A0A093HF77_STRCA Loading...

Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5

AlphaFold DB , UniProt , Accession A0A093HF77, Species STRCA (Struthio camelus australis), Gene n/a, Length 41 aa.

						>A0A093HF77_STRCA|A0A093HF77
VSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	V	57.1	Low	90.7	Very high	198 Å²	198	104.6 Å²	104.6	100%	1.2	59%	0.587	S	S	*	*				0	121.1	0	-135.8	0	0	0	0	106.9
2	S	84.5	Confident	91.2	Very high	86 Å²	86	102.3 Å²	102.3	60%	0.601	58%	0.581	S	S	*	*			trans	-99.4	164.5	-154.6	50.5	0	0	0	0	114.4	A4 A5	S2-A4 PolarHBondContact O-N 3.34Å; S2-A4 VanDerWaalsContact O-N 3.09Å; S2-A5 WeakPolarHBondContact O-CB 3.39Å; S2-A5 PolarHBondContact O-N 2.84Å
3	Q	91.4	Very high	91.5	Very high	133 Å²	133	103.2 Å²	103.2	62%	0.621	58%	0.582	S	S	*	*	H	α-helix	trans	-45	-39.1	178.3	-176.4	61.3	43.3	0	0	114	A5 A6 D7	Q3-A5 PolarHBondContact O-N 3.01Å; Q3-A5 VanDerWaalsContact O-N 3.15Å; Q3-A6 WeakPolarHBondContact O-CA 3.42Å; Q3-A6 WeakPolarHBondContact O-CB 3.44Å; Q3-A6 PolarHBondContact O-N 3.05Å; Q3-D7 PolarHBondContact NE2-OD1 2.9Å; Q3-D7 PolarHBondContact O-N 2.84Å
4	A	93.9	Very high	91.9	Very high	57 Å²	57	104.7 Å²	104.7	47%	0.471	58%	0.582	S	S	.	*	H	α-helix	trans	-56.4	-33.2	177.4	0	0	0	0	0	113.4	S2 L8	S2-A4 PolarHBondContact O-N 3.34Å; S2-A4 VanDerWaalsContact O-N 3.09Å; A4-L8 WeakPolarHBondContact O-CB 3.36Å; A4-L8 WeakPolarHBondContact O-CG 3.33Å; A4-L8 PolarHBondContact O-N 3.29Å
5	A	95.5	Very high	92.1	Very high	49 Å²	49	101.9 Å²	101.9	41%	0.405	57%	0.566	S	S	.	*	H	α-helix	trans	-71.5	-33.9	175.8	0	0	0	0	0	112.1	S2 Q3 K9	S2-A5 WeakPolarHBondContact O-CB 3.39Å; S2-A5 PolarHBondContact O-N 2.84Å; Q3-A5 PolarHBondContact O-N 3.01Å; Q3-A5 VanDerWaalsContact O-N 3.15Å; A5-K9 WeakPolarHBondContact O-CB 3.49Å; A5-K9 PolarHBondContact O-N 2.98Å
6	A	95.7	Very high	92.3	Very high	52 Å²	52	97.1 Å²	97.1	43%	0.43	54%	0.543	S	S	.	.	H	α-helix	trans	-68.9	-42	174.1	0	0	0	0	0	110.9	Q3 K9 Q10	Q3-A6 WeakPolarHBondContact O-CA 3.42Å; Q3-A6 WeakPolarHBondContact O-CB 3.44Å; Q3-A6 PolarHBondContact O-N 3.05Å; A6-K9 PolarHBondContact O-N 3.34Å; A6-Q10 WeakPolarHBondContact O-CB 3.35Å; A6-Q10 PolarHBondContact O-N 3.42Å
7	D	96.1	Very high	92.3	Very high	84 Å²	84	99.8 Å²	99.8	45%	0.449	55%	0.551	S	S	.	*	H	α-helix	trans	-65.1	-43.6	178.1	-59.3	-23.7	0	0	0	111.2	Q3 Q10 F11	Q3-D7 PolarHBondContact NE2-OD1 2.9Å; Q3-D7 PolarHBondContact O-N 2.84Å; D7-Q10 PolarHBondContact O-N 3.44Å; D7-F11 WeakPolarHBondContact O-CB 3.3Å; D7-F11 PolarHBondContact O-N 3.27Å
8	L	95.6	Very high	92.3	Very high	113 Å²	113	102.6 Å²	102.6	59%	0.592	56%	0.559	S	S	*	*	H	α-helix	trans	-60.1	-47	174	-81.5	167	0	0	0	111.7	A4 Q10 F11 C12	A4-L8 WeakPolarHBondContact O-CB 3.36Å; A4-L8 WeakPolarHBondContact O-CG 3.33Å; A4-L8 PolarHBondContact O-N 3.29Å; L8-Q10 VanDerWaalsContact C-N 3.29Å; L8-Q10 PolarHBondContact O-N 3.3Å; L8-F11 PolarHBondContact O-N 3.45Å; L8-C12 PolarHBondContact O-N 3.48Å; L8-C12 PolarHBondContact O-SG 2.96Å
9	K	94.8	Very high	92.3	Very high	140 Å²	140	100.3 Å²	100.3	61%	0.609	55%	0.546	S	S	*	.	H	α-helix	trans	-58.7	-44.7	176.6	178.7	-176.4	169.3	-177.4	0	110.9	A5 A6 C12 L13	A5-K9 WeakPolarHBondContact O-CB 3.49Å; A5-K9 PolarHBondContact O-N 2.98Å; A6-K9 PolarHBondContact O-N 3.34Å; K9-C12 PolarHBondContact O-N 2.94Å; K9-L13 HydrophobicContact CG-CD1 4.12Å; K9-L13 HydrophobicContact CG-CG 4.49Å; K9-L13 WeakPolarHBondContact O-CG 3.5Å; K9-L13 PolarHBondContact O-N 2.95Å
10	Q	96.3	Very high	92.3	Very high	117 Å²	117	98.8 Å²	98.8	55%	0.547	54%	0.541	S	S	.	.	H	α-helix	trans	-64.3	-43	-179.5	-173.4	134.7	-79.4	0	0	111.5	A6 D7 L8 C12 L13 Q14	A6-Q10 WeakPolarHBondContact O-CB 3.35Å; A6-Q10 PolarHBondContact O-N 3.42Å; D7-Q10 PolarHBondContact O-N 3.44Å; L8-Q10 VanDerWaalsContact C-N 3.29Å; L8-Q10 PolarHBondContact O-N 3.3Å; Q10-C12 PolarHBondContact O-N 3.39Å; Q10-L13 PolarHBondContact O-N 2.92Å; Q10-Q14 VanDerWaalsContact O-CG 3.3Å; Q10-Q14 WeakPolarHBondContact O-CG 3.39Å; Q10-Q14 PolarHBondContact O-N 2.9Å
11	F	96.3	Very high	92.2	Very high	122 Å²	122	101.7 Å²	101.7	54%	0.535	56%	0.555	S	S	.	*	H	α-helix	trans	-58.7	-47	174	176.4	-94.6	0	0	0	111.8	D7 L8 L13 Q14 N15	D7-F11 WeakPolarHBondContact O-CB 3.3Å; D7-F11 PolarHBondContact O-N 3.27Å; L8-F11 PolarHBondContact O-N 3.45Å; F11-L13 VanDerWaalsContact C-N 3.35Å; F11-L13 PolarHBondContact O-N 3.15Å; F11-Q14 PolarHBondContact O-N 3.09Å; F11-N15 WeakPolarHBondContact CD2-ND2 3.36Å; F11-N15 VanDerWaalsContact CE2-ND2 3.25Å; F11-N15 WeakPolarHBondContact CE2-ND2 3.3Å; F11-N15 PolarHBondContact O-N 3.47Å; F11-N15 VanDerWaalsContact O-N 3.11Å; F11-N15 PolarHBondContact O-ND2 3.32Å
12	C	96.6	Very high	94	Very high	76 Å²	76	98 Å²	98	51%	0.514	53%	0.528	S	S	.	.	H	α-helix	trans	-59.5	-45.2	177.4	-68.3	0	0	0	0	111.6	L8 K9 Q10 Q14 N15 A16	L8-C12 PolarHBondContact O-N 3.48Å; L8-C12 PolarHBondContact O-SG 2.96Å; K9-C12 PolarHBondContact O-N 2.94Å; Q10-C12 PolarHBondContact O-N 3.39Å; C12-Q14 PolarHBondContact O-N 3.26Å; C12-N15 PolarHBondContact O-N 3.04Å; C12-A16 WeakPolarHBondContact O-CA 3.48Å; C12-A16 VanDerWaalsContact O-CB 3.3Å; C12-A16 WeakPolarHBondContact O-CB 3.32Å; C12-A16 PolarHBondContact O-N 3.3Å
13	L	95.5	Very high	94.3	Very high	114 Å²	114	97 Å²	97	60%	0.597	52%	0.519	S	S	*	.	H	α-helix	trans	-64	-38.9	179.9	-70.8	173.5	0	0	0	112.7	K9 Q10 F11 N15	K9-L13 HydrophobicContact CG-CD1 4.12Å; K9-L13 HydrophobicContact CG-CG 4.49Å; K9-L13 WeakPolarHBondContact O-CG 3.5Å; K9-L13 PolarHBondContact O-N 2.95Å; Q10-L13 PolarHBondContact O-N 2.92Å; F11-L13 VanDerWaalsContact C-N 3.35Å; F11-L13 PolarHBondContact O-N 3.15Å; L13-N15 VanDerWaalsContact C-N 3.33Å
14	Q	96.6	Very high	94.2	Very high	125 Å²	125	93 Å²	93	58%	0.584	51%	0.512	S	S	*	.	H	α-helix	trans	-67.4	-33.9	178	-71.9	172.6	5.4	0	0	112.4	Q10 F11 C12	Q10-Q14 VanDerWaalsContact O-CG 3.3Å; Q10-Q14 WeakPolarHBondContact O-CG 3.39Å; Q10-Q14 PolarHBondContact O-N 2.9Å; F11-Q14 PolarHBondContact O-N 3.09Å; C12-Q14 PolarHBondContact O-N 3.26Å
15	N	96.1	Very high	94.1	Very high	62 Å²	62	93.7 Å²	93.7	33%	0.332	51%	0.511	S	S	.	.	H	α-helix	trans	-97.9	-10.5	-176.4	-68.4	-81.2	0	0	0	113.8	F11 C12 L13 Q17 H18 D19	F11-N15 WeakPolarHBondContact CD2-ND2 3.36Å; F11-N15 VanDerWaalsContact CE2-ND2 3.25Å; F11-N15 WeakPolarHBondContact CE2-ND2 3.3Å; F11-N15 PolarHBondContact O-N 3.47Å; F11-N15 VanDerWaalsContact O-N 3.11Å; F11-N15 PolarHBondContact O-ND2 3.32Å; C12-N15 PolarHBondContact O-N 3.04Å; L13-N15 VanDerWaalsContact C-N 3.33Å; N15-Q17 PolarHBondContact O-N 3.11Å; N15-Q17 VanDerWaalsContact O-N 3.11Å; N15-H18 WeakPolarHBondContact O-CA 3.12Å; N15-H18 PolarHBondContact O-N 3.33Å; N15-D19 PolarHBondContact O-N 3.01Å
16	A	95.2	Very high	93.7	Very high	25 Å²	25	94.5 Å²	94.5	21%	0.207	51%	0.514	C	S	.	.	G	3₁₀ helix	trans	-55.3	-34.6	-176.8	0	0	0	0	0	112.9	C12 H18 D19 L22	C12-A16 WeakPolarHBondContact O-CA 3.48Å; C12-A16 VanDerWaalsContact O-CB 3.3Å; C12-A16 WeakPolarHBondContact O-CB 3.32Å; C12-A16 PolarHBondContact O-N 3.3Å; A16-H18 VanDerWaalsContact C-N 3.27Å; A16-H18 PolarHBondContact O-N 2.88Å; A16-D19 PolarHBondContact O-N 3.11Å; A16-L22 HydrophobicContact CB-CD1 4.13Å
17	Q	92.4	Very high	93.1	Very high	143 Å²	143	95.4 Å²	95.4	67%	0.668	52%	0.517	S	S	*	.	G	3₁₀ helix	trans	-69.6	-25.4	178.1	-65.1	-59.6	-58.2	0	0	113.3	N15 T23	N15-Q17 PolarHBondContact O-N 3.11Å; N15-Q17 VanDerWaalsContact O-N 3.11Å; Q17-T23 WeakPolarHBondContact O-CG2 3.25Å; Q17-T23 PolarHBondContact O-OG1 3.07Å
18	H	91.1	Very high	92.5	Very high	150 Å²	150	96.1 Å²	96.1	69%	0.694	53%	0.528	S	S	*	.	G	3₁₀ helix	trans	-91.4	-6	178.7	-57.7	148	0	0	0	113	N15 A16 P20	N15-H18 WeakPolarHBondContact O-CA 3.12Å; N15-H18 PolarHBondContact O-N 3.33Å; A16-H18 VanDerWaalsContact C-N 3.27Å; A16-H18 PolarHBondContact O-N 2.88Å; H18-P20 WeakPolarHBondContact O-CD 3.17Å
19	D	94	Very high	92.1	Very high	60 Å²	60	95.2 Å²	95.2	32%	0.321	53%	0.528	S	S	.	.			trans	-83.1	107.5	176	-171.5	-25.9	0	0	0	109.8	N15 A16 L21 L22 T23	N15-D19 PolarHBondContact O-N 3.01Å; A16-D19 PolarHBondContact O-N 3.11Å; D19-L21 PolarHBondContact O-N 2.89Å; D19-L21 VanDerWaalsContact O-N 3.08Å; D19-L21 VanDerWaalsContact OD1-CB 3.32Å; D19-L21 WeakPolarHBondContact OD1-CB 3.48Å; D19-L21 PolarHBondContact OD1-N 3.01Å; D19-L22 HydrophobicContact CB-CB 4.11Å; D19-L22 HydrophobicContact CB-CD1 3.95Å; D19-L22 HydrophobicContact CB-CG 3.95Å; D19-L22 PolarHBondContact O-N 2.91Å; D19-T23 PolarHBondContact O-N 3.08Å; D19-T23 PolarHBondContact O-OG1 2.85Å; D19-T23 VanDerWaalsContact O-OG1 3.07Å
20	P	91.4	Very high	91.8	Very high	69 Å²	69	91.2 Å²	91.2	45%	0.448	51%	0.513	S	S	.	.	H	α-helix	trans	-59.6	-22.8	-178.8	-26.2	39.8	0	0	0	113.8	H18 G24 V25	H18-P20 WeakPolarHBondContact O-CD 3.17Å; P20-G24 CarbonylContact O-C 3.51Å; P20-G24 WeakPolarHBondContact O-CA 3.42Å; P20-G24 PolarHBondContact O-N 2.82Å; P20-V25 HydrophobicContact CB-CG1 3.65Å; P20-V25 HydrophobicContact CB-CG2 4.42Å; P20-V25 HydrophobicContact CG-CG1 4.34Å
21	L	91.2	Very high	91.4	Very high	160 Å²	160	91.2 Å²	91.2	84%	0.838	52%	0.523	S	S	*	.	H	α-helix	trans	-81.4	-25.1	179.8	-56.6	179.4	0	0	0	111.8	D19	D19-L21 PolarHBondContact O-N 2.89Å; D19-L21 VanDerWaalsContact O-N 3.08Å; D19-L21 VanDerWaalsContact OD1-CB 3.32Å; D19-L21 WeakPolarHBondContact OD1-CB 3.48Å; D19-L21 PolarHBondContact OD1-N 3.01Å
22	L	93.2	Very high	91	Very high	121 Å²	121	94.2 Å²	94.2	63%	0.634	54%	0.536	S	S	*	.	H	α-helix	trans	-89.4	-42	177.2	-62.9	-177.6	0	0	0	112.3	A16 D19	A16-L22 HydrophobicContact CB-CD1 4.13Å; D19-L22 HydrophobicContact CB-CB 4.11Å; D19-L22 HydrophobicContact CB-CD1 3.95Å; D19-L22 HydrophobicContact CB-CG 3.95Å; D19-L22 PolarHBondContact O-N 2.91Å
23	T	92.3	Very high	90.4	Very high	66 Å²	66	94.8 Å²	94.8	41%	0.405	53%	0.528	S	S	.	.	H	α-helix	trans	-92.2	-16.3	-178.6	52.1	0	0	0	0	113.9	Q17 D19	Q17-T23 WeakPolarHBondContact O-CG2 3.25Å; Q17-T23 PolarHBondContact O-OG1 3.07Å; D19-T23 PolarHBondContact O-N 3.08Å; D19-T23 PolarHBondContact O-OG1 2.85Å; D19-T23 VanDerWaalsContact O-OG1 3.07Å
24	G	89.5	Confident	89.8	Confident	47 Å²	47	94.4 Å²	94.4	49%	0.485	53%	0.532	S	S	.	.			trans	72.9	157.6	-169	0	0	0	0	0	111.7	P20	P20-G24 CarbonylContact O-C 3.51Å; P20-G24 WeakPolarHBondContact O-CA 3.42Å; P20-G24 PolarHBondContact O-N 2.82Å
25	V	90.2	Very high	88.9	Confident	72 Å²	72	97 Å²	97	44%	0.436	54%	0.544	S	S	.	.			trans	-129	151.5	175.2	-76.4	0	0	0	0	110.7	P20 N30	P20-V25 HydrophobicContact CB-CG1 3.65Å; P20-V25 HydrophobicContact CB-CG2 4.42Å; P20-V25 HydrophobicContact CG-CG1 4.34Å; V25-N30 HydrophobicContact CG2-CB 3.87Å
26	S	87.6	Confident	87.9	Confident	67 Å²	67	102 Å²	102	47%	0.469	56%	0.563	S	S	.	*			trans	-55.5	145.4	170.7	172.1	0	0	0	0	110.4	S28 T29 N30	S26-S28 PolarHBondContact O-N 2.93Å; S26-S28 VanDerWaalsContact O-N 3.11Å; S26-S28 PolarHBondContact OG-N 3.16Å; S26-S28 VanDerWaalsContact OG-N 3.16Å; S26-S28 PolarHBondContact OG-OG 3.26Å; S26-T29 PolarHBondContact O-N 3.11Å; S26-T29 VanDerWaalsContact O-N 3.07Å; S26-T29 PolarHBondContact O-OG1 3.1Å; S26-N30 PolarHBondContact O-N 3.17Å; S26-N30 VanDerWaalsContact O-N 3.1Å
27	S	83.3	Confident	87	Confident	71 Å²	71	106.3 Å²	106.3	50%	0.497	59%	0.586	S	S	.	*	T	Hydrogen-bonded Turn	trans	-54.7	-29.2	171.5	-71	0	0	0	0	113.1	R33	S27-R33 WeakPolarHBondContact O-CD 3.26Å; S27-R33 WeakPolarHBondContact O-CG 3.33Å
28	S	84	Confident	86.2	Confident	98 Å²	98	104.9 Å²	104.9	69%	0.685	59%	0.591	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76	-26.6	179.6	55.6	0	0	0	0	113.7	S26	S26-S28 PolarHBondContact O-N 2.93Å; S26-S28 VanDerWaalsContact O-N 3.11Å; S26-S28 PolarHBondContact OG-N 3.16Å; S26-S28 VanDerWaalsContact OG-N 3.16Å; S26-S28 PolarHBondContact OG-OG 3.26Å
29	T	86.8	Confident	85.3	Confident	94 Å²	94	102.3 Å²	102.3	58%	0.577	59%	0.59	S	S	*	*	T	Hydrogen-bonded Turn	trans	-101.3	-7.1	-177.7	58.3	0	0	0	0	112.8	S26 P31	S26-T29 PolarHBondContact O-N 3.11Å; S26-T29 VanDerWaalsContact O-N 3.07Å; S26-T29 PolarHBondContact O-OG1 3.1Å; T29-P31 WeakPolarHBondContact O-CD 3.21Å
30	N	88.7	Confident	84.1	Confident	57 Å²	57	109 Å²	109	31%	0.305	62%	0.616	S	S	.	*			trans	-79.1	114	175.9	-178.6	-2.2	0	0	0	110.9	V25 S26 F32 R33	V25-N30 HydrophobicContact CG2-CB 3.87Å; S26-N30 PolarHBondContact O-N 3.17Å; S26-N30 VanDerWaalsContact O-N 3.1Å; N30-F32 PolarHBondContact O-N 3.24Å; N30-F32 WeakPolarHBondContact OD1-CB 3.47Å; N30-F32 PolarHBondContact OD1-N 3.07Å; N30-R33 HydrophobicContact CB-CB 4.18Å; N30-R33 VanDerWaalsContact O-CB 3.26Å; N30-R33 WeakPolarHBondContact O-CB 3.47Å; N30-R33 PolarHBondContact O-N 3.24Å
31	P	86.7	Confident	82.9	Confident	117 Å²	117	117.2 Å²	117.2	76%	0.76	66%	0.655	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.6	-18.5	-179.1	29.4	-35.3	0	0	0	113.5	T29 R33	T29-P31 WeakPolarHBondContact O-CD 3.21Å; P31-R33 VanDerWaalsContact C-N 3.34Å
32	F	89.3	Confident	82.5	Confident	184 Å²	184	115.1 Å²	115.1	81%	0.807	65%	0.646	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.9	-0.3	177.7	-60.8	-76.9	0	0	0	113.2	N30	N30-F32 PolarHBondContact O-N 3.24Å; N30-F32 WeakPolarHBondContact OD1-CB 3.47Å; N30-F32 PolarHBondContact OD1-N 3.07Å
33	R	84.4	Confident	81.9	Confident	89 Å²	89	114.7 Å²	114.7	34%	0.336	65%	0.646	S	S	.	*	S	Bend	trans	-67.4	130.7	-178.8	-169.5	-123.5	-167.5	168.4	7.8	109.9	S27 N30 P31 Q35	S27-R33 WeakPolarHBondContact O-CD 3.26Å; S27-R33 WeakPolarHBondContact O-CG 3.33Å; N30-R33 HydrophobicContact CB-CB 4.18Å; N30-R33 VanDerWaalsContact O-CB 3.26Å; N30-R33 WeakPolarHBondContact O-CB 3.47Å; N30-R33 PolarHBondContact O-N 3.24Å; P31-R33 VanDerWaalsContact C-N 3.34Å; R33-Q35 PolarHBondContact O-N 3.34Å
34	P	82.3	Confident	81.4	Confident	106 Å²	106	117.4 Å²	117.4	69%	0.688	66%	0.66	S	S	*	*	P	Polyproline II helix	trans	-56.2	135.5	172.8	-24.4	33.3	0	0	0	110.8	K36	P34-K36 PolarHBondContact O-N 3.04Å
35	Q	78.4	Confident	80.9	Confident	179 Å²	179	121.6 Å²	121.6	84%	0.836	67%	0.67	S	S	*	*	P	Polyproline II helix	trans	-61.6	123	174.8	-68	-171	2.5	0	0	108.8	R33 V37	R33-Q35 PolarHBondContact O-N 3.34Å; Q35-V37 PolarHBondContact O-N 3.18Å
36	K	73.9	Confident	80.3	Confident	168 Å²	168	124.7 Å²	124.7	73%	0.73	69%	0.685	S	S	*	*			trans	-73	98.7	167.3	-74.1	-166.3	173.7	-175.5	0	107	P34 C38	P34-K36 PolarHBondContact O-N 3.04Å; K36-C38 PolarHBondContact O-N 3.38Å
37	V	77.3	Confident	79.8	Confident	114 Å²	114	128.5 Å²	128.5	69%	0.691	70%	0.699	S	S	*	*			trans	-70.6	117.2	163.6	-66.5	0	0	0	0	107	Q35 S39	Q35-V37 PolarHBondContact O-N 3.18Å; V37-S39 PolarHBondContact O-N 3.2Å
38	C	74.4	Confident	79.6	Confident	114 Å²	114	132.6 Å²	132.6	77%	0.77	71%	0.714	S	S	*	*			trans	-80	98.8	168	-130.7	0	0	0	0	105.9	K36 F40	K36-C38 PolarHBondContact O-N 3.38Å; C38-F40 PolarHBondContact O-N 3.3Å
39	S	72.1	Confident	79.2	Confident	95 Å²	95	135.3 Å²	135.3	66%	0.664	72%	0.716	S	S	*	*			trans	-72.9	112	170.9	-62.9	0	0	0	0	108.1	V37 L41	V37-S39 PolarHBondContact O-N 3.2Å; S39-L41 PolarHBondContact O-N 3.28Å
40	F	69.6	Low	78.6	Confident	202 Å²	202	138.8 Å²	138.8	89%	0.886	73%	0.728	S	S	*	*			trans	-73.5	104.7	163.7	-67.2	-85.9	0	0	0	106.8	C38	C38-F40 PolarHBondContact O-N 3.3Å
41	L	66.3	Low	77.7	Confident	240 Å²	240	146.2 Å²	146.2	100%	1.257	77%	0.766	S	S	*	*			trans	-85.7	0	165	-78.1	168.5	0	0	0	109.2	S39	S39-L41 PolarHBondContact O-N 3.28Å

Retrieved 41 of 41 residues in 325.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).