A0A093HDQ6_STRCA Loading...

Potassium voltage-gated channel subfamily E member 1

Ancillary protein that functions as a regulatory subunit of the voltage-gated potassium (Kv) channel complex composed of pore-forming and potassium-conducting alpha subunits and of regulatory beta subunits. KCNE1 beta subunit modulates the gating kinetics and enhances stability of the channel complex. Alters the gating of the delayed rectifier Kv channel containing KCNB1 alpha subunit. Associates with KCNQ1/KVLQT1 alpha subunit to form the slowly activating delayed rectifier cardiac potassium (IKs) channel responsible for ventricular muscle action potential repolarization. The outward current reaches its steady state only after 50 seconds. Assembly with KCNH2/HERG alpha subunit Kv channel may regulate the rapidly activating component of the delayed rectifying potassium current (IKr) in heart.

AlphaFold DB , UniProt , Accession A0A093HDQ6, Species STRCA (Struthio camelus australis), Gene n/a, Length 126 aa.

						>A0A093HDQ6_STRCA|A0A093HDQ6
MLVLSNNTALNSLLSKLFQDYLERTNSSASSQVQSGGDSLEIIYVLLLIGLFGFFTVGVMLTNIRARKLEDDHDPYNMYIASDIWPKKDRAYFQAKLIENYKLCCVFENPLTVEQPNTQIPEVKCS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	38.3	Very low	53.5	Low	232 Å²	232	128.5 Å²	128.5	100%	1.143	72%	0.722	S	S	*	*				0	73	0	-169.6	-176.1	-123.6	0	0	108.4	V3	M1-V3 HydrophobicContact CG-CG2 4.22Å
2	L	37.6	Very low	53.5	Low	174 Å²	174	123.9 Å²	123.9	91%	0.911	71%	0.705	S	S	*	*			trans	-98.4	90.9	160.8	-91.1	164.1	0	0	0	105.1	L4	L2-L4 VanDerWaalsContact C-N 3.33Å; L2-L4 PolarHBondContact O-N 2.59Å
3	V	53	Low	54.6	Low	127 Å²	127	123.2 Å²	123.2	77%	0.77	70%	0.696	S	S	*	*			trans	-86.3	86.4	164.6	176	0	0	0	0	105.2	M1	M1-V3 HydrophobicContact CG-CG2 4.22Å
4	L	50.7	Low	55.9	Low	166 Å²	166	122 Å²	122	87%	0.869	69%	0.687	S	S	*	*			trans	-116.8	112.1	159.7	-160.2	66.6	0	0	0	106.7	L2	L2-L4 VanDerWaalsContact C-N 3.33Å; L2-L4 PolarHBondContact O-N 2.59Å
5	S	46	Very low	55.9	Low	89 Å²	89	118.6 Å²	118.6	62%	0.622	67%	0.674	S	S	*	*			trans	-62.4	135.3	-159.5	-166.3	0	0	0	0	113.8	N7	S5-N7 PolarHBondContact O-N 2.73Å; S5-N7 VanDerWaalsContact O-N 3.15Å
6	N	59.1	Low	56.9	Low	145 Å²	145	121.6 Å²	121.6	78%	0.775	68%	0.677	S	S	*	*			trans	-65.4	96.2	172	-171.3	-8.8	0	0	0	109.9	T8	N6-T8 PolarHBondContact OD1-OG1 3.38Å
7	N	59	Low	57.2	Low	88 Å²	88	121.4 Å²	121.4	47%	0.471	67%	0.673	S	S	.	*			trans	-116.7	39.1	-165.8	-113.9	-23.7	0	0	0	114	S5 A9 L10	S5-N7 PolarHBondContact O-N 2.73Å; S5-N7 VanDerWaalsContact O-N 3.15Å; N7-A9 VanDerWaalsContact C-N 3.27Å; N7-A9 PolarHBondContact O-N 3.3Å; N7-L10 HydrophobicContact CB-CD1 4.47Å; N7-L10 PolarHBondContact O-N 3.06Å
8	T	58	Low	58.2	Low	112 Å²	112	122.4 Å²	122.4	69%	0.687	67%	0.67	S	S	*	*	H	α-helix	trans	-67.3	-24.9	-177.7	-37.3	0	0	0	0	113.2	N6	N6-T8 PolarHBondContact OD1-OG1 3.38Å
9	A	61.1	Low	58.3	Low	70 Å²	70	122.9 Å²	122.9	58%	0.579	67%	0.668	S	S	*	*	H	α-helix	trans	-75.5	-19.8	178.1	0	0	0	0	0	114.5	N7 S12 L13	N7-A9 VanDerWaalsContact C-N 3.27Å; N7-A9 PolarHBondContact O-N 3.3Å; A9-S12 PolarHBondContact O-OG 3.38Å; A9-L13 PolarHBondContact O-N 2.95Å
10	L	61.2	Low	59	Low	90 Å²	90	122.5 Å²	122.5	47%	0.471	66%	0.664	S	S	.	*	H	α-helix	trans	-73.6	-39.2	-175.3	-138	171.4	0	0	0	111.7	N7 L14	N7-L10 HydrophobicContact CB-CD1 4.47Å; N7-L10 PolarHBondContact O-N 3.06Å; L10-L14 PolarHBondContact O-N 3.19Å
11	N	64.9	Low	59.2	Low	121 Å²	121	125.1 Å²	125.1	65%	0.647	67%	0.666	S	S	*	*	H	α-helix	trans	-73	-29.9	178.9	-79	-41.4	0	0	0	113.3	S15	N11-S15 PolarHBondContact O-N 3.21Å
12	S	53.4	Low	60.6	Low	73 Å²	73	118.4 Å²	118.4	51%	0.51	63%	0.634	S	S	.	*	H	α-helix	trans	-72.8	-31.1	176.6	50.2	0	0	0	0	113.2	A9 K16	A9-S12 PolarHBondContact O-OG 3.38Å; S12-K16 PolarHBondContact O-N 3.41Å
13	L	67	Low	61.7	Low	114 Å²	114	116.1 Å²	116.1	60%	0.597	62%	0.619	S	S	*	*	H	α-helix	trans	-74.8	-35.8	174.4	-95.1	172.8	0	0	0	112.2	A9 K16 L17	A9-L13 PolarHBondContact O-N 2.95Å; L13-K16 PolarHBondContact O-N 3.46Å; L13-L17 WeakPolarHBondContact O-CB 3.45Å; L13-L17 WeakPolarHBondContact O-CG 3.39Å; L13-L17 PolarHBondContact O-N 3Å
14	L	72.8	Confident	61.9	Low	107 Å²	107	119.4 Å²	119.4	56%	0.56	62%	0.618	S	S	*	*	H	α-helix	trans	-64.2	-42.6	179.9	-149.7	107.5	0	0	0	112.1	L10 L17 F18	L10-L14 PolarHBondContact O-N 3.19Å; L14-L17 PolarHBondContact O-N 3.45Å; L14-F18 PolarHBondContact O-N 2.93Å; L14-F18 VanDerWaalsContact O-N 3.1Å
15	S	56.9	Low	62.2	Low	71 Å²	71	115.6 Å²	115.6	50%	0.497	60%	0.601	S	S	.	*	H	α-helix	trans	-66.9	-43.3	178.4	177.7	0	0	0	0	112.4	N11 L17 F18 Q19	N11-S15 PolarHBondContact O-N 3.21Å; S15-L17 PolarHBondContact O-N 2.75Å; S15-F18 PolarHBondContact O-N 3.44Å; S15-Q19 PolarHBondContact O-N 3.32Å; S15-Q19 VanDerWaalsContact O-N 3.16Å
16	K	70.9	Confident	62.8	Low	166 Å²	166	116.8 Å²	116.8	72%	0.722	60%	0.601	S	S	*	*	H	α-helix	trans	-62.5	-39.3	174.7	-84.7	-77.6	-175.2	-179.1	0	112.6	S12 L13 F18 D20	S12-K16 PolarHBondContact O-N 3.41Å; L13-K16 PolarHBondContact O-N 3.46Å; K16-F18 VanDerWaalsContact C-N 3.33Å; K16-D20 WeakPolarHBondContact O-CB 3.47Å; K16-D20 PolarHBondContact O-N 2.88Å
17	L	63.2	Low	62.4	Low	118 Å²	118	114.5 Å²	114.5	62%	0.618	60%	0.596	S	S	*	*	H	α-helix	trans	-67.5	-31	176	-85.1	162.5	0	0	0	113	L13 L14 S15 Y21	L13-L17 WeakPolarHBondContact O-CB 3.45Å; L13-L17 WeakPolarHBondContact O-CG 3.39Å; L13-L17 PolarHBondContact O-N 3Å; L14-L17 PolarHBondContact O-N 3.45Å; S15-L17 PolarHBondContact O-N 2.75Å; L17-Y21 WeakPolarHBondContact O-CB 3.44Å; L17-Y21 PolarHBondContact O-N 3.44Å
18	F	74	Confident	62.1	Low	141 Å²	141	115 Å²	115	62%	0.618	61%	0.606	S	S	*	*	H	α-helix	trans	-80.8	-36.4	-176.9	-150.3	-99.5	0	0	0	112.5	L14 S15 K16 Y21 L22	L14-F18 PolarHBondContact O-N 2.93Å; L14-F18 VanDerWaalsContact O-N 3.1Å; S15-F18 PolarHBondContact O-N 3.44Å; K16-F18 VanDerWaalsContact C-N 3.33Å; F18-Y21 WeakPolarHBondContact O-CB 3.37Å; F18-Y21 PolarHBondContact O-N 2.9Å; F18-L22 HydrophobicContact CD1-CD1 3.79Å; F18-L22 HydrophobicContact CE1-CD1 3.72Å; F18-L22 PolarHBondContact O-N 2.89Å; F18-L22 VanDerWaalsContact O-N 3.11Å
19	Q	59.8	Low	61.7	Low	132 Å²	132	113 Å²	113	62%	0.617	60%	0.601	S	S	*	*	H	α-helix	trans	-74.1	-38.3	179.4	-154.9	146.3	19.8	0	0	111.9	S15 Y21 L22 E23	S15-Q19 PolarHBondContact O-N 3.32Å; S15-Q19 VanDerWaalsContact O-N 3.16Å; Q19-Y21 VanDerWaalsContact C-N 3.29Å; Q19-Y21 PolarHBondContact O-N 3.32Å; Q19-L22 PolarHBondContact O-N 3.31Å; Q19-E23 WeakPolarHBondContact O-CB 3.25Å; Q19-E23 PolarHBondContact O-N 2.91Å
20	D	72.9	Confident	61.1	Low	113 Å²	113	114.5 Å²	114.5	60%	0.604	61%	0.607	S	S	*	*	H	α-helix	trans	-66.1	-33	174.1	-149.9	50.4	0	0	0	111.6	K16 R24	K16-D20 WeakPolarHBondContact O-CB 3.47Å; K16-D20 PolarHBondContact O-N 2.88Å; D20-R24 WeakPolarHBondContact O-CB 3.42Å; D20-R24 PolarHBondContact O-N 3.48Å
21	Y	63.9	Low	60.7	Low	179 Å²	179	115.1 Å²	115.1	70%	0.702	62%	0.619	S	S	*	*	H	α-helix	trans	-65.6	-44.6	173.1	-139.5	-97.4	0	0	0	112.5	L17 F18 Q19 T25	L17-Y21 WeakPolarHBondContact O-CB 3.44Å; L17-Y21 PolarHBondContact O-N 3.44Å; F18-Y21 WeakPolarHBondContact O-CB 3.37Å; F18-Y21 PolarHBondContact O-N 2.9Å; Q19-Y21 VanDerWaalsContact C-N 3.29Å; Q19-Y21 PolarHBondContact O-N 3.32Å; Y21-T25 WeakPolarHBondContact O-CB 3.48Å; Y21-T25 PolarHBondContact O-N 2.9Å; Y21-T25 PolarHBondContact O-OG1 3.38Å
22	L	66.3	Low	60	Low	91 Å²	91	115.7 Å²	115.7	48%	0.476	62%	0.618	S	S	.	*	H	α-helix	trans	-72	-35.8	-177.7	-93.1	159.9	0	0	0	112.6	F18 Q19 N26	F18-L22 HydrophobicContact CD1-CD1 3.79Å; F18-L22 HydrophobicContact CE1-CD1 3.72Å; F18-L22 PolarHBondContact O-N 2.89Å; F18-L22 VanDerWaalsContact O-N 3.11Å; Q19-L22 PolarHBondContact O-N 3.31Å; L22-N26 PolarHBondContact O-N 3.02Å; L22-N26 PolarHBondContact O-ND2 2.97Å
23	E	62.1	Low	60.1	Low	125 Å²	125	118.6 Å²	118.6	58%	0.584	63%	0.632	S	S	*	*	H	α-helix	trans	-81.5	-35.2	-175.8	-154	168	-172.9	0	0	112.7	Q19 T25 N26 S27	Q19-E23 WeakPolarHBondContact O-CB 3.25Å; Q19-E23 PolarHBondContact O-N 2.91Å; E23-T25 VanDerWaalsContact C-N 3.3Å; E23-T25 PolarHBondContact O-N 2.86Å; E23-N26 PolarHBondContact O-N 2.87Å; E23-S27 WeakPolarHBondContact O-CB 3.48Å; E23-S27 PolarHBondContact O-N 2.87Å; E23-S27 VanDerWaalsContact O-N 3.09Å; E23-S27 PolarHBondContact O-OG 2.83Å
24	R	57.3	Low	59.4	Low	197 Å²	197	120 Å²	120	74%	0.743	64%	0.636	S	S	*	*	H	α-helix	trans	-64.6	-34.6	169.3	179	123.6	-90.2	172.6	-6.6	112.1	D20 S28	D20-R24 WeakPolarHBondContact O-CB 3.42Å; D20-R24 PolarHBondContact O-N 3.48Å; R24-S28 PolarHBondContact O-OG 2.94Å; R24-S28 VanDerWaalsContact O-OG 3.09Å
25	T	57	Low	58.3	Low	85 Å²	85	120.2 Å²	120.2	52%	0.521	65%	0.646	S	S	.	*	H	α-helix	trans	-71.8	-36.7	179	-56.6	0	0	0	0	112.1	Y21 E23	Y21-T25 WeakPolarHBondContact O-CB 3.48Å; Y21-T25 PolarHBondContact O-N 2.9Å; Y21-T25 PolarHBondContact O-OG1 3.38Å; E23-T25 VanDerWaalsContact C-N 3.3Å; E23-T25 PolarHBondContact O-N 2.86Å
26	N	56.9	Low	58.5	Low	115 Å²	115	120 Å²	120	62%	0.615	66%	0.656	S	S	*	*	H	α-helix	trans	-86.1	-26.3	-179	-72.4	-37.6	0	0	0	114.6	L22 E23	L22-N26 PolarHBondContact O-N 3.02Å; L22-N26 PolarHBondContact O-ND2 2.97Å; E23-N26 PolarHBondContact O-N 2.87Å
27	S	52.1	Low	58	Low	97 Å²	97	114.1 Å²	114.1	68%	0.678	64%	0.642	S	S	*	*	H	α-helix	trans	-89.2	-15	-175.2	-53.2	0	0	0	0	114.8	E23 A29	E23-S27 WeakPolarHBondContact O-CB 3.48Å; E23-S27 PolarHBondContact O-N 2.87Å; E23-S27 VanDerWaalsContact O-N 3.09Å; E23-S27 PolarHBondContact O-OG 2.83Å; S27-A29 VanDerWaalsContact C-N 3.34Å
28	S	52	Low	58.1	Low	97 Å²	97	114.6 Å²	114.6	68%	0.678	65%	0.645	S	S	*	*	S	Bend	trans	-86	-9.2	172.7	55.7	0	0	0	0	113.1	R24 S30	R24-S28 PolarHBondContact O-OG 2.94Å; R24-S28 VanDerWaalsContact O-OG 3.09Å; S28-S30 PolarHBondContact O-N 2.74Å
29	A	50.1	Low	58.1	Low	70 Å²	70	111.2 Å²	111.2	58%	0.579	64%	0.639	S	S	*	*			trans	-75.5	78.6	164.5	0	0	0	0	0	108.9	S27 S31	S27-A29 VanDerWaalsContact C-N 3.34Å; A29-S31 PolarHBondContact O-N 2.95Å
30	S	48.1	Very low	59.1	Low	102 Å²	102	110.8 Å²	110.8	71%	0.713	64%	0.64	S	S	*	*			trans	-52.8	98.8	151.3	172.9	0	0	0	0	107.1	S28 Q32	S28-S30 PolarHBondContact O-N 2.74Å; S30-Q32 PolarHBondContact O-N 2.79Å
31	S	52.5	Low	59.6	Low	104 Å²	104	112 Å²	112	73%	0.727	64%	0.642	S	S	*	*			trans	-73.8	73.1	165.5	63.4	0	0	0	0	107.3	A29 V33	A29-S31 PolarHBondContact O-N 2.95Å; S31-V33 PolarHBondContact O-N 3.47Å
32	Q	50.6	Low	60.7	Low	133 Å²	133	108.1 Å²	108.1	62%	0.621	63%	0.633	S	S	*	*			trans	-69.9	88.9	158	-168.8	170.6	11.6	0	0	105.7	S30 Q34	S30-Q32 PolarHBondContact O-N 2.79Å; Q32-Q34 HydrophobicContact CG-CB 4.48Å; Q32-Q34 HydrophobicContact CG-CG 3.93Å; Q32-Q34 PolarHBondContact O-N 3.48Å
33	V	55.3	Low	61.8	Low	133 Å²	133	108.5 Å²	108.5	81%	0.806	63%	0.634	S	S	*	*			trans	-65.6	79.8	164.5	178.2	0	0	0	0	106	S31 S35	S31-V33 PolarHBondContact O-N 3.47Å; V33-S35 PolarHBondContact O-N 3.18Å
34	Q	52.3	Low	63.2	Low	144 Å²	144	109.6 Å²	109.6	67%	0.673	63%	0.634	S	S	*	*			trans	-78.9	104	167.5	-105.9	173.8	25.1	0	0	106.5	Q32	Q32-Q34 HydrophobicContact CG-CB 4.48Å; Q32-Q34 HydrophobicContact CG-CG 3.93Å; Q32-Q34 PolarHBondContact O-N 3.48Å
35	S	50.9	Low	64.8	Low	111 Å²	111	104.1 Å²	104.1	78%	0.776	62%	0.622	S	S	*	*			trans	40.1	100.9	155.4	-161.6	0	0	0	0	116	V33 G37	V33-S35 PolarHBondContact O-N 3.18Å; S35-G37 PolarHBondContact O-N 2.92Å
36	G	60.6	Low	66.6	Low	68 Å²	68	105.4 Å²	105.4	70%	0.701	63%	0.625	S	S	*	*			trans	-48.9	132.2	169.7	0	0	0	0	0	112.6
37	G	60.2	Low	68.4	Low	41 Å²	41	104.7 Å²	104.7	42%	0.423	62%	0.621	S	S	.	*			trans	-161.1	122.3	166.8	0	0	0	0	0	107.4	S35 S39	S35-G37 PolarHBondContact O-N 2.92Å; G37-S39 WeakPolarHBondContact O-CB 3.31Å; G37-S39 PolarHBondContact O-N 3.49Å; G37-S39 PolarHBondContact O-OG 3.09Å
38	D	64.9	Low	70.4	Confident	128 Å²	128	104.2 Å²	104.2	68%	0.684	61%	0.611	S	S	*	*	T	Hydrogen-bonded Turn	trans	20.9	-36.6	170.7	-56.3	-2.4	0	0	0	120.2	L40 E41 I42	D38-L40 PolarHBondContact O-N 3.47Å; D38-E41 WeakPolarHBondContact O-CB 3.34Å; D38-E41 PolarHBondContact O-N 2.91Å; D38-I42 WeakPolarHBondContact O-CG1 3.39Å; D38-I42 PolarHBondContact O-N 2.84Å
39	S	73.8	Confident	72.5	Confident	71 Å²	71	104.9 Å²	104.9	50%	0.497	61%	0.605	S	S	.	*	H	α-helix	trans	-52.3	-44.3	175.3	61.3	0	0	0	0	115.2	G37 E41 I42 I43	G37-S39 WeakPolarHBondContact O-CB 3.31Å; G37-S39 PolarHBondContact O-N 3.49Å; G37-S39 PolarHBondContact O-OG 3.09Å; S39-E41 VanDerWaalsContact C-N 3.31Å; S39-E41 PolarHBondContact O-N 3.09Å; S39-I42 PolarHBondContact O-N 3.34Å; S39-I43 WeakPolarHBondContact O-CD1 3.04Å; S39-I43 VanDerWaalsContact O-CG1 3.25Å; S39-I43 WeakPolarHBondContact O-CG1 3.26Å; S39-I43 PolarHBondContact O-N 3.03Å
40	L	81.1	Confident	74.7	Confident	123 Å²	123	103.5 Å²	103.5	64%	0.644	60%	0.598	S	S	*	*	H	α-helix	trans	-67.4	-33.5	178.8	-78	168.7	0	0	0	112	D38 Y44	D38-L40 PolarHBondContact O-N 3.47Å; L40-Y44 WeakPolarHBondContact O-CB 3.12Å; L40-Y44 PolarHBondContact O-N 3.07Å
41	E	83.2	Confident	77	Confident	137 Å²	137	103.7 Å²	103.7	64%	0.64	59%	0.59	S	S	*	*	H	α-helix	trans	-69.9	-42.5	176	-173.3	176.3	171.7	0	0	111	D38 S39 I43 Y44 V45	D38-E41 WeakPolarHBondContact O-CB 3.34Å; D38-E41 PolarHBondContact O-N 2.91Å; S39-E41 VanDerWaalsContact C-N 3.31Å; S39-E41 PolarHBondContact O-N 3.09Å; E41-I43 VanDerWaalsContact C-N 3.34Å; E41-I43 PolarHBondContact O-N 3.11Å; E41-Y44 WeakPolarHBondContact O-CB 3.34Å; E41-Y44 PolarHBondContact O-N 3.21Å; E41-V45 WeakPolarHBondContact O-CG2 3.47Å; E41-V45 PolarHBondContact O-N 3.36Å
42	I	87.3	Confident	79	Confident	99 Å²	99	105.1 Å²	105.1	51%	0.508	58%	0.584	S	S	.	*	H	α-helix	trans	-61.4	-43.4	174.9	-64.5	160.5	0	0	0	110.8	D38 S39 Y44 V45 L46	D38-I42 WeakPolarHBondContact O-CG1 3.39Å; D38-I42 PolarHBondContact O-N 2.84Å; S39-I42 PolarHBondContact O-N 3.34Å; I42-Y44 VanDerWaalsContact C-N 3.31Å; I42-Y44 PolarHBondContact O-N 3.19Å; I42-V45 PolarHBondContact O-N 2.73Å; I42-L46 HydrophobicContact CG2-CD1 3.91Å; I42-L46 HydrophobicContact CG2-CG 4.3Å; I42-L46 WeakPolarHBondContact O-CB 3.33Å; I42-L46 VanDerWaalsContact O-CG 3.26Å; I42-L46 WeakPolarHBondContact O-CG 3.36Å; I42-L46 PolarHBondContact O-N 3.18Å
43	I	89.9	Confident	81.2	Confident	98 Å²	98	100.3 Å²	100.3	50%	0.503	57%	0.57	S	S	.	*	H	α-helix	trans	-62	-41.1	176.6	-68.7	162.5	0	0	0	110.7	S39 E41 L46 L47	S39-I43 WeakPolarHBondContact O-CD1 3.04Å; S39-I43 VanDerWaalsContact O-CG1 3.25Å; S39-I43 WeakPolarHBondContact O-CG1 3.26Å; S39-I43 PolarHBondContact O-N 3.03Å; E41-I43 VanDerWaalsContact C-N 3.34Å; E41-I43 PolarHBondContact O-N 3.11Å; I43-L46 PolarHBondContact O-N 3.28Å; I43-L47 VanDerWaalsContact O-CB 3.31Å; I43-L47 WeakPolarHBondContact O-CB 3.37Å; I43-L47 PolarHBondContact O-N 3.46Å
44	Y	90.4	Very high	83.1	Confident	148 Å²	148	101.7 Å²	101.7	58%	0.58	57%	0.565	S	S	*	*	H	α-helix	trans	-61.7	-46.9	176.5	177.1	-101.2	0	0	0	111.9	L40 E41 I42 L47 L48	L40-Y44 WeakPolarHBondContact O-CB 3.12Å; L40-Y44 PolarHBondContact O-N 3.07Å; E41-Y44 WeakPolarHBondContact O-CB 3.34Å; E41-Y44 PolarHBondContact O-N 3.21Å; I42-Y44 VanDerWaalsContact C-N 3.31Å; I42-Y44 PolarHBondContact O-N 3.19Å; Y44-L47 PolarHBondContact O-N 3.42Å; Y44-L48 HydrophobicContact CE1-CD1 3.81Å; Y44-L48 WeakPolarHBondContact O-CB 3.44Å; Y44-L48 PolarHBondContact O-N 3.29Å
45	V	92.6	Very high	85.2	Confident	83 Å²	83	101.7 Å²	101.7	50%	0.503	56%	0.563	S	S	.	*	H	α-helix	trans	-65.3	-40.6	178.4	176.3	0	0	0	0	111.6	E41 I42 L48 I49	E41-V45 WeakPolarHBondContact O-CG2 3.47Å; E41-V45 PolarHBondContact O-N 3.36Å; I42-V45 PolarHBondContact O-N 2.73Å; V45-L48 PolarHBondContact O-N 2.6Å; V45-I49 WeakPolarHBondContact O-CG2 3.37Å; V45-I49 PolarHBondContact O-N 3.28Å
46	L	93.2	Very high	87.2	Confident	111 Å²	111	99.8 Å²	99.8	58%	0.581	55%	0.547	S	S	*	.	H	α-helix	trans	-63.2	-39.7	175.1	-73.6	173.9	0	0	0	112.4	I42 I43 I49 G50	I42-L46 HydrophobicContact CG2-CD1 3.91Å; I42-L46 HydrophobicContact CG2-CG 4.3Å; I42-L46 WeakPolarHBondContact O-CB 3.33Å; I42-L46 VanDerWaalsContact O-CG 3.26Å; I42-L46 WeakPolarHBondContact O-CG 3.36Å; I42-L46 PolarHBondContact O-N 3.18Å; I43-L46 PolarHBondContact O-N 3.28Å; L46-I49 WeakPolarHBondContact O-CG2 3.26Å; L46-G50 PolarHBondContact O-N 3.43Å
47	L	94.8	Very high	88.9	Confident	100 Å²	100	101.4 Å²	101.4	52%	0.524	54%	0.543	S	S	.	.	H	α-helix	trans	-68	-42.6	175.9	-171.8	156.1	0	0	0	110.5	I43 Y44 G50 L51	I43-L47 VanDerWaalsContact O-CB 3.31Å; I43-L47 WeakPolarHBondContact O-CB 3.37Å; I43-L47 PolarHBondContact O-N 3.46Å; Y44-L47 PolarHBondContact O-N 3.42Å; L47-G50 PolarHBondContact O-N 2.7Å; L47-L51 HydrophobicContact CD2-CD1 3.35Å; L47-L51 HydrophobicContact CD2-CG 3.91Å; L47-L51 HydrophobicContact CG-CD1 4.28Å; L47-L51 HydrophobicContact CG-CG 4.44Å; L47-L51 WeakPolarHBondContact O-CB 3.42Å; L47-L51 WeakPolarHBondContact O-CG 3.21Å; L47-L51 PolarHBondContact O-N 2.92Å
48	L	95.3	Very high	90.6	Very high	88 Å²	88	100.4 Å²	100.4	46%	0.461	53%	0.533	S	S	.	.	H	α-helix	trans	-63.8	-47.7	179.5	-159.1	159	0	0	0	110.9	Y44 V45 G50 F52	Y44-L48 HydrophobicContact CE1-CD1 3.81Å; Y44-L48 WeakPolarHBondContact O-CB 3.44Å; Y44-L48 PolarHBondContact O-N 3.29Å; V45-L48 PolarHBondContact O-N 2.6Å; L48-G50 VanDerWaalsContact C-N 3.35Å; L48-G50 PolarHBondContact O-N 3.26Å; L48-F52 WeakPolarHBondContact O-CB 3.32Å; L48-F52 PolarHBondContact O-N 3.32Å
49	I	96.1	Very high	92	Very high	110 Å²	110	97.9 Å²	97.9	56%	0.564	52%	0.522	S	S	*	.	H	α-helix	trans	-66.3	-38.2	177.6	-159.9	72.1	0	0	0	111.7	V45 L46 G53	V45-I49 WeakPolarHBondContact O-CG2 3.37Å; V45-I49 PolarHBondContact O-N 3.28Å; L46-I49 WeakPolarHBondContact O-CG2 3.26Å; I49-G53 PolarHBondContact O-N 2.92Å
50	G	95.4	Very high	92.9	Very high	41 Å²	41	100.5 Å²	100.5	42%	0.423	53%	0.528	S	S	.	.	H	α-helix	trans	-65.4	-50.5	178.3	0	0	0	0	0	112.2	L46 L47 L48 F54	L46-G50 PolarHBondContact O-N 3.43Å; L47-G50 PolarHBondContact O-N 2.7Å; L48-G50 VanDerWaalsContact C-N 3.35Å; L48-G50 PolarHBondContact O-N 3.26Å; G50-F54 WeakPolarHBondContact O-CB 3.38Å; G50-F54 PolarHBondContact O-N 3.3Å
51	L	96	Very high	93.4	Very high	107 Å²	107	98.8 Å²	98.8	56%	0.56	52%	0.519	S	S	*	.	H	α-helix	trans	-65.7	-41.1	176.9	-71.2	-173.3	0	0	0	111.6	L47 F54 F55	L47-L51 HydrophobicContact CD2-CD1 3.35Å; L47-L51 HydrophobicContact CD2-CG 3.91Å; L47-L51 HydrophobicContact CG-CD1 4.28Å; L47-L51 HydrophobicContact CG-CG 4.44Å; L47-L51 WeakPolarHBondContact O-CB 3.42Å; L47-L51 WeakPolarHBondContact O-CG 3.21Å; L47-L51 PolarHBondContact O-N 2.92Å; L51-F54 PolarHBondContact O-N 2.88Å; L51-F55 WeakPolarHBondContact O-CB 3.29Å; L51-F55 PolarHBondContact O-N 3.5Å
52	F	95.8	Very high	93.8	Very high	134 Å²	134	96.7 Å²	96.7	59%	0.588	52%	0.516	S	S	*	.	H	α-helix	trans	-63.2	-46.7	178.4	178.4	-102	0	0	0	111.9	L48 F55 T56	L48-F52 WeakPolarHBondContact O-CB 3.32Å; L48-F52 PolarHBondContact O-N 3.32Å; F52-F55 PolarHBondContact O-N 3.16Å; F52-T56 WeakPolarHBondContact O-CB 3.31Å; F52-T56 PolarHBondContact O-N 3.46Å; F52-T56 PolarHBondContact O-OG1 2.93Å
53	G	95.4	Very high	93.9	Very high	32 Å²	32	95.7 Å²	95.7	33%	0.33	51%	0.512	S	S	.	.	H	α-helix	trans	-63.7	-46.8	176.4	0	0	0	0	0	112	I49 F55 T56 V57	I49-G53 PolarHBondContact O-N 2.92Å; G53-F55 VanDerWaalsContact C-N 3.35Å; G53-F55 PolarHBondContact O-N 2.8Å; G53-T56 PolarHBondContact O-N 3.26Å; G53-V57 WeakPolarHBondContact O-CG2 3.21Å; G53-V57 PolarHBondContact O-N 3.11Å
54	F	96.1	Very high	93.8	Very high	161 Å²	161	95.7 Å²	95.7	71%	0.706	51%	0.512	S	S	*	.	H	α-helix	trans	-62.2	-41.7	177.7	-177.7	-100.6	0	0	0	112.1	G50 L51 G58	G50-F54 WeakPolarHBondContact O-CB 3.38Å; G50-F54 PolarHBondContact O-N 3.3Å; L51-F54 PolarHBondContact O-N 2.88Å; F54-G58 VanDerWaalsContact O-CA 3.29Å; F54-G58 WeakPolarHBondContact O-CA 3.35Å; F54-G58 PolarHBondContact O-N 3.36Å
55	F	95.8	Very high	93.4	Very high	145 Å²	145	97 Å²	97	64%	0.636	52%	0.515	S	S	*	.	H	α-helix	trans	-68.2	-41.1	178.9	-169.4	-100.8	0	0	0	111.6	L51 F52 G53 G58 V59	L51-F55 WeakPolarHBondContact O-CB 3.29Å; L51-F55 PolarHBondContact O-N 3.5Å; F52-F55 PolarHBondContact O-N 3.16Å; G53-F55 VanDerWaalsContact C-N 3.35Å; G53-F55 PolarHBondContact O-N 2.8Å; F55-G58 PolarHBondContact O-N 3.33Å; F55-V59 HydrophobicContact CD1-CG2 3.98Å; F55-V59 HydrophobicContact CD2-CG2 4.3Å; F55-V59 HydrophobicContact CE1-CG2 3.67Å; F55-V59 HydrophobicContact CE2-CG2 4Å; F55-V59 HydrophobicContact CG-CG2 4.29Å; F55-V59 HydrophobicContact CZ-CG2 3.67Å; F55-V59 WeakPolarHBondContact O-CB 3.44Å; F55-V59 VanDerWaalsContact O-CG2 3.26Å; F55-V59 WeakPolarHBondContact O-CG2 3.32Å; F55-V59 PolarHBondContact O-N 3.38Å
56	T	94.4	Very high	92.7	Very high	71 Å²	71	95.3 Å²	95.3	44%	0.436	51%	0.51	S	S	.	.	H	α-helix	trans	-61.8	-50.3	177.8	-56.6	0	0	0	0	111.2	F52 G53 M60	F52-T56 WeakPolarHBondContact O-CB 3.31Å; F52-T56 PolarHBondContact O-N 3.46Å; F52-T56 PolarHBondContact O-OG1 2.93Å; G53-T56 PolarHBondContact O-N 3.26Å; T56-M60 WeakPolarHBondContact O-CB 3.26Å; T56-M60 PolarHBondContact O-N 3.25Å
57	V	95.8	Very high	91.8	Very high	101 Å²	101	97.6 Å²	97.6	61%	0.612	51%	0.511	S	S	*	.	H	α-helix	trans	-68	-38.3	176.6	177.2	0	0	0	0	111.1	G53 M60 L61	G53-V57 WeakPolarHBondContact O-CG2 3.21Å; G53-V57 PolarHBondContact O-N 3.11Å; V57-M60 PolarHBondContact O-N 3.49Å; V57-L61 WeakPolarHBondContact O-CB 3.34Å; V57-L61 PolarHBondContact O-N 3.1Å
58	G	95.1	Very high	90.7	Very high	21 Å²	21	100.9 Å²	100.9	22%	0.216	52%	0.521	C	S	.	.	H	α-helix	trans	-65.2	-44	-178.3	0	0	0	0	0	112.8	F54 F55 M60 L61 T62	F54-G58 VanDerWaalsContact O-CA 3.29Å; F54-G58 WeakPolarHBondContact O-CA 3.35Å; F54-G58 PolarHBondContact O-N 3.36Å; F55-G58 PolarHBondContact O-N 3.33Å; G58-M60 VanDerWaalsContact C-N 3.35Å; G58-L61 PolarHBondContact O-N 2.83Å; G58-T62 VanDerWaalsContact O-CB 3.26Å; G58-T62 WeakPolarHBondContact O-CB 3.47Å; G58-T62 PolarHBondContact O-N 3.24Å; G58-T62 PolarHBondContact O-OG1 3.44Å
59	V	94.1	Very high	89.2	Confident	75 Å²	75	102.6 Å²	102.6	46%	0.455	53%	0.53	S	S	.	.	H	α-helix	trans	-66.1	-40.9	174.7	172.2	0	0	0	0	110.3	F55 T62 N63	F55-V59 HydrophobicContact CD1-CG2 3.98Å; F55-V59 HydrophobicContact CD2-CG2 4.3Å; F55-V59 HydrophobicContact CE1-CG2 3.67Å; F55-V59 HydrophobicContact CE2-CG2 4Å; F55-V59 HydrophobicContact CG-CG2 4.29Å; F55-V59 HydrophobicContact CZ-CG2 3.67Å; F55-V59 WeakPolarHBondContact O-CB 3.44Å; F55-V59 VanDerWaalsContact O-CG2 3.26Å; F55-V59 WeakPolarHBondContact O-CG2 3.32Å; F55-V59 PolarHBondContact O-N 3.38Å; V59-T62 PolarHBondContact O-N 3.37Å; V59-N63 WeakPolarHBondContact O-CB 3.4Å; V59-N63 PolarHBondContact O-N 3Å
60	M	93.3	Very high	87.5	Confident	125 Å²	125	105 Å²	105	62%	0.616	54%	0.539	S	S	*	.	H	α-helix	trans	-65.2	-44.6	177.5	-169	160	179	0	0	112.2	T56 V57 G58 N63 I64	T56-M60 WeakPolarHBondContact O-CB 3.26Å; T56-M60 PolarHBondContact O-N 3.25Å; V57-M60 PolarHBondContact O-N 3.49Å; G58-M60 VanDerWaalsContact C-N 3.35Å; M60-N63 PolarHBondContact O-N 3.48Å; M60-I64 HydrophobicContact CG-CD1 4.19Å; M60-I64 VanDerWaalsContact O-CG1 3.31Å; M60-I64 WeakPolarHBondContact O-CG1 3.38Å; M60-I64 PolarHBondContact O-N 3.43Å
61	L	91.7	Very high	85.8	Confident	87 Å²	87	109.9 Å²	109.9	46%	0.455	56%	0.555	S	S	.	*	H	α-helix	trans	-64.7	-41.1	176.2	-177.5	64.9	0	0	0	111.7	V57 G58 N63 I64 R65	V57-L61 WeakPolarHBondContact O-CB 3.34Å; V57-L61 PolarHBondContact O-N 3.1Å; G58-L61 PolarHBondContact O-N 2.83Å; L61-N63 VanDerWaalsContact C-N 3.3Å; L61-N63 PolarHBondContact O-N 3.46Å; L61-I64 PolarHBondContact O-N 3.48Å; L61-R65 HydrophobicContact CD1-CG 4.47Å; L61-R65 WeakPolarHBondContact O-CB 3.22Å; L61-R65 WeakPolarHBondContact O-CG 3.46Å; L61-R65 PolarHBondContact O-N 2.9Å
62	T	92.2	Very high	84.2	Confident	94 Å²	94	109.2 Å²	109.2	58%	0.577	55%	0.552	S	S	*	*	H	α-helix	trans	-59.9	-43.5	174.6	-60.2	0	0	0	0	110.6	G58 V59 R65 A66	G58-T62 VanDerWaalsContact O-CB 3.26Å; G58-T62 WeakPolarHBondContact O-CB 3.47Å; G58-T62 PolarHBondContact O-N 3.24Å; G58-T62 PolarHBondContact O-OG1 3.44Å; V59-T62 PolarHBondContact O-N 3.37Å; T62-R65 PolarHBondContact O-N 3.32Å; T62-A66 VanDerWaalsContact O-CB 3.22Å; T62-A66 WeakPolarHBondContact O-CB 3.38Å; T62-A66 PolarHBondContact O-N 2.97Å
63	N	88.3	Confident	82.8	Confident	78 Å²	78	110.9 Å²	110.9	42%	0.417	56%	0.562	S	S	.	*	H	α-helix	trans	-66	-43.5	177.4	-172.9	19.4	0	0	0	112.3	V59 M60 L61 R65 A66 R67	V59-N63 WeakPolarHBondContact O-CB 3.4Å; V59-N63 PolarHBondContact O-N 3Å; M60-N63 PolarHBondContact O-N 3.48Å; L61-N63 VanDerWaalsContact C-N 3.3Å; L61-N63 PolarHBondContact O-N 3.46Å; N63-R65 PolarHBondContact O-N 3.01Å; N63-A66 PolarHBondContact O-N 3.24Å; N63-R67 WeakPolarHBondContact O-CG 3.41Å; N63-R67 PolarHBondContact O-N 3.48Å; N63-R67 PolarHBondContact OD1-NE 3.04Å
64	I	88.1	Confident	81.5	Confident	98 Å²	98	112.2 Å²	112.2	50%	0.503	56%	0.561	S	S	.	*	H	α-helix	trans	-61.4	-45.1	175.8	-67.6	163.6	0	0	0	110.7	M60 L61 K68	M60-I64 HydrophobicContact CG-CD1 4.19Å; M60-I64 VanDerWaalsContact O-CG1 3.31Å; M60-I64 WeakPolarHBondContact O-CG1 3.38Å; M60-I64 PolarHBondContact O-N 3.43Å; L61-I64 PolarHBondContact O-N 3.48Å; I64-K68 WeakPolarHBondContact O-CB 3.47Å; I64-K68 PolarHBondContact O-N 2.99Å
65	R	82.4	Confident	80.2	Confident	174 Å²	174	108.7 Å²	108.7	66%	0.657	55%	0.554	S	S	*	*	H	α-helix	trans	-66.2	-40.6	177.6	-74.6	-175	177.7	-143.7	1.5	112.2	L61 T62 N63 K68 L69	L61-R65 HydrophobicContact CD1-CG 4.47Å; L61-R65 WeakPolarHBondContact O-CB 3.22Å; L61-R65 WeakPolarHBondContact O-CG 3.46Å; L61-R65 PolarHBondContact O-N 2.9Å; T62-R65 PolarHBondContact O-N 3.32Å; N63-R65 PolarHBondContact O-N 3.01Å; R65-K68 PolarHBondContact O-N 3.3Å; R65-L69 WeakPolarHBondContact O-CB 3.44Å; R65-L69 PolarHBondContact O-N 2.98Å
66	A	77.8	Confident	78.6	Confident	48 Å²	48	110.5 Å²	110.5	40%	0.397	56%	0.558	S	S	.	*	H	α-helix	trans	-61.3	-44.9	177.8	0	0	0	0	0	111.3	T62 N63 K68 L69 E70	T62-A66 VanDerWaalsContact O-CB 3.22Å; T62-A66 WeakPolarHBondContact O-CB 3.38Å; T62-A66 PolarHBondContact O-N 2.97Å; N63-A66 PolarHBondContact O-N 3.24Å; A66-K68 VanDerWaalsContact C-N 3.34Å; A66-K68 PolarHBondContact O-N 2.89Å; A66-L69 PolarHBondContact O-N 3.16Å; A66-L69 VanDerWaalsContact O-N 3.16Å; A66-E70 PolarHBondContact O-N 3.35Å; A66-E70 VanDerWaalsContact O-N 3.09Å
67	R	75	Confident	77.1	Confident	159 Å²	159	111.3 Å²	111.3	60%	0.6	56%	0.56	S	S	*	*	H	α-helix	trans	-66.5	-34.1	176.5	-70.3	174	-177.1	-87.4	-2.7	113.1	N63 L69	N63-R67 WeakPolarHBondContact O-CG 3.41Å; N63-R67 PolarHBondContact O-N 3.48Å; N63-R67 PolarHBondContact OD1-NE 3.04Å; R67-L69 VanDerWaalsContact C-N 3.29Å
68	K	70.1	Confident	75.6	Confident	169 Å²	169	111.8 Å²	111.8	74%	0.735	56%	0.557	S	S	*	*	H	α-helix	trans	-68.6	-29.9	174	-169.9	-179.2	176.2	-172.1	0	112.1	I64 R65 A66	I64-K68 WeakPolarHBondContact O-CB 3.47Å; I64-K68 PolarHBondContact O-N 2.99Å; R65-K68 PolarHBondContact O-N 3.3Å; A66-K68 VanDerWaalsContact C-N 3.34Å; A66-K68 PolarHBondContact O-N 2.89Å
69	L	64.6	Low	73.8	Confident	124 Å²	124	119.3 Å²	119.3	65%	0.649	58%	0.58	S	S	*	*	H	α-helix	trans	-81.1	-27.7	179.9	-162.5	73.3	0	0	0	112.7	R65 A66 R67 D71 D72	R65-L69 WeakPolarHBondContact O-CB 3.44Å; R65-L69 PolarHBondContact O-N 2.98Å; A66-L69 PolarHBondContact O-N 3.16Å; A66-L69 VanDerWaalsContact O-N 3.16Å; R67-L69 VanDerWaalsContact C-N 3.29Å; L69-D71 PolarHBondContact O-N 3Å; L69-D72 PolarHBondContact O-N 3.27Å
70	E	59.7	Low	72.2	Confident	162 Å²	162	122.4 Å²	122.4	76%	0.757	59%	0.592	S	S	*	*	H	α-helix	trans	-63.2	-28.3	174	-80.3	173.7	151.8	0	0	112.9	A66	A66-E70 PolarHBondContact O-N 3.35Å; A66-E70 VanDerWaalsContact O-N 3.09Å
71	D	59.8	Low	70.5	Confident	142 Å²	142	118.7 Å²	118.7	76%	0.759	58%	0.582	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.2	3.2	-179	-145.2	14.1	0	0	0	112.8	L69 H73	L69-D71 PolarHBondContact O-N 3Å; D71-H73 PolarHBondContact O-N 3.46Å
72	D	63.6	Low	68.9	Low	93 Å²	93	117.4 Å²	117.4	50%	0.497	58%	0.58	S	S	.	*			trans	-81.8	85.7	-179.3	-155.2	24.9	0	0	0	109.9	L69 D74	L69-D72 PolarHBondContact O-N 3.27Å; D72-D74 PolarHBondContact O-N 3.04Å
73	H	64.8	Low	67.2	Low	170 Å²	170	117.7 Å²	117.7	79%	0.787	58%	0.578	S	S	*	*			trans	-74.6	57.5	168.6	-114.1	61.6	0	0	0	110.3	D71 P75	D71-H73 PolarHBondContact O-N 3.46Å; H73-P75 WeakPolarHBondContact O-CD 3.45Å
74	D	69.7	Low	65.8	Low	60 Å²	60	119.5 Å²	119.5	32%	0.321	59%	0.587	S	S	.	*			trans	-69.9	119.7	175.8	-176.6	-8.3	0	0	0	109.6	D72 Y76 N77 M78	D72-D74 PolarHBondContact O-N 3.04Å; D74-Y76 PolarHBondContact O-N 3.09Å; D74-Y76 VanDerWaalsContact O-N 3.09Å; D74-Y76 WeakPolarHBondContact OD1-CD2 3.19Å; D74-Y76 PolarHBondContact OD1-N 3.47Å; D74-N77 HydrophobicContact CB-CB 4.32Å; D74-N77 PolarHBondContact O-N 3.26Å; D74-M78 PolarHBondContact O-N 2.88Å
75	P	67.5	Low	64.4	Low	86 Å²	86	124.2 Å²	124.2	56%	0.558	60%	0.598	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.6	-21	177.4	24.3	-35.9	0	0	0	114.2	H73	H73-P75 WeakPolarHBondContact O-CD 3.45Å
76	Y	63.2	Low	63.5	Low	183 Å²	183	119.4 Å²	119.4	72%	0.718	59%	0.59	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.1	-30.6	175.2	-64.7	-72.2	0	0	0	113.1	D74	D74-Y76 PolarHBondContact O-N 3.09Å; D74-Y76 VanDerWaalsContact O-N 3.09Å; D74-Y76 WeakPolarHBondContact OD1-CD2 3.19Å; D74-Y76 PolarHBondContact OD1-N 3.47Å
77	N	62.5	Low	62.9	Low	89 Å²	89	123.2 Å²	123.2	48%	0.476	60%	0.597	S	S	.	*	H	α-helix	trans	-77.2	-28.7	179.1	-166.2	36	0	0	0	112	D74 Y79 I80 A81	D74-N77 HydrophobicContact CB-CB 4.32Å; D74-N77 PolarHBondContact O-N 3.26Å; N77-Y79 PolarHBondContact O-N 3.44Å; N77-Y79 VanDerWaalsContact O-N 3.14Å; N77-I80 PolarHBondContact O-N 3.02Å; N77-A81 WeakPolarHBondContact O-CB 2.84Å; N77-A81 PolarHBondContact O-N 3.48Å; N77-A81 VanDerWaalsContact OD1-CB 3.22Å; N77-A81 WeakPolarHBondContact OD1-CB 2.88Å
78	M	63.2	Low	62.4	Low	110 Å²	110	123.1 Å²	123.1	54%	0.542	60%	0.601	S	S	.	*	H	α-helix	trans	-61	-26.7	-174.2	-161.6	165.9	76.3	0	0	114.1	D74	D74-M78 PolarHBondContact O-N 2.88Å
79	Y	59	Low	62.4	Low	179 Å²	179	119.2 Å²	119.2	70%	0.702	59%	0.588	S	S	*	*	H	α-helix	trans	-100	-25	179.5	-62.6	-77	0	0	0	113.7	N77 S82	N77-Y79 PolarHBondContact O-N 3.44Å; N77-Y79 VanDerWaalsContact O-N 3.14Å; Y79-S82 PolarHBondContact O-OG 3.47Å; Y79-S82 VanDerWaalsContact O-OG 3.09Å
80	I	59.6	Low	62.8	Low	140 Å²	140	122.4 Å²	122.4	72%	0.718	59%	0.592	S	S	*	*	H	α-helix	trans	-87.5	-39.3	-179.6	-57.9	173.3	0	0	0	111.1	N77 S82	N77-I80 PolarHBondContact O-N 3.02Å; I80-S82 VanDerWaalsContact C-N 3.29Å; I80-S82 PolarHBondContact O-N 2.96Å
81	A	58.6	Low	63.6	Low	48 Å²	48	117.6 Å²	117.6	40%	0.397	58%	0.579	S	S	.	*	S	Bend	trans	-90.3	14.9	-179.1	0	0	0	0	0	113.7	N77 D83	N77-A81 WeakPolarHBondContact O-CB 2.84Å; N77-A81 PolarHBondContact O-N 3.48Å; N77-A81 VanDerWaalsContact OD1-CB 3.22Å; N77-A81 WeakPolarHBondContact OD1-CB 2.88Å; A81-D83 PolarHBondContact O-N 3.43Å
82	S	56.6	Low	64.4	Low	59 Å²	59	117.5 Å²	117.5	41%	0.413	57%	0.569	S	S	.	*	S	Bend	trans	-64.5	78.8	174.5	56.4	0	0	0	0	110.5	Y79 I80 I84	Y79-S82 PolarHBondContact O-OG 3.47Å; Y79-S82 VanDerWaalsContact O-OG 3.09Å; I80-S82 VanDerWaalsContact C-N 3.29Å; I80-S82 PolarHBondContact O-N 2.96Å; S82-I84 WeakPolarHBondContact O-CB 3.38Å; S82-I84 WeakPolarHBondContact O-CD1 3.23Å; S82-I84 WeakPolarHBondContact O-CG1 3.45Å; S82-I84 PolarHBondContact O-N 3.44Å
83	D	56.6	Low	65.2	Low	100 Å²	100	119.6 Å²	119.6	54%	0.535	57%	0.574	S	S	.	*	S	Bend	trans	44.4	-3.1	151.2	-122.8	1.2	0	0	0	120.9	A81 K87	A81-D83 PolarHBondContact O-N 3.43Å; D83-K87 WeakPolarHBondContact OD1-CE 3.47Å; D83-K87 IonicContact OD1-NZ 2.81Å; D83-K87 PolarHBondContact OD1-NZ 2.79Å; D83-K87 IonicContact OD2-NZ 2.79Å; D83-K87 PolarHBondContact OD2-NZ 3.31Å
84	I	59.3	Low	65.8	Low	117 Å²	117	117.1 Å²	117.1	60%	0.6	56%	0.563	S	S	*	*	S	Bend	trans	-102.5	-39.5	-164.3	-62.2	160.7	0	0	0	110.3	S82 K88	S82-I84 WeakPolarHBondContact O-CB 3.38Å; S82-I84 WeakPolarHBondContact O-CD1 3.23Å; S82-I84 WeakPolarHBondContact O-CG1 3.45Å; S82-I84 PolarHBondContact O-N 3.44Å; I84-K88 WeakPolarHBondContact O-CB 3.42Å
85	W	58.3	Low	66.2	Low	197 Å²	197	117 Å²	117	75%	0.746	57%	0.571	S	S	*	*	H	α-helix	trans	-81.4	-48.4	-179.9	-75.6	34.7	0	0	0	112.9	K87 K88 D89	W85-K87 PolarHBondContact O-N 2.87Å; W85-K88 PolarHBondContact O-N 2.82Å; W85-D89 VanDerWaalsContact O-CB 3.28Å; W85-D89 WeakPolarHBondContact O-CB 3.27Å; W85-D89 VanDerWaalsContact O-CG 3.29Å; W85-D89 PolarHBondContact O-N 3Å
86	P	64.3	Low	66.8	Low	73 Å²	73	117.4 Å²	117.4	47%	0.474	56%	0.564	S	S	.	*	H	α-helix	trans	-65.5	-35.7	-174.1	-20	32	0	0	0	113.6	R90	P86-R90 WeakPolarHBondContact O-CB 3.05Å; P86-R90 PolarHBondContact O-N 3.36Å; P86-R90 VanDerWaalsContact O-N 3.14Å
87	K	64.4	Low	67.5	Low	128 Å²	128	113.5 Å²	113.5	56%	0.557	56%	0.555	S	S	*	*	H	α-helix	trans	-75.7	-42.9	-178.1	-72.9	176.3	177.7	162.3	0	111.9	D83 W85 A91	D83-K87 WeakPolarHBondContact OD1-CE 3.47Å; D83-K87 IonicContact OD1-NZ 2.81Å; D83-K87 PolarHBondContact OD1-NZ 2.79Å; D83-K87 IonicContact OD2-NZ 2.79Å; D83-K87 PolarHBondContact OD2-NZ 3.31Å; W85-K87 PolarHBondContact O-N 2.87Å; K87-A91 WeakPolarHBondContact O-CB 3.07Å; K87-A91 PolarHBondContact O-N 3.34Å
88	K	65.3	Low	68.1	Low	156 Å²	156	114 Å²	114	68%	0.678	56%	0.556	S	S	*	*	H	α-helix	trans	-71.2	-43.3	-179.9	-170.6	173.7	178.1	177	0	111.6	I84 W85 Y92	I84-K88 WeakPolarHBondContact O-CB 3.42Å; W85-K88 PolarHBondContact O-N 2.82Å; K88-Y92 VanDerWaalsContact O-CB 3.24Å; K88-Y92 WeakPolarHBondContact O-CB 3.2Å; K88-Y92 PolarHBondContact O-N 2.92Å
89	D	70.2	Confident	68.6	Low	88 Å²	88	115 Å²	115	47%	0.471	56%	0.56	S	S	.	*	H	α-helix	trans	-71.5	-35.7	-179.9	-66.9	-21.2	0	0	0	111.7	W85 F93	W85-D89 VanDerWaalsContact O-CB 3.28Å; W85-D89 WeakPolarHBondContact O-CB 3.27Å; W85-D89 VanDerWaalsContact O-CG 3.29Å; W85-D89 PolarHBondContact O-N 3Å; D89-F93 WeakPolarHBondContact O-CB 3.11Å; D89-F93 PolarHBondContact O-N 2.79Å
90	R	72.9	Confident	69.1	Low	191 Å²	191	110.1 Å²	110.1	72%	0.721	55%	0.545	S	S	*	.	H	α-helix	trans	-65.2	-47.2	175.3	-175.8	-176.5	-71.8	-133.6	1	111.9	P86 F93 Q94	P86-R90 WeakPolarHBondContact O-CB 3.05Å; P86-R90 PolarHBondContact O-N 3.36Å; P86-R90 VanDerWaalsContact O-N 3.14Å; R90-F93 PolarHBondContact O-N 3.29Å; R90-Q94 WeakPolarHBondContact O-CB 3.48Å; R90-Q94 PolarHBondContact O-N 3.34Å
91	A	75.6	Confident	69.5	Low	60 Å²	60	110.6 Å²	110.6	50%	0.496	54%	0.539	S	S	.	.	H	α-helix	trans	-64.8	-42	178.6	0	0	0	0	0	111.8	K87 A95	K87-A91 WeakPolarHBondContact O-CB 3.07Å; K87-A91 PolarHBondContact O-N 3.34Å; A91-A95 WeakPolarHBondContact O-CB 3.24Å; A91-A95 PolarHBondContact O-N 3.46Å
92	Y	78.1	Confident	69.6	Low	140 Å²	140	116.1 Å²	116.1	55%	0.549	55%	0.554	S	S	.	*	H	α-helix	trans	-64.1	-46	175.5	177.7	-101	0	0	0	112.1	K88 A95 K96	K88-Y92 VanDerWaalsContact O-CB 3.24Å; K88-Y92 WeakPolarHBondContact O-CB 3.2Å; K88-Y92 PolarHBondContact O-N 2.92Å; Y92-A95 PolarHBondContact O-N 2.79Å; Y92-K96 HydrophobicContact CE1-CD 3.82Å; Y92-K96 VanDerWaalsContact O-CB 3.27Å; Y92-K96 WeakPolarHBondContact O-CB 3.28Å; Y92-K96 PolarHBondContact O-N 3.01Å; Y92-K96 PolarHBondContact OH-NZ 3.14Å
93	F	79.1	Confident	69.9	Low	137 Å²	137	118.7 Å²	118.7	60%	0.601	56%	0.563	S	S	*	*	H	α-helix	trans	-65	-41.1	178.7	-172.2	-97.6	0	0	0	111.5	D89 R90 K96 L97	D89-F93 WeakPolarHBondContact O-CB 3.11Å; D89-F93 PolarHBondContact O-N 2.79Å; R90-F93 PolarHBondContact O-N 3.29Å; F93-K96 PolarHBondContact O-N 2.81Å; F93-L97 HydrophobicContact CE1-CD1 4.3Å; F93-L97 HydrophobicContact CZ-CD1 4.35Å; F93-L97 VanDerWaalsContact O-CB 3.23Å; F93-L97 WeakPolarHBondContact O-CB 3.33Å; F93-L97 PolarHBondContact O-N 3.18Å
94	Q	77.3	Confident	69.8	Low	119 Å²	119	119 Å²	119	56%	0.556	57%	0.572	S	S	*	*	H	α-helix	trans	-65.4	-43.5	178.3	-161.7	176.2	12.8	0	0	111.4	R90 L97 I98	R90-Q94 WeakPolarHBondContact O-CB 3.48Å; R90-Q94 PolarHBondContact O-N 3.34Å; Q94-L97 PolarHBondContact O-N 2.99Å; Q94-I98 HydrophobicContact CG-CD1 4.37Å; Q94-I98 WeakPolarHBondContact O-CB 3.22Å; Q94-I98 WeakPolarHBondContact O-CD1 3.33Å; Q94-I98 WeakPolarHBondContact O-CG1 3.35Å; Q94-I98 PolarHBondContact O-N 2.97Å
95	A	78.2	Confident	69.6	Low	58 Å²	58	118.8 Å²	118.8	48%	0.479	58%	0.579	S	S	.	*	H	α-helix	trans	-62.4	-42.5	173.6	0	0	0	0	0	112	A91 Y92 I98 E99	A91-A95 WeakPolarHBondContact O-CB 3.24Å; A91-A95 PolarHBondContact O-N 3.46Å; Y92-A95 PolarHBondContact O-N 2.79Å; A95-I98 PolarHBondContact O-N 3.37Å; A95-E99 PolarHBondContact O-N 2.92Å
96	K	79.9	Confident	69.5	Low	94 Å²	94	115 Å²	115	41%	0.409	58%	0.577	S	S	.	*	H	α-helix	trans	-72.2	-31	-179.3	-162.1	169.1	-168.6	178.3	0	113.2	Y92 F93 E99 N100	Y92-K96 HydrophobicContact CE1-CD 3.82Å; Y92-K96 VanDerWaalsContact O-CB 3.27Å; Y92-K96 WeakPolarHBondContact O-CB 3.28Å; Y92-K96 PolarHBondContact O-N 3.01Å; Y92-K96 PolarHBondContact OH-NZ 3.14Å; F93-K96 PolarHBondContact O-N 2.81Å; K96-E99 PolarHBondContact O-N 3.15Å; K96-N100 WeakPolarHBondContact O-CB 3.49Å; K96-N100 PolarHBondContact O-N 2.62Å; K96-N100 PolarHBondContact O-ND2 3.3Å
97	L	79.3	Confident	69	Low	101 Å²	101	121 Å²	121	53%	0.529	60%	0.597	S	S	.	*	H	α-helix	trans	-69.3	-42.4	172.8	-165.4	80.4	0	0	0	110.4	F93 Q94 E99 N100 Y101	F93-L97 HydrophobicContact CE1-CD1 4.3Å; F93-L97 HydrophobicContact CZ-CD1 4.35Å; F93-L97 VanDerWaalsContact O-CB 3.23Å; F93-L97 WeakPolarHBondContact O-CB 3.33Å; F93-L97 PolarHBondContact O-N 3.18Å; Q94-L97 PolarHBondContact O-N 2.99Å; L97-E99 VanDerWaalsContact C-N 3.26Å; L97-E99 PolarHBondContact O-N 2.7Å; L97-N100 PolarHBondContact O-N 3.44Å; L97-Y101 WeakPolarHBondContact O-CD1 3.18Å; L97-Y101 PolarHBondContact O-N 2.88Å
98	I	74.9	Confident	68.3	Low	99 Å²	99	123.8 Å²	123.8	51%	0.508	61%	0.611	S	S	.	*	H	α-helix	trans	-61.9	-35.4	174	-69.9	168.5	0	0	0	110.9	Q94 A95 Y101	Q94-I98 HydrophobicContact CG-CD1 4.37Å; Q94-I98 WeakPolarHBondContact O-CB 3.22Å; Q94-I98 WeakPolarHBondContact O-CD1 3.33Å; Q94-I98 WeakPolarHBondContact O-CG1 3.35Å; Q94-I98 PolarHBondContact O-N 2.97Å; A95-I98 PolarHBondContact O-N 3.37Å; I98-Y101 VanDerWaalsContact C-CD1 3.42Å; I98-Y101 HydrophobicContact CB-CD1 4.47Å; I98-Y101 HydrophobicContact CB-CE1 4.21Å; I98-Y101 HydrophobicContact CG2-CE1 3.92Å; I98-Y101 WeakPolarHBondContact O-CD1 3.37Å; I98-Y101 WeakPolarHBondContact O-CE1 3.18Å
99	E	72.4	Confident	67.9	Low	132 Å²	132	121.7 Å²	121.7	62%	0.617	61%	0.608	S	S	*	*	H	α-helix	trans	-73.4	-40.7	174.9	-164.3	177.2	-174	0	0	112.1	A95 K96 L97	A95-E99 PolarHBondContact O-N 2.92Å; K96-E99 PolarHBondContact O-N 3.15Å; L97-E99 VanDerWaalsContact C-N 3.26Å; L97-E99 PolarHBondContact O-N 2.7Å
100	N	70	Confident	67.1	Low	75 Å²	75	123.3 Å²	123.3	40%	0.401	62%	0.623	S	S	.	*	H	α-helix	trans	-77.4	-32.7	-176.4	-82.8	-74.7	0	0	0	114.6	K96 L97 K102 L103 C104	K96-N100 WeakPolarHBondContact O-CB 3.49Å; K96-N100 PolarHBondContact O-N 2.62Å; K96-N100 PolarHBondContact O-ND2 3.3Å; L97-N100 PolarHBondContact O-N 3.44Å; N100-K102 PolarHBondContact O-N 3.14Å; N100-L103 PolarHBondContact O-N 3.41Å; N100-C104 PolarHBondContact O-N 2.92Å
101	Y	68	Low	66	Low	151 Å²	151	121.2 Å²	121.2	59%	0.592	63%	0.626	S	S	*	*	H	α-helix	trans	-64.7	-31.3	-179.9	88.2	-81.6	0	0	0	112.3	L97 I98 L103	L97-Y101 WeakPolarHBondContact O-CD1 3.18Å; L97-Y101 PolarHBondContact O-N 2.88Å; I98-Y101 VanDerWaalsContact C-CD1 3.42Å; I98-Y101 HydrophobicContact CB-CD1 4.47Å; I98-Y101 HydrophobicContact CB-CE1 4.21Å; I98-Y101 HydrophobicContact CG2-CE1 3.92Å; I98-Y101 WeakPolarHBondContact O-CD1 3.37Å; I98-Y101 WeakPolarHBondContact O-CE1 3.18Å; Y101-L103 PolarHBondContact O-N 3.26Å
102	K	61.6	Low	64.6	Low	163 Å²	163	123.9 Å²	123.9	71%	0.709	64%	0.636	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.4	-24	175	-166.7	177.8	179.6	-175.2	0	111.9	N100	N100-K102 PolarHBondContact O-N 3.14Å
103	L	62.5	Low	63.2	Low	114 Å²	114	123.8 Å²	123.8	60%	0.597	65%	0.649	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.8	-26.2	-177.8	-63.3	170.2	0	0	0	113	N100 Y101 C105	N100-L103 PolarHBondContact O-N 3.41Å; Y101-L103 PolarHBondContact O-N 3.26Å; L103-C105 PolarHBondContact O-N 3.01Å
104	C	55.2	Low	61.7	Low	106 Å²	106	125 Å²	125	72%	0.716	66%	0.657	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.8	-11.2	178.6	-79.1	0	0	0	0	115.2	N100 V106	N100-C104 PolarHBondContact O-N 2.92Å; C104-V106 VanDerWaalsContact C-N 3.33Å
105	C	54.8	Low	60.4	Low	113 Å²	113	127.7 Å²	127.7	76%	0.764	67%	0.669	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.2	-7.2	179.4	-67.1	0	0	0	0	114.1	L103	L103-C105 PolarHBondContact O-N 3.01Å
106	V	54.7	Low	58.7	Low	116 Å²	116	130.7 Å²	130.7	70%	0.703	68%	0.684	S	S	*	*			trans	-134.1	80.2	-174.1	-173.5	0	0	0	0	110.2	C104	C104-V106 VanDerWaalsContact C-N 3.33Å
107	F	53.7	Low	57.2	Low	201 Å²	201	131.4 Å²	131.4	88%	0.882	69%	0.692	S	S	*	*			trans	-129.9	85.5	166.5	-158.3	-94.2	0	0	0	109.3
108	E	51.8	Low	55.6	Low	185 Å²	185	132.3 Å²	132.3	86%	0.864	70%	0.702	S	S	*	*			trans	-98.4	133.9	179	-133	171.1	-175.4	0	0	109.9
109	N	54.8	Low	54.6	Low	112 Å²	112	136 Å²	136	60%	0.599	72%	0.718	S	S	*	*			trans	-105.6	117.7	-170.9	-177.2	5.5	0	0	0	111.5	L111	N109-L111 VanDerWaalsContact C-N 3.33Å; N109-L111 PolarHBondContact O-N 3.09Å
110	P	53.4	Low	53.3	Low	123 Å²	123	137.6 Å²	137.6	80%	0.799	73%	0.729	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.2	9.9	-171.6	31.6	-36	0	0	0	116.3
111	L	51.4	Low	52.4	Low	147 Å²	147	139.3 Å²	139.3	77%	0.77	74%	0.744	S	S	*	*	T	Hydrogen-bonded Turn	trans	-106	12.8	-168.1	-69.5	-178.9	0	0	0	117.7	N109	N109-L111 VanDerWaalsContact C-N 3.33Å; N109-L111 PolarHBondContact O-N 3.09Å
112	T	45.8	Very low	51.5	Low	116 Å²	116	141.2 Å²	141.2	71%	0.712	76%	0.758	S	S	*	*			trans	-98	112.4	173.6	-49.1	0	0	0	0	111.2	E114	T112-E114 PolarHBondContact O-N 3.09Å; T112-E114 VanDerWaalsContact O-N 3.11Å
113	V	48.4	Very low	51.1	Low	137 Å²	137	139.8 Å²	139.8	83%	0.83	76%	0.762	S	S	*	*			trans	-72.4	91.5	166.1	173.8	0	0	0	0	108.1
114	E	47.1	Very low	50.2	Low	163 Å²	163	143.7 Å²	143.7	76%	0.762	78%	0.775	S	S	*	*			trans	-141.3	96.1	154.9	-79.1	-63.1	148	0	0	105.8	T112	T112-E114 PolarHBondContact O-N 3.09Å; T112-E114 VanDerWaalsContact O-N 3.11Å
115	Q	49.4	Very low	49.5	Very low	175 Å²	175	144.5 Å²	144.5	82%	0.818	78%	0.78	S	S	*	*			trans	-72.8	134.3	160.3	-81.5	-169.3	-29.8	0	0	107.3
116	P	43.9	Very low	49	Very low	122 Å²	122	148.3 Å²	148.3	79%	0.792	81%	0.808	S	S	*	*				-127.3	121.5	100.2	29.3	-17.6	0	0	0	111.1
117	N	48.5	Very low	48.7	Very low	108 Å²	108	150 Å²	150	58%	0.578	81%	0.813	S	S	*	*			trans	-33.1	131.5	157.2	-174.1	21.2	0	0	0	112.3
118	T	45.7	Very low	48.5	Very low	120 Å²	120	147.3 Å²	147.3	74%	0.736	81%	0.81	S	S	*	*				-176.5	103.5	109.6	31.5	0	0	0	0	110.5
119	Q	54.3	Low	48.3	Very low	178 Å²	178	145.2 Å²	145.2	83%	0.832	81%	0.807	S	S	*	*			trans	16.9	128.7	146.2	-65.2	172.1	0.1	0	0	118.3
120	I	45.2	Very low	47.9	Very low	165 Å²	165	147.1 Å²	147.1	85%	0.846	82%	0.819	S	S	*	*			trans	-129.2	133.2	147.5	-56.8	-179	0	0	0	108.3
121	P	51	Low	47.5	Very low	111 Å²	111	148.6 Å²	148.6	72%	0.721	82%	0.82	S	S	*	*	P	Polyproline II helix	trans	-94	149.8	-154.9	30.1	-20.1	0	0	0	114
122	E	49.1	Very low	47.3	Very low	191 Å²	191	148.7 Å²	148.7	89%	0.893	82%	0.824	S	S	*	*	P	Polyproline II helix	trans	-74.6	130.1	170.5	-73.6	-82.7	156.5	0	0	111
123	V	52.3	Low	47.4	Very low	132 Å²	132	151.1 Å²	151.1	80%	0.8	83%	0.832	S	S	*	*	P	Polyproline II helix	trans	-93	119.5	167	-155	0	0	0	0	108	C125	V123-C125 PolarHBondContact O-N 3.36Å
124	K	43.5	Very low	47.3	Very low	197 Å²	197	152.2 Å²	152.2	86%	0.857	83%	0.832	S	S	*	*			trans	-71.3	112.7	177.1	-170.3	176.6	-175	-176.1	0	109.9
125	C	41.2	Very low	47.3	Very low	122 Å²	122	151.3 Å²	151.3	82%	0.824	84%	0.838	S	S	*	*			trans	-74.4	131	164.9	-80.6	0	0	0	0	110.1	V123	V123-C125 PolarHBondContact O-N 3.36Å
126	S	43.7	Very low	47.1	Very low	194 Å²	194	149.1 Å²	149.1	100%	1.357	84%	0.84	S	S	*	*			trans	-60.7	0	176	-65.5	0	0	0	0	113.7

Retrieved 126 of 126 residues in 230.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).