D24-Y26 PolarHBondContact OD1-N 2.79Å; D24-M27 PolarHBondContact O-N 3.26Å; D24-M27 VanDerWaalsContact O-N 3.14Å; D24-M27 PolarHBondContact OD1-N 2.82Å; D24-M27 VanDerWaalsContact OD1-N 3.13Å; D24-N28 PolarHBondContact N-O 2.86Å; D24-N28 WeakPolarHBondContact OD1-CB 3.43Å; D24-N28 PolarHBondContact OD1-N 2.86Å; D24-N28 PolarHBondContact OD1-ND2 3.48Å; D24-N28 WeakPolarHBondContact OD2-CB 3.19Å; D24-N28 PolarHBondContact OD2-ND2 3.43Å
25	E	97.5	Very high	97.1	Very high	165 Å²	165	51.2 Å²	51.2	77%	0.771	25%	0.253	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.2	-18.7	179.5	67.9	-173	139.2	0	0	114.1	M27	E25-M27 VanDerWaalsContact C-N 3.29Å
26	Y	96.1	Very high	97.1	Very high	160 Å²	160	51.9 Å²	51.9	63%	0.627	26%	0.257	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.3	6.8	177.2	-55.1	-68.2	0	0	0	112.2	D24 N28	D24-Y26 PolarHBondContact O-N 2.86Å; D24-Y26 WeakPolarHBondContact OD1-CA 3.38Å; D24-Y26 WeakPolarHBondContact OD1-CB 3.45Å; D24-Y26 PolarHBondContact OD1-N 2.79Å; Y26-N28 PolarHBondContact O-N 2.86Å
27	M	96.5	Very high	97	Very high	103 Å²	103	52.4 Å²	52.4	51%	0.507	26%	0.259	S	S	.	.			trans	62.1	22	-176.6	-58.2	-71.1	-69.3	0	0	113.4	D24 E25 L29 G54 I57	D24-M27 PolarHBondContact O-N 3.26Å; D24-M27 VanDerWaalsContact O-N 3.14Å; D24-M27 PolarHBondContact OD1-N 2.82Å; D24-M27 VanDerWaalsContact OD1-N 3.13Å; E25-M27 VanDerWaalsContact C-N 3.29Å; M27-L29 PolarHBondContact O-N 3.03Å; M27-G54 VanDerWaalsContact O-CA 3.24Å; M27-G54 WeakPolarHBondContact O-CA 3.46Å; M27-I57 WeakPolarHBondContact O-CD1 2.95Å
28	N	97.1	Very high	96.9	Very high	32 Å²	32	55 Å²	55	17%	0.171	27%	0.271	C	S	.	.			trans	-67.1	135.8	166.7	-57.8	-48.9	0	0	0	108.4	F23 D24 Y26 M51 L52 K53 G54	F23-N28 VanDerWaalsContact CA-O 3.23Å; F23-N28 WeakPolarHBondContact CA-O 3.43Å; D24-N28 PolarHBondContact N-O 2.86Å; D24-N28 WeakPolarHBondContact OD1-CB 3.43Å; D24-N28 PolarHBondContact OD1-N 2.86Å; D24-N28 PolarHBondContact OD1-ND2 3.48Å; D24-N28 WeakPolarHBondContact OD2-CB 3.19Å; D24-N28 PolarHBondContact OD2-ND2 3.43Å; Y26-N28 PolarHBondContact O-N 2.86Å; N28-M51 HydrophobicContact CB-CE 3.59Å; N28-L52 CarbonylContact C-O 3.46Å; N28-L52 VanDerWaalsContact CA-O 3.24Å; N28-L52 WeakPolarHBondContact CA-O 3.45Å; N28-K53 VanDerWaalsContact OD1-CA 3.26Å; N28-K53 WeakPolarHBondContact OD1-CA 3.35Å; N28-G54 PolarHBondContact OD1-N 3.16Å
29	L	97.4	Very high	96.5	Very high	5 Å²	5	57 Å²	57	3%	0.026	29%	0.286	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.7	134.8	-177.1	-59	-177.1	0	0	0	110.6	I4 F23 M27 L31 M51 L52 I57 L60	I4-L29 HydrophobicContact CD1-CD1 4.43Å; F23-L29 HydrophobicContact CB-CD2 3.63Å; M27-L29 PolarHBondContact O-N 3.03Å; L29-L31 HydrophobicContact CB-CD2 4.36Å; L29-M51 CarbonylContact O-C 3.58Å; L29-M51 VanDerWaalsContact O-CA 3.29Å; L29-M51 WeakPolarHBondContact O-CA 3.39Å; L29-L52 PolarHBondContact N-O 3.46Å; L29-L52 PolarHBondContact O-N 3.46Å; L29-I57 HydrophobicContact CD1-CD1 3.62Å; L29-I57 HydrophobicContact CG-CD1 3.74Å; L29-L60 HydrophobicContact CD1-CD1 4.11Å; L29-L60 HydrophobicContact CD1-CD2 3.77Å
30	V	97.8	Very high	96.2	Very high	47 Å²	47	64.2 Å²	64.2	29%	0.285	32%	0.315	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.6	119.7	164.8	-171.4	0	0	0	0	108.1	I21 G22 R49 I50	I21-V30 HydrophobicContact CD1-CB 4.49Å; I21-V30 HydrophobicContact CD1-CG1 3.65Å; I21-V30 HydrophobicContact CG1-CB 3.91Å; I21-V30 HydrophobicContact CG1-CG1 3.58Å; I21-V30 WeakPolarHBondContact CG1-O 3.49Å; I21-V30 PolarHBondContact N-O 3.3Å; G22-V30 PolarHBondContact O-N 3.16Å; V30-R49 HydrophobicContact CG1-CG 4.29Å; V30-I50 WeakPolarHBondContact CA-O 3.26Å
31	L	97.6	Very high	96	Very high	0 Å²	0	65.5 Å²	65.5	0%	0	33%	0.326	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.5	134.5	178.7	-58.3	-176.8	0	0	0	110.6	I4 V6 I16 C19 I20 L29 A34 R49 I50 L52	I4-L31 HydrophobicContact CD1-CD2 4.1Å; I4-L31 HydrophobicContact CG1-CD2 4.44Å; V6-L31 HydrophobicContact CG2-CD1 4.13Å; I16-L31 HydrophobicContact CG2-CD1 3.68Å; C19-L31 CarbonylContact O-C 3.6Å; C19-L31 WeakPolarHBondContact O-CA 3.18Å; I20-L31 HydrophobicContact CB-CD2 4.39Å; I20-L31 HydrophobicContact CG1-CD2 3.85Å; L29-L31 HydrophobicContact CB-CD2 4.36Å; L31-A34 HydrophobicContact CB-CB 4.1Å; L31-R49 VanDerWaalsContact O-CA 3.31Å; L31-R49 WeakPolarHBondContact O-CA 3.23Å; L31-I50 HydrophobicContact CB-CG1 4.12Å; L31-I50 PolarHBondContact N-O 2.8Å; L31-I50 PolarHBondContact O-N 2.93Å; L31-L52 HydrophobicContact CD1-CD1 3.56Å; L31-L52 HydrophobicContact CD1-CG 4.33Å; L31-L52 HydrophobicContact CG-CD1 4.37Å
32	D	97.6	Very high	95.6	Very high	21 Å²	21	69.4 Å²	69.4	11%	0.112	34%	0.341	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.8	153.7	169.1	-141.8	24	0	0	0	109.7	R1 C19 I21 A34 R49	R1-D32 IonicContact NH1-OD2 3.7Å; R1-D32 PolarHBondContact NH1-OD2 3.37Å; R1-D32 VanDerWaalsContact NH1-OD2 3.16Å; C19-D32 PolarHBondContact N-O 2.87Å; C19-D32 PolarHBondContact O-N 2.87Å; I21-D32 HydrophobicContact CD1-CB 4.15Å; I21-D32 HydrophobicContact CG1-CB 4.43Å; I21-D32 HydrophobicContact CG2-CB 3.72Å; D32-A34 PolarHBondContact O-N 3.21Å; D32-R49 VanDerWaalsContact CG-NH2 3.33Å; D32-R49 IonicContact OD1-CZ 3.31Å; D32-R49 VanDerWaalsContact OD1-CZ 3.31Å; D32-R49 IonicContact OD1-NE 2.87Å; D32-R49 PolarHBondContact OD1-NE 2.91Å; D32-R49 IonicContact OD1-NH2 2.89Å; D32-R49 PolarHBondContact OD1-NH2 3.34Å; D32-R49 IonicContact OD2-NH2 3.86Å; D32-R49 PolarHBondContact OD2-NH2 3.49Å; D32-R49 VanDerWaalsContact OD2-NH2 3.16Å
33	D	96.3	Very high	95.5	Very high	92 Å²	92	71 Å²	71	49%	0.492	35%	0.348	S	S	.	.	E	Extended strand (participates in β ladder)	trans	49	41.7	-177.5	-55.5	-44	0	0	0	112.9	R3	R3-D33 PolarHBondContact NH2-O 2.85Å
34	A	97.5	Very high	95.4	Very high	0 Å²	0	70 Å²	70	0%	0	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.2	139.4	-173.7	0	0	0	0	0	111.9	I16 E17 L31 D32 L47 G48 I50	I16-A34 HydrophobicContact CG2-CB 4.5Å; E17-A34 CarbonylContact O-C 3.6Å; E17-A34 WeakPolarHBondContact O-CA 3.28Å; L31-A34 HydrophobicContact CB-CB 4.1Å; D32-A34 PolarHBondContact O-N 3.21Å; A34-L47 HydrophobicContact CB-CB 4.34Å; A34-L47 WeakPolarHBondContact O-CB 3.16Å; A34-L47 PolarHBondContact O-N 2.9Å; A34-G48 WeakPolarHBondContact CB-O 3.32Å; A34-G48 PolarHBondContact N-O 3.25Å; A34-G48 PolarHBondContact O-N 2.91Å; A34-I50 HydrophobicContact CB-CD1 3.66Å; A34-I50 HydrophobicContact CB-CG1 3.69Å
35	E	97.6	Very high	95.4	Very high	18 Å²	18	73.3 Å²	73.3	8%	0.084	35%	0.351	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.8	140.6	175.4	-70.8	179.1	123	0	0	110.8	R3 I16 E17 R44 K45 Q46	R3-E35 IonicContact CZ-OE2 2.79Å; R3-E35 IonicContact NH1-OE2 3.16Å; R3-E35 PolarHBondContact NH1-OE2 2.93Å; R3-E35 IonicContact NH2-OE2 3.16Å; R3-E35 PolarHBondContact NH2-OE2 3.05Å; I16-E35 CarbonylContact C-O 3.57Å; I16-E35 WeakPolarHBondContact CA-O 3.19Å; E17-E35 PolarHBondContact N-O 3.35Å; E17-E35 PolarHBondContact O-N 2.75Å; E35-R44 IonicContact OE2-CZ 3.48Å; E35-R44 IonicContact OE2-NE 3.37Å; E35-R44 PolarHBondContact OE2-NE 2.89Å; E35-R44 IonicContact OE2-NH2 2.87Å; E35-K45 CarbonylContact C-O 3.53Å; E35-K45 VanDerWaalsContact CA-O 3.26Å; E35-K45 WeakPolarHBondContact CA-O 3.29Å; E35-Q46 VanDerWaalsContact CG-CD 3.47Å; E35-Q46 HydrophobicContact CG-CG 4.3Å; E35-Q46 VanDerWaalsContact CG-NE2 3.29Å; E35-Q46 PolarHBondContact OE1-NE2 2.85Å
36	E	96.3	Very high	95.4	Very high	31 Å²	31	71.2 Å²	71.2	15%	0.145	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.3	126.5	165.4	-171.6	-173.8	163.5	0	0	109.3	M14 I16 H38 R44 K45 L47	M14-E36 HydrophobicContact CG-CG 3.62Å; M14-E36 VanDerWaalsContact SD-CD 3.52Å; M14-E36 HydrophobicContact SD-CG 3.63Å; I16-E36 HydrophobicContact CD1-CB 4.16Å; I16-E36 HydrophobicContact CD1-CG 4.25Å; E36-H38 IonicContact OE1-CE1 2.95Å; E36-H38 PolarHBondContact OE1-CE1 2.99Å; E36-H38 IonicContact OE1-ND1 3.84Å; E36-H38 IonicContact OE1-NE2 3.59Å; E36-R44 CarbonylContact O-C 3.49Å; E36-R44 VanDerWaalsContact O-CA 3.3Å; E36-R44 WeakPolarHBondContact O-CA 3.24Å; E36-K45 HydrophobicContact CB-CB 4.27Å; E36-K45 PolarHBondContact N-O 2.86Å; E36-K45 PolarHBondContact O-N 2.79Å; E36-L47 HydrophobicContact CB-CD1 4.15Å; E36-L47 HydrophobicContact CB-CG 4.46Å
37	I	95.7	Very high	95.5	Very high	19 Å²	19	66.7 Å²	66.7	10%	0.097	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.6	121.7	178.1	-54.5	-157.8	0	0	0	109.5	M14 R15 E17 R44	M14-I37 CarbonylContact C-O 3.57Å; M14-I37 WeakPolarHBondContact CA-O 3.41Å; R15-I37 HydrophobicContact CB-CB 4.5Å; R15-I37 PolarHBondContact N-O 2.78Å; R15-I37 PolarHBondContact O-N 2.81Å; E17-I37 HydrophobicContact CB-CD1 4.34Å; E17-I37 HydrophobicContact CG-CD1 3.81Å; E17-I37 HydrophobicContact CG-CG1 4.33Å; E17-I37 WeakPolarHBondContact OE1-CD1 3.44Å; E17-I37 VanDerWaalsContact OE2-CD1 3.28Å; E17-I37 WeakPolarHBondContact OE2-CD1 3.31Å; I37-R44 HydrophobicContact CD1-CG 4.2Å; I37-R44 VanDerWaalsContact CD1-NE 3.25Å; I37-R44 HydrophobicContact CG1-CG 4.21Å
38	H	94.9	Very high	95.5	Very high	65 Å²	65	63.1 Å²	63.1	30%	0.301	32%	0.318	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.2	118	172.6	-72.6	72.5	0	0	0	110.2	N13 E36 K40 T41 K42 S43	N13-H38 CarbonylContact O-C 3.53Å; N13-H38 WeakPolarHBondContact O-CA 3.46Å; E36-H38 IonicContact OE1-CE1 2.95Å; E36-H38 PolarHBondContact OE1-CE1 2.99Å; E36-H38 IonicContact OE1-ND1 3.84Å; E36-H38 IonicContact OE1-NE2 3.59Å; H38-K40 VanDerWaalsContact C-N 3.27Å; H38-K40 PolarHBondContact O-N 2.89Å; H38-T41 WeakPolarHBondContact CB-OG1 3.37Å; H38-K42 WeakPolarHBondContact O-CA 3.26Å; H38-K42 PolarHBondContact O-N 3.08Å; H38-S43 WeakPolarHBondContact CB-OG 3.47Å; H38-S43 PolarHBondContact N-O 2.76Å; H38-S43 VanDerWaalsContact N-O 3.08Å
39	S	88.5	Confident	95.5	Very high	44 Å²	44	69.4 Å²	69.4	31%	0.308	34%	0.339	S	S	.	.	T	Hydrogen-bonded Turn	trans	-60.6	-34	-173.1	-61.9	0	0	0	0	113.5	N13 K42	N13-S39 PolarHBondContact O-N 2.72Å; S39-K42 WeakPolarHBondContact O-CE 3.29Å; S39-K42 PolarHBondContact O-NZ 3.33Å
40	K	90	Very high	95.6	Very high	165 Å²	165	71 Å²	71	72%	0.717	35%	0.347	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.6	-50.8	-176.1	-68.1	-177.8	176.1	174.5	0	113.2	N13 H38	N13-K40 WeakPolarHBondContact OD1-CE 3.21Å; H38-K40 VanDerWaalsContact C-N 3.27Å; H38-K40 PolarHBondContact O-N 2.89Å
41	T	92.8	Very high	95.5	Very high	97 Å²	97	74.6 Å²	74.6	60%	0.595	36%	0.363	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.1	-13.6	-176.4	53.8	0	0	0	0	112.6	H38 S43	H38-T41 WeakPolarHBondContact CB-OG1 3.37Å; T41-S43 PolarHBondContact O-N 3.26Å; T41-S43 PolarHBondContact OG1-N 3.14Å; T41-S43 PolarHBondContact OG1-OG 2.89Å
42	K	88.4	Confident	95.5	Very high	155 Å²	155	75.8 Å²	75.8	67%	0.674	37%	0.369	S	S	*	.			trans	56	16.6	-170.4	-55.2	-61.4	-174.6	-174.8	0	113.4	H38 S39 R44	H38-K42 WeakPolarHBondContact O-CA 3.26Å; H38-K42 PolarHBondContact O-N 3.08Å; S39-K42 WeakPolarHBondContact O-CE 3.29Å; S39-K42 PolarHBondContact O-NZ 3.33Å; K42-R44 PolarHBondContact O-N 3.46Å
43	S	94.9	Very high	95.5	Very high	57 Å²	57	81.2 Å²	81.2	40%	0.399	39%	0.391	S	S	.	.			trans	-70.2	132.7	176.4	57	0	0	0	0	109.8	H38 T41	H38-S43 WeakPolarHBondContact CB-OG 3.47Å; H38-S43 PolarHBondContact N-O 2.76Å; H38-S43 VanDerWaalsContact N-O 3.08Å; T41-S43 PolarHBondContact O-N 3.26Å; T41-S43 PolarHBondContact OG1-N 3.14Å; T41-S43 PolarHBondContact OG1-OG 2.89Å
44	R	95.9	Very high	95.5	Very high	138 Å²	138	77.4 Å²	77.4	52%	0.521	37%	0.374	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.9	133.3	174.4	-60.1	-176.5	114.9	164.7	5.7	109.5	R3 E17 E35 E36 I37 K42	R3-R44 VanDerWaalsContact NH1-NH2 3.14Å; E17-R44 IonicContact OE2-CZ 3.97Å; E17-R44 IonicContact OE2-NH2 2.75Å; E17-R44 PolarHBondContact OE2-NH2 2.89Å; E35-R44 IonicContact OE2-CZ 3.48Å; E35-R44 IonicContact OE2-NE 3.37Å; E35-R44 PolarHBondContact OE2-NE 2.89Å; E35-R44 IonicContact OE2-NH2 2.87Å; E36-R44 CarbonylContact O-C 3.49Å; E36-R44 VanDerWaalsContact O-CA 3.3Å; E36-R44 WeakPolarHBondContact O-CA 3.24Å; I37-R44 HydrophobicContact CD1-CG 4.2Å; I37-R44 VanDerWaalsContact CD1-NE 3.25Å; I37-R44 HydrophobicContact CG1-CG 4.21Å; K42-R44 PolarHBondContact O-N 3.46Å
45	K	97.1	Very high	95.5	Very high	126 Å²	126	82.9 Å²	82.9	55%	0.548	40%	0.403	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.9	123.1	174.4	179.2	-174.9	174	-168.5	0	109.2	E35 E36	E35-K45 CarbonylContact C-O 3.53Å; E35-K45 VanDerWaalsContact CA-O 3.26Å; E35-K45 WeakPolarHBondContact CA-O 3.29Å; E36-K45 HydrophobicContact CB-CB 4.27Å; E36-K45 PolarHBondContact N-O 2.86Å; E36-K45 PolarHBondContact O-N 2.79Å
46	Q	97.4	Very high	95.4	Very high	121 Å²	121	85.4 Å²	85.4	57%	0.565	42%	0.417	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-70.7	131.7	177.9	-71.7	-74.9	-13.8	0	0	110.5	E35	E35-Q46 VanDerWaalsContact CG-CD 3.47Å; E35-Q46 HydrophobicContact CG-CG 4.3Å; E35-Q46 VanDerWaalsContact CG-NE2 3.29Å; E35-Q46 PolarHBondContact OE1-NE2 2.85Å
47	L	97.5	Very high	95.4	Very high	64 Å²	64	85.5 Å²	85.5	34%	0.335	42%	0.418	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.1	-23.3	177.7	-58.2	178	0	0	0	111.9	I16 A34 E36 I50	I16-L47 HydrophobicContact CD1-CD1 4Å; A34-L47 HydrophobicContact CB-CB 4.34Å; A34-L47 WeakPolarHBondContact O-CB 3.16Å; A34-L47 PolarHBondContact O-N 2.9Å; E36-L47 HydrophobicContact CB-CD1 4.15Å; E36-L47 HydrophobicContact CB-CG 4.46Å; L47-I50 HydrophobicContact CB-CG2 3.88Å; L47-I50 HydrophobicContact CD1-CD1 3.95Å
48	G	97.4	Very high	95.4	Very high	29 Å²	29	88.8 Å²	88.8	30%	0.299	44%	0.439	S	S	.	.	E	Extended strand (participates in β ladder)	trans	77.3	-131.5	-177	0	0	0	0	0	111.5	A34	A34-G48 WeakPolarHBondContact CB-O 3.32Å; A34-G48 PolarHBondContact N-O 3.25Å; A34-G48 PolarHBondContact O-N 2.91Å
49	R	97.8	Very high	95.5	Very high	163 Å²	163	89.4 Å²	89.4	62%	0.615	44%	0.444	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-91.9	122.2	179.8	-175.1	171.5	-65.7	176.8	0.3	111.1	I21 V30 L31 D32	I21-R49 HydrophobicContact CD1-CG 4.35Å; V30-R49 HydrophobicContact CG1-CG 4.29Å; L31-R49 VanDerWaalsContact O-CA 3.31Å; L31-R49 WeakPolarHBondContact O-CA 3.23Å; D32-R49 VanDerWaalsContact CG-NH2 3.33Å; D32-R49 IonicContact OD1-CZ 3.31Å; D32-R49 VanDerWaalsContact OD1-CZ 3.31Å; D32-R49 IonicContact OD1-NE 2.87Å; D32-R49 PolarHBondContact OD1-NE 2.91Å; D32-R49 IonicContact OD1-NH2 2.89Å; D32-R49 PolarHBondContact OD1-NH2 3.34Å; D32-R49 IonicContact OD2-NH2 3.86Å; D32-R49 PolarHBondContact OD2-NH2 3.49Å; D32-R49 VanDerWaalsContact OD2-NH2 3.16Å
50	I	97.9	Very high	95.9	Very high	40 Å²	40	90.7 Å²	90.7	21%	0.205	45%	0.447	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.4	160.4	-177.1	65.2	174.4	0	0	0	111.8	I16 V30 L31 A34 L47 L52	I16-I50 HydrophobicContact CG2-CD1 3.94Å; V30-I50 WeakPolarHBondContact CA-O 3.26Å; L31-I50 HydrophobicContact CB-CG1 4.12Å; L31-I50 PolarHBondContact N-O 2.8Å; L31-I50 PolarHBondContact O-N 2.93Å; A34-I50 HydrophobicContact CB-CD1 3.66Å; A34-I50 HydrophobicContact CB-CG1 3.69Å; L47-I50 HydrophobicContact CB-CG2 3.88Å; L47-I50 HydrophobicContact CD1-CD1 3.95Å; I50-L52 HydrophobicContact CD1-CD2 4.24Å; I50-L52 HydrophobicContact CD1-CG 4.35Å
51	M	97.3	Very high	96.1	Very high	122 Å²	122	87.3 Å²	87.3	60%	0.601	43%	0.434	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-112	125.7	167.9	-175.8	-178.8	-179.8	0	0	109	N28 L29	N28-M51 HydrophobicContact CB-CE 3.59Å; L29-M51 CarbonylContact O-C 3.58Å; L29-M51 VanDerWaalsContact O-CA 3.29Å; L29-M51 WeakPolarHBondContact O-CA 3.39Å
52	L	96.9	Very high	96.2	Very high	24 Å²	24	86.5 Å²	86.5	13%	0.126	43%	0.432	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.3	135	171.6	-68.8	176.6	0	0	0	109.4	V6 I16 N28 L29 L31 I50 I57	V6-L52 HydrophobicContact CB-CD1 4.22Å; V6-L52 HydrophobicContact CG1-CD1 4.07Å; V6-L52 HydrophobicContact CG2-CD1 3.96Å; I16-L52 HydrophobicContact CB-CD1 4.3Å; I16-L52 HydrophobicContact CG1-CD2 4.42Å; I16-L52 HydrophobicContact CG2-CD1 4.15Å; N28-L52 CarbonylContact C-O 3.46Å; N28-L52 VanDerWaalsContact CA-O 3.24Å; N28-L52 WeakPolarHBondContact CA-O 3.45Å; L29-L52 PolarHBondContact N-O 3.46Å; L29-L52 PolarHBondContact O-N 3.46Å; L31-L52 HydrophobicContact CD1-CD1 3.56Å; L31-L52 HydrophobicContact CD1-CG 4.33Å; L31-L52 HydrophobicContact CG-CD1 4.37Å; I50-L52 HydrophobicContact CD1-CD2 4.24Å; I50-L52 HydrophobicContact CD1-CG 4.35Å; L52-I57 HydrophobicContact CB-CD1 4.4Å
53	K	97.3	Very high	96.3	Very high	135 Å²	135	81.2 Å²	81.2	59%	0.587	41%	0.413	S	S	*	.			trans	-79	136.1	173.6	-63.4	-174.1	174.2	-174.6	0	110.5	N28 D55 N56	N28-K53 VanDerWaalsContact OD1-CA 3.26Å; N28-K53 WeakPolarHBondContact OD1-CA 3.35Å; K53-D55 VanDerWaalsContact C-N 3.28Å; K53-D55 WeakPolarHBondContact CB-OD1 3.45Å; K53-D55 PolarHBondContact O-N 3.32Å; K53-N56 PolarHBondContact O-N 3.15Å; K53-N56 VanDerWaalsContact O-N 3.15Å
54	G	96.8	Very high	95.4	Very high	12 Å²	12	83.7 Å²	83.7	12%	0.124	43%	0.43	C	S	.	.	G	3₁₀ helix	trans	-63.6	-30	-174.1	0	0	0	0	0	114.5	M27 N28 N56 I57	M27-G54 VanDerWaalsContact O-CA 3.24Å; M27-G54 WeakPolarHBondContact O-CA 3.46Å; N28-G54 PolarHBondContact OD1-N 3.16Å; G54-N56 PolarHBondContact O-N 3.27Å; G54-I57 PolarHBondContact O-N 3.12Å; G54-I57 VanDerWaalsContact O-N 3.12Å
55	D	97	Very high	93.4	Very high	115 Å²	115	88 Å²	88	62%	0.615	46%	0.464	S	S	*	.	G	3₁₀ helix	trans	-60.1	-25.5	175	60.5	-14.2	0	0	0	113.7	K53	K53-D55 VanDerWaalsContact C-N 3.28Å; K53-D55 WeakPolarHBondContact CB-OD1 3.45Å; K53-D55 PolarHBondContact O-N 3.32Å
56	N	95.3	Very high	93.3	Very high	72 Å²	72	86.1 Å²	86.1	39%	0.385	46%	0.46	S	S	.	.	G	3₁₀ helix	trans	-93	-1.2	-179.9	-69.8	-74.7	0	0	0	113.3	L8 Y9 K53 G54	L8-N56 CarbonylContact C-O 3.59Å; L8-N56 VanDerWaalsContact CA-O 3.29Å; L8-N56 WeakPolarHBondContact CA-O 3.24Å; Y9-N56 PolarHBondContact N-O 2.89Å; K53-N56 PolarHBondContact O-N 3.15Å; K53-N56 VanDerWaalsContact O-N 3.15Å; G54-N56 PolarHBondContact O-N 3.27Å
57	I	96.6	Very high	93	Very high	32 Å²	32	84.3 Å²	84.3	16%	0.164	45%	0.454	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.3	123.1	-175.9	-60.2	178.2	0	0	0	110	V6 M27 L29 L52 G54 L60	V6-I57 HydrophobicContact CG1-CB 4.43Å; V6-I57 HydrophobicContact CG1-CD1 4.48Å; V6-I57 HydrophobicContact CG1-CG1 4Å; V6-I57 HydrophobicContact CG1-CG2 3.97Å; M27-I57 WeakPolarHBondContact O-CD1 2.95Å; L29-I57 HydrophobicContact CD1-CD1 3.62Å; L29-I57 HydrophobicContact CG-CD1 3.74Å; L52-I57 HydrophobicContact CB-CD1 4.4Å; G54-I57 PolarHBondContact O-N 3.12Å; G54-I57 VanDerWaalsContact O-N 3.12Å; I57-L60 HydrophobicContact CG2-CD2 3.93Å; I57-L60 HydrophobicContact CG2-CG 4.16Å
58	T	96.6	Very high	92.8	Very high	88 Å²	88	85.4 Å²	85.4	54%	0.54	46%	0.461	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.8	-41.6	175.5	-55.1	0	0	0	0	112.5	W7 Y9	W7-T58 PolarHBondContact O-N 2.92Å; Y9-T58 VanDerWaalsContact CA-OG1 3.32Å; Y9-T58 WeakPolarHBondContact CA-OG1 3.47Å; Y9-T58 PolarHBondContact N-OG1 2.85Å
59	L	96.3	Very high	92.5	Very high	78 Å²	78	88.7 Å²	88.7	41%	0.408	47%	0.47	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.1	140.9	-177	-177.1	144	0	0	0	110.9	V6 W7 Q61	V6-L59 WeakPolarHBondContact CA-O 3.5Å; W7-L59 HydrophobicContact CB-CB 3.93Å; W7-L59 HydrophobicContact CD2-CD2 4.34Å; W7-L59 HydrophobicContact CG-CB 4.07Å; W7-L59 HydrophobicContact CG-CD2 4.08Å; W7-L59 PolarHBondContact N-O 3.22Å; L59-Q61 HydrophobicContact CD2-CB 3.77Å
60	L	95.9	Very high	92.2	Very high	71 Å²	71	84.1 Å²	84.1	37%	0.372	46%	0.461	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112	123.4	170.6	-60.2	177.2	0	0	0	108.7	I4 V6 L29 I57	I4-L60 HydrophobicContact CD1-CD2 3.87Å; V6-L60 HydrophobicContact CB-CD2 4.19Å; V6-L60 HydrophobicContact CG1-CD2 3.94Å; V6-L60 HydrophobicContact CG2-CD2 3.68Å; L29-L60 HydrophobicContact CD1-CD1 4.11Å; L29-L60 HydrophobicContact CD1-CD2 3.77Å; I57-L60 HydrophobicContact CG2-CD2 3.93Å; I57-L60 HydrophobicContact CG2-CG 4.16Å
61	Q	95.4	Very high	91.8	Very high	95 Å²	95	87 Å²	87	44%	0.444	48%	0.478	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.3	131.4	179.6	-170.8	177.7	3.5	0	0	109.8	I4 Q5 L59 V63	I4-Q61 CarbonylContact C-O 3.52Å; I4-Q61 VanDerWaalsContact CA-O 3.26Å; I4-Q61 WeakPolarHBondContact CA-O 3.41Å; Q5-Q61 PolarHBondContact N-O 2.83Å; Q5-Q61 PolarHBondContact O-N 3.29Å; L59-Q61 HydrophobicContact CD2-CB 3.77Å; Q61-V63 PolarHBondContact O-N 2.98Å
62	S	94.3	Very high	91.4	Very high	79 Å²	79	84.5 Å²	84.5	55%	0.552	47%	0.469	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-66.7	131.3	167	-177.6	0	0	0	0	109.4	S64	S62-S64 PolarHBondContact O-N 3.13Å
63	V	90.1	Very high	91	Very high	44 Å²	44	89.2 Å²	89.2	27%	0.267	50%	0.496	S	S	.	.			trans	-90.8	101.8	173.5	-151.8	0	0	0	0	107.4	R3 Q5 Q61	R3-V63 HydrophobicContact CB-CG2 4.47Å; R3-V63 PolarHBondContact O-N 3.14Å; Q5-V63 HydrophobicContact CB-CG2 3.87Å; Q61-V63 PolarHBondContact O-N 2.98Å
64	S	75.9	Confident	90.5	Very high	109 Å²	109	85.3 Å²	85.3	76%	0.762	49%	0.488	S	S	*	.			trans	-79	114.7	168.6	37.6	0	0	0	0	108.3	S62	S62-S64 PolarHBondContact O-N 3.13Å
65	N	55.7	Low	89.9	Confident	229 Å²	229	92 Å²	92	100%	1.225	52%	0.521	S	S	*	.			trans	-70.7	0	163.6	-78.2	-19.2	0	0	0	110.1

Retrieved 65 of 65 residues in 173.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).