A0A093HNC5_STRCA Loading...

F237A protein

AlphaFold DB , UniProt , Accession A0A093HNC5, Species STRCA (Struthio camelus australis), Gene n/a, Length 122 aa.

						>A0A093HNC5_STRCA|A0A093HNC5
MEVEWRRRWYLQLGCILILNLVYANLDYQKETPASLGQIDHQCWEMSSHGLVEMKKLKVADTVIALWDFMMFLKESPKPKHNELFNDLAQNFWDMYVDCVLSRSHGMGRRQLIAPKYFSTYS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.9	Low	71	Confident	205 Å²	205	150.6 Å²	150.6	100%	1.01	65%	0.654	S	S	*	*				0	-26.9	0	-61.7	-154.4	-67.3	0	0	113.5	W5	M1-W5 PolarHBondContact O-N 3.2Å
2	E	60.4	Low	72.2	Confident	155 Å²	155	147.6 Å²	147.6	72%	0.724	64%	0.644	S	S	*	*	H	α-helix	trans	-72.8	-28.5	179.7	-74.7	155.8	136.4	0	0	115.2	W5 R6	E2-W5 PolarHBondContact O-N 3.14Å; E2-R6 PolarHBondContact O-N 2.72Å
3	V	61.8	Low	73.5	Confident	116 Å²	116	143.5 Å²	143.5	70%	0.703	63%	0.632	S	S	*	*	H	α-helix	trans	-69.4	-40.7	-179.5	-179.7	0	0	0	0	111.5	R7	V3-R7 WeakPolarHBondContact O-CB 3.45Å; V3-R7 PolarHBondContact O-N 2.87Å
4	E	61.6	Low	74.8	Confident	121 Å²	121	135.2 Å²	135.2	57%	0.565	61%	0.607	S	S	*	*	H	α-helix	trans	-69.7	-36.3	176.8	-65.4	-179.3	148	0	0	111.8	R7 R8	E4-R7 PolarHBondContact O-N 3.44Å; E4-R8 WeakPolarHBondContact O-CB 3.27Å; E4-R8 PolarHBondContact O-N 2.96Å
5	W	63.2	Low	75.8	Confident	162 Å²	162	130.7 Å²	130.7	61%	0.614	60%	0.597	S	S	*	*	H	α-helix	trans	-63	-52.6	174.2	-162.1	78.6	0	0	0	110.1	M1 E2 R7 R8 W9	M1-W5 PolarHBondContact O-N 3.2Å; E2-W5 PolarHBondContact O-N 3.14Å; W5-R7 VanDerWaalsContact C-N 3.34Å; W5-R7 PolarHBondContact O-N 3.13Å; W5-R8 WeakPolarHBondContact O-CB 3.48Å; W5-R8 PolarHBondContact O-N 3.3Å; W5-R8 VanDerWaalsContact O-N 3.1Å; W5-W9 AromaticContact CD2-CD1 3.46Å; W5-W9 VanDerWaalsContact CD2-CD1 3.46Å; W5-W9 AromaticContact CD2-NE1 3.14Å; W5-W9 AromaticContact CE2-CD1 3.79Å; W5-W9 AromaticContact CE2-CE2 3.91Å; W5-W9 AromaticContact CE2-NE1 2.94Å; W5-W9 AromaticContact CE3-CD1 3.41Å; W5-W9 VanDerWaalsContact CE3-CD1 3.41Å; W5-W9 AromaticContact CE3-NE1 3.39Å; W5-W9 AromaticContact CG-NE1 3.88Å; W5-W9 AromaticContact CH2-CD1 3.99Å; W5-W9 AromaticContact CH2-CE2 3.73Å; W5-W9 AromaticContact CH2-CZ2 3.94Å; W5-W9 HydrophobicContact CH2-CZ2 3.94Å; W5-W9 AromaticContact CH2-NE1 3.26Å; W5-W9 VanDerWaalsContact CH2-NE1 3.26Å; W5-W9 AromaticContact CZ2-CE2 3.59Å; W5-W9 AromaticContact CZ2-CZ2 3.65Å; W5-W9 HydrophobicContact CZ2-CZ2 3.65Å; W5-W9 AromaticContact CZ2-NE1 3.03Å; W5-W9 AromaticContact CZ3-CD1 3.68Å; W5-W9 AromaticContact CZ3-NE1 3.43Å; W5-W9 AromaticContact NE1-NE1 3.51Å; W5-W9 PolarHBondContact O-N 3.16Å
6	R	71.4	Confident	76.8	Confident	154 Å²	154	127.9 Å²	127.9	58%	0.581	59%	0.588	S	S	*	*	H	α-helix	trans	-56.6	-44.6	174.3	-77.8	-173.8	-162.5	-136.7	3.4	112.4	E2 R8 W9 Y10	E2-R6 PolarHBondContact O-N 2.72Å; R6-R8 VanDerWaalsContact C-N 3.28Å; R6-R8 PolarHBondContact O-N 2.98Å; R6-W9 PolarHBondContact O-N 2.79Å; R6-W9 VanDerWaalsContact O-N 3.16Å; R6-Y10 HydrophobicContact CB-CD2 4.27Å; R6-Y10 HydrophobicContact CB-CE2 4.01Å; R6-Y10 WeakPolarHBondContact O-CD2 3.39Å; R6-Y10 PolarHBondContact O-N 3.48Å
7	R	75.4	Confident	77.5	Confident	159 Å²	159	127.7 Å²	127.7	60%	0.6	59%	0.591	S	S	*	*	H	α-helix	trans	-59	-40.5	177.3	-169.3	177.6	73.2	-159.4	0.2	111.8	V3 E4 W5 Y10 L11	V3-R7 WeakPolarHBondContact O-CB 3.45Å; V3-R7 PolarHBondContact O-N 2.87Å; E4-R7 PolarHBondContact O-N 3.44Å; W5-R7 VanDerWaalsContact C-N 3.34Å; W5-R7 PolarHBondContact O-N 3.13Å; R7-Y10 PolarHBondContact O-N 3.02Å; R7-L11 HydrophobicContact CG-CD1 4.35Å; R7-L11 WeakPolarHBondContact O-CB 3.3Å; R7-L11 WeakPolarHBondContact O-CD1 3.49Å; R7-L11 WeakPolarHBondContact O-CG 3.31Å; R7-L11 PolarHBondContact O-N 3.3Å
8	R	78.3	Confident	78.1	Confident	184 Å²	184	126.6 Å²	126.6	69%	0.694	59%	0.589	S	S	*	*	H	α-helix	trans	-67.5	-38.9	176.3	-167.6	172.4	175.9	175.2	-2.1	111.9	E4 W5 R6 L11 Q12	E4-R8 WeakPolarHBondContact O-CB 3.27Å; E4-R8 PolarHBondContact O-N 2.96Å; W5-R8 WeakPolarHBondContact O-CB 3.48Å; W5-R8 PolarHBondContact O-N 3.3Å; W5-R8 VanDerWaalsContact O-N 3.1Å; R6-R8 VanDerWaalsContact C-N 3.28Å; R6-R8 PolarHBondContact O-N 2.98Å; R8-L11 PolarHBondContact O-N 3.47Å; R8-Q12 VanDerWaalsContact O-CG 3.22Å; R8-Q12 WeakPolarHBondContact O-CG 3.45Å; R8-Q12 PolarHBondContact O-N 3.32Å
9	W	83.4	Confident	78.6	Confident	132 Å²	132	126.3 Å²	126.3	50%	0.5	59%	0.592	S	S	.	*	H	α-helix	trans	-65.7	-43.6	173.4	-75.7	102.6	0	0	0	112.9	W5 R6 L11 Q12 L13	W5-W9 AromaticContact CD2-CD1 3.46Å; W5-W9 VanDerWaalsContact CD2-CD1 3.46Å; W5-W9 AromaticContact CD2-NE1 3.14Å; W5-W9 AromaticContact CE2-CD1 3.79Å; W5-W9 AromaticContact CE2-CE2 3.91Å; W5-W9 AromaticContact CE2-NE1 2.94Å; W5-W9 AromaticContact CE3-CD1 3.41Å; W5-W9 VanDerWaalsContact CE3-CD1 3.41Å; W5-W9 AromaticContact CE3-NE1 3.39Å; W5-W9 AromaticContact CG-NE1 3.88Å; W5-W9 AromaticContact CH2-CD1 3.99Å; W5-W9 AromaticContact CH2-CE2 3.73Å; W5-W9 AromaticContact CH2-CZ2 3.94Å; W5-W9 HydrophobicContact CH2-CZ2 3.94Å; W5-W9 AromaticContact CH2-NE1 3.26Å; W5-W9 VanDerWaalsContact CH2-NE1 3.26Å; W5-W9 AromaticContact CZ2-CE2 3.59Å; W5-W9 AromaticContact CZ2-CZ2 3.65Å; W5-W9 HydrophobicContact CZ2-CZ2 3.65Å; W5-W9 AromaticContact CZ2-NE1 3.03Å; W5-W9 AromaticContact CZ3-CD1 3.68Å; W5-W9 AromaticContact CZ3-NE1 3.43Å; W5-W9 AromaticContact NE1-NE1 3.51Å; W5-W9 PolarHBondContact O-N 3.16Å; R6-W9 PolarHBondContact O-N 2.79Å; R6-W9 VanDerWaalsContact O-N 3.16Å; W9-L11 VanDerWaalsContact C-N 3.32Å; W9-L11 PolarHBondContact O-N 3.35Å; W9-Q12 PolarHBondContact O-N 2.91Å; W9-L13 WeakPolarHBondContact O-CB 3.47Å; W9-L13 WeakPolarHBondContact O-CG 3.15Å; W9-L13 PolarHBondContact O-N 3.41Å
10	Y	86.6	Confident	78.9	Confident	160 Å²	160	124.9 Å²	124.9	63%	0.627	59%	0.588	S	S	*	*	H	α-helix	trans	-62.8	-39.3	176.1	-73.3	-60.9	0	0	0	112.1	R6 R7 G14	R6-Y10 HydrophobicContact CB-CD2 4.27Å; R6-Y10 HydrophobicContact CB-CE2 4.01Å; R6-Y10 WeakPolarHBondContact O-CD2 3.39Å; R6-Y10 PolarHBondContact O-N 3.48Å; R7-Y10 PolarHBondContact O-N 3.02Å; Y10-G14 PolarHBondContact O-N 2.75Å
11	L	87.3	Confident	79.1	Confident	109 Å²	109	124.4 Å²	124.4	57%	0.571	59%	0.589	S	S	*	*	H	α-helix	trans	-62.6	-45.4	173.6	-80.9	161.1	0	0	0	111.9	R7 R8 W9 G14 C15	R7-L11 HydrophobicContact CG-CD1 4.35Å; R7-L11 WeakPolarHBondContact O-CB 3.3Å; R7-L11 WeakPolarHBondContact O-CD1 3.49Å; R7-L11 WeakPolarHBondContact O-CG 3.31Å; R7-L11 PolarHBondContact O-N 3.3Å; R8-L11 PolarHBondContact O-N 3.47Å; W9-L11 VanDerWaalsContact C-N 3.32Å; W9-L11 PolarHBondContact O-N 3.35Å; L11-G14 PolarHBondContact O-N 3.19Å; L11-C15 PolarHBondContact O-N 2.73Å; L11-C15 PolarHBondContact O-SG 2.95Å
12	Q	85.2	Confident	80.6	Confident	114 Å²	114	119 Å²	119	53%	0.533	57%	0.567	S	S	.	*	H	α-helix	trans	-62.9	-45.3	177.8	-71.1	-77.2	-64.3	0	0	111.9	R8 W9 G14 C15 I16	R8-Q12 VanDerWaalsContact O-CG 3.22Å; R8-Q12 WeakPolarHBondContact O-CG 3.45Å; R8-Q12 PolarHBondContact O-N 3.32Å; W9-Q12 PolarHBondContact O-N 2.91Å; Q12-G14 VanDerWaalsContact C-N 3.34Å; Q12-G14 PolarHBondContact O-N 3.32Å; Q12-C15 PolarHBondContact O-N 3.05Å; Q12-I16 VanDerWaalsContact O-CG1 3.3Å; Q12-I16 WeakPolarHBondContact O-CG1 3.48Å; Q12-I16 PolarHBondContact O-N 3.16Å
13	L	89.6	Confident	81.4	Confident	94 Å²	94	118.9 Å²	118.9	49%	0.492	56%	0.561	S	S	.	*	H	α-helix	trans	-63	-40.8	176.4	-70.7	171	0	0	0	111.7	W9 I16 L17	W9-L13 WeakPolarHBondContact O-CB 3.47Å; W9-L13 WeakPolarHBondContact O-CG 3.15Å; W9-L13 PolarHBondContact O-N 3.41Å; L13-I16 PolarHBondContact O-N 3.27Å; L13-L17 WeakPolarHBondContact O-CB 3.49Å; L13-L17 WeakPolarHBondContact O-CG 3.44Å; L13-L17 PolarHBondContact O-N 2.86Å
14	G	90.8	Very high	81.9	Confident	28 Å²	28	116.2 Å²	116.2	29%	0.289	55%	0.551	S	S	.	*	H	α-helix	trans	-60.4	-45.5	173.9	0	0	0	0	0	112.5	Y10 L11 Q12 I16 L17 I18	Y10-G14 PolarHBondContact O-N 2.75Å; L11-G14 PolarHBondContact O-N 3.19Å; Q12-G14 VanDerWaalsContact C-N 3.34Å; Q12-G14 PolarHBondContact O-N 3.32Å; G14-I16 PolarHBondContact O-N 2.99Å; G14-L17 PolarHBondContact O-N 3.33Å; G14-I18 VanDerWaalsContact O-CG1 3.31Å; G14-I18 WeakPolarHBondContact O-CG1 3.34Å; G14-I18 PolarHBondContact O-N 2.82Å
15	C	90.6	Very high	82.4	Confident	67 Å²	67	115.5 Å²	115.5	45%	0.453	55%	0.551	S	S	.	*	H	α-helix	trans	-62	-42.9	176	-69.8	0	0	0	0	112.2	L11 Q12 L17 I18 L19	L11-C15 PolarHBondContact O-N 2.73Å; L11-C15 PolarHBondContact O-SG 2.95Å; Q12-C15 PolarHBondContact O-N 3.05Å; C15-L17 VanDerWaalsContact C-N 3.34Å; C15-L17 PolarHBondContact O-N 3.27Å; C15-I18 PolarHBondContact O-N 3.13Å; C15-L19 WeakPolarHBondContact O-CB 3.18Å; C15-L19 VanDerWaalsContact O-CG 3.3Å; C15-L19 WeakPolarHBondContact O-CG 3.33Å; C15-L19 PolarHBondContact O-N 3.44Å
16	I	90.9	Very high	82.5	Confident	87 Å²	87	112.9 Å²	112.9	45%	0.446	55%	0.549	S	S	.	.	H	α-helix	trans	-63.1	-42.4	177.7	-67.6	165.2	0	0	0	110.6	Q12 L13 G14 L19 N20	Q12-I16 VanDerWaalsContact O-CG1 3.3Å; Q12-I16 WeakPolarHBondContact O-CG1 3.48Å; Q12-I16 PolarHBondContact O-N 3.16Å; L13-I16 PolarHBondContact O-N 3.27Å; G14-I16 PolarHBondContact O-N 2.99Å; I16-L19 PolarHBondContact O-N 3.41Å; I16-N20 WeakPolarHBondContact CG2-ND2 3.2Å; I16-N20 PolarHBondContact O-N 3.2Å; I16-N20 PolarHBondContact O-ND2 3.47Å
17	L	89.9	Confident	82	Confident	124 Å²	124	109.1 Å²	109.1	65%	0.649	54%	0.54	S	S	*	.	H	α-helix	trans	-62.3	-44.4	176.8	-78.6	170.5	0	0	0	112	L13 G14 C15 N20 L21	L13-L17 WeakPolarHBondContact O-CB 3.49Å; L13-L17 WeakPolarHBondContact O-CG 3.44Å; L13-L17 PolarHBondContact O-N 2.86Å; G14-L17 PolarHBondContact O-N 3.33Å; C15-L17 VanDerWaalsContact C-N 3.34Å; C15-L17 PolarHBondContact O-N 3.27Å; L17-N20 PolarHBondContact O-N 2.87Å; L17-L21 WeakPolarHBondContact O-CB 3.24Å; L17-L21 PolarHBondContact O-N 3.3Å
18	I	87.6	Confident	81.2	Confident	108 Å²	108	109.7 Å²	109.7	55%	0.554	54%	0.543	S	S	*	.	H	α-helix	trans	-64.4	-43.9	177.7	-66.2	166	0	0	0	110.6	G14 C15 N20 L21 V22	G14-I18 VanDerWaalsContact O-CG1 3.31Å; G14-I18 WeakPolarHBondContact O-CG1 3.34Å; G14-I18 PolarHBondContact O-N 2.82Å; C15-I18 PolarHBondContact O-N 3.13Å; I18-N20 PolarHBondContact O-N 2.79Å; I18-L21 PolarHBondContact O-N 2.91Å; I18-V22 HydrophobicContact CG2-CG2 4.33Å; I18-V22 WeakPolarHBondContact O-CB 3.4Å; I18-V22 VanDerWaalsContact O-CG2 3.28Å; I18-V22 WeakPolarHBondContact O-CG2 3.45Å; I18-V22 PolarHBondContact O-N 3.49Å
19	L	88	Confident	80.2	Confident	121 Å²	121	107.4 Å²	107.4	63%	0.634	54%	0.54	S	S	*	.	H	α-helix	trans	-61.7	-43.8	177.8	-74.2	170.2	0	0	0	112	C15 I16 V22 Y23	C15-L19 WeakPolarHBondContact O-CB 3.18Å; C15-L19 VanDerWaalsContact O-CG 3.3Å; C15-L19 WeakPolarHBondContact O-CG 3.33Å; C15-L19 PolarHBondContact O-N 3.44Å; I16-L19 PolarHBondContact O-N 3.41Å; L19-V22 PolarHBondContact O-N 3.42Å; L19-Y23 VanDerWaalsContact O-CB 3.29Å; L19-Y23 WeakPolarHBondContact O-CB 3.48Å; L19-Y23 PolarHBondContact O-N 2.93Å
20	N	84.5	Confident	78.9	Confident	97 Å²	97	109 Å²	109	52%	0.519	55%	0.551	S	S	.	*	H	α-helix	trans	-65.5	-39.6	175.6	-79	-72.3	0	0	0	112	I16 L17 I18 Y23 A24	I16-N20 WeakPolarHBondContact CG2-ND2 3.2Å; I16-N20 PolarHBondContact O-N 3.2Å; I16-N20 PolarHBondContact O-ND2 3.47Å; L17-N20 PolarHBondContact O-N 2.87Å; I18-N20 PolarHBondContact O-N 2.79Å; N20-Y23 PolarHBondContact O-N 3.47Å; N20-A24 VanDerWaalsContact O-CB 3.31Å; N20-A24 WeakPolarHBondContact O-CB 3.38Å; N20-A24 PolarHBondContact O-N 3.22Å
21	L	82.9	Confident	77.4	Confident	115 Å²	115	109.1 Å²	109.1	60%	0.602	56%	0.557	S	S	*	*	H	α-helix	trans	-63.4	-42.8	177	-175.8	68.4	0	0	0	111.7	L17 I18 N25	L17-L21 WeakPolarHBondContact O-CB 3.24Å; L17-L21 PolarHBondContact O-N 3.3Å; I18-L21 PolarHBondContact O-N 2.91Å; L21-N25 PolarHBondContact O-N 2.94Å; L21-N25 VanDerWaalsContact O-N 3.07Å
22	V	82.6	Confident	75.6	Confident	92 Å²	92	107.1 Å²	107.1	56%	0.558	55%	0.55	S	S	*	.	H	α-helix	trans	-67	-42.2	176.5	171.7	0	0	0	0	110.8	I18 L19 N25 L26	I18-V22 HydrophobicContact CG2-CG2 4.33Å; I18-V22 WeakPolarHBondContact O-CB 3.4Å; I18-V22 VanDerWaalsContact O-CG2 3.28Å; I18-V22 WeakPolarHBondContact O-CG2 3.45Å; I18-V22 PolarHBondContact O-N 3.49Å; L19-V22 PolarHBondContact O-N 3.42Å; V22-N25 PolarHBondContact O-N 3.41Å; V22-L26 WeakPolarHBondContact O-CB 3.41Å; V22-L26 PolarHBondContact O-N 3.15Å
23	Y	77.8	Confident	74	Confident	153 Å²	153	103.7 Å²	103.7	60%	0.6	54%	0.537	S	S	*	.	H	α-helix	trans	-64.4	-43.7	178.2	-168.1	-97.9	0	0	0	112	L19 N20 N25 L26 D27	L19-Y23 VanDerWaalsContact O-CB 3.29Å; L19-Y23 WeakPolarHBondContact O-CB 3.48Å; L19-Y23 PolarHBondContact O-N 2.93Å; N20-Y23 PolarHBondContact O-N 3.47Å; Y23-N25 VanDerWaalsContact C-N 3.34Å; Y23-N25 PolarHBondContact O-N 2.91Å; Y23-L26 PolarHBondContact O-N 3.32Å; Y23-D27 PolarHBondContact O-N 3.3Å
24	A	73.1	Confident	71.9	Confident	60 Å²	60	104.3 Å²	104.3	50%	0.496	56%	0.556	S	S	.	*	H	α-helix	trans	-62.9	-38.8	175.4	0	0	0	0	0	112.4	N20 L26 Y28	N20-A24 VanDerWaalsContact O-CB 3.31Å; N20-A24 WeakPolarHBondContact O-CB 3.38Å; N20-A24 PolarHBondContact O-N 3.22Å; A24-L26 VanDerWaalsContact C-N 3.34Å; A24-Y28 WeakPolarHBondContact O-CB 3.44Å; A24-Y28 PolarHBondContact O-N 3.02Å
25	N	71.6	Confident	69.9	Low	105 Å²	105	105.3 Å²	105.3	56%	0.561	56%	0.558	S	S	*	*	H	α-helix	trans	-64.7	-39.5	174.2	-119.7	-69.6	0	0	0	112.1	L21 V22 Y23 Y28 Q29	L21-N25 PolarHBondContact O-N 2.94Å; L21-N25 VanDerWaalsContact O-N 3.07Å; V22-N25 PolarHBondContact O-N 3.41Å; Y23-N25 VanDerWaalsContact C-N 3.34Å; Y23-N25 PolarHBondContact O-N 2.91Å; N25-Y28 PolarHBondContact O-N 3.23Å; N25-Q29 PolarHBondContact O-N 3.22Å
26	L	66.1	Low	67.9	Low	107 Å²	107	108.3 Å²	108.3	56%	0.56	57%	0.569	S	S	*	*	H	α-helix	trans	-66.9	-41.9	179.1	-171.4	69.7	0	0	0	111.7	V22 Y23 A24 Q29 K30	V22-L26 WeakPolarHBondContact O-CB 3.41Å; V22-L26 PolarHBondContact O-N 3.15Å; Y23-L26 PolarHBondContact O-N 3.32Å; A24-L26 VanDerWaalsContact C-N 3.34Å; L26-Q29 PolarHBondContact O-N 3.49Å; L26-K30 WeakPolarHBondContact O-CB 3.47Å; L26-K30 PolarHBondContact O-N 2.82Å
27	D	60.6	Low	66.2	Low	75 Å²	75	108.1 Å²	108.1	40%	0.401	59%	0.588	S	S	.	*	H	α-helix	trans	-66.9	-40.3	175.1	-116	-3.3	0	0	0	111.5	Y23 Q29 K30 E31	Y23-D27 PolarHBondContact O-N 3.3Å; D27-Q29 VanDerWaalsContact C-N 3.28Å; D27-Q29 PolarHBondContact O-N 2.99Å; D27-K30 WeakPolarHBondContact O-CA 3.44Å; D27-K30 WeakPolarHBondContact O-CB 3.48Å; D27-K30 PolarHBondContact O-N 3.23Å; D27-E31 PolarHBondContact O-N 2.85Å
28	Y	59.1	Low	65.2	Low	172 Å²	172	109.2 Å²	109.2	68%	0.675	59%	0.59	S	S	*	*	H	α-helix	trans	-58.7	-41	172.2	-175	-94.4	0	0	0	111.9	A24 N25 K30 E31 T32	A24-Y28 WeakPolarHBondContact O-CB 3.44Å; A24-Y28 PolarHBondContact O-N 3.02Å; N25-Y28 PolarHBondContact O-N 3.23Å; Y28-K30 VanDerWaalsContact C-N 3.3Å; Y28-K30 PolarHBondContact O-N 3.38Å; Y28-E31 PolarHBondContact O-N 2.94Å; Y28-T32 PolarHBondContact O-N 3.37Å
29	Q	57	Low	64.8	Low	135 Å²	135	108.4 Å²	108.4	63%	0.631	59%	0.586	S	S	*	*	H	α-helix	trans	-70.1	-28.8	175.4	-136.9	-158.8	-0.5	0	0	112.5	N25 L26 D27 E31 T32	N25-Q29 PolarHBondContact O-N 3.22Å; L26-Q29 PolarHBondContact O-N 3.49Å; D27-Q29 VanDerWaalsContact C-N 3.28Å; D27-Q29 PolarHBondContact O-N 2.99Å; Q29-E31 VanDerWaalsContact C-N 3.3Å; Q29-T32 PolarHBondContact O-N 3.45Å; Q29-T32 PolarHBondContact O-OG1 3.35Å
30	K	55.9	Low	64.7	Low	167 Å²	167	104.2 Å²	104.2	73%	0.726	57%	0.565	S	S	*	*	H	α-helix	trans	-72.6	-26.1	175.7	-156.4	177.8	-178.4	-173.9	0	112.4	L26 D27 Y28	L26-K30 WeakPolarHBondContact O-CB 3.47Å; L26-K30 PolarHBondContact O-N 2.82Å; D27-K30 WeakPolarHBondContact O-CA 3.44Å; D27-K30 WeakPolarHBondContact O-CB 3.48Å; D27-K30 PolarHBondContact O-N 3.23Å; Y28-K30 VanDerWaalsContact C-N 3.3Å; Y28-K30 PolarHBondContact O-N 3.38Å
31	E	54	Low	64.9	Low	162 Å²	162	106.6 Å²	106.6	76%	0.757	57%	0.572	S	S	*	*	H	α-helix	trans	-82.2	-10.1	170.3	-66.3	-158.2	176.8	0	0	113.8	D27 Y28 Q29 P33	D27-E31 PolarHBondContact O-N 2.85Å; Y28-E31 PolarHBondContact O-N 2.94Å; Q29-E31 VanDerWaalsContact C-N 3.3Å; E31-P33 WeakPolarHBondContact O-CD 3.47Å; E31-P33 VanDerWaalsContact O-N 3.15Å
32	T	50.1	Low	65.1	Low	67 Å²	67	105.6 Å²	105.6	41%	0.411	56%	0.564	S	S	.	*	S	Bend	trans	-65.6	116.2	160.3	62.5	0	0	0	0	106.9	Y28 Q29 A34	Y28-T32 PolarHBondContact O-N 3.37Å; Q29-T32 PolarHBondContact O-N 3.45Å; Q29-T32 PolarHBondContact O-OG1 3.35Å; T32-A34 PolarHBondContact O-N 3.27Å
33	P	50.5	Low	65.4	Low	42 Å²	42	101.2 Å²	101.2	27%	0.273	54%	0.538	S	S	.	.			trans	-52.1	123.7	-177.5	-23.5	30.2	0	0	0	108.5	E31 S35 L36	E31-P33 WeakPolarHBondContact O-CD 3.47Å; E31-P33 VanDerWaalsContact O-N 3.15Å; P33-S35 WeakPolarHBondContact CB-OG 3.47Å; P33-S35 PolarHBondContact O-N 2.92Å; P33-L36 HydrophobicContact CB-CD1 4.17Å; P33-L36 HydrophobicContact CG-CD1 4Å; P33-L36 PolarHBondContact O-N 3.29Å
34	A	47.4	Very low	66.1	Low	107 Å²	107	96.9 Å²	96.9	88%	0.884	52%	0.521	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.9	-10.7	172.6	0	0	0	0	0	112.4	T32	T32-A34 PolarHBondContact O-N 3.27Å
35	S	48	Very low	66.9	Low	48 Å²	48	98.2 Å²	98.2	34%	0.336	52%	0.516	S	S	.	.	T	Hydrogen-bonded Turn	trans	-80.1	-7.5	170.2	70.2	0	0	0	0	115.2	P33 G37 Q38	P33-S35 WeakPolarHBondContact CB-OG 3.47Å; P33-S35 PolarHBondContact O-N 2.92Å; S35-G37 PolarHBondContact O-N 2.74Å; S35-Q38 CarbonylContact O-C 3.52Å; S35-Q38 PolarHBondContact O-N 2.94Å
36	L	49.5	Very low	67.7	Low	131 Å²	131	97.4 Å²	97.4	69%	0.686	51%	0.51	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.7	-22.7	175.3	-111.4	84.3	0	0	0	112.3	P33 Q38	P33-L36 HydrophobicContact CB-CD1 4.17Å; P33-L36 HydrophobicContact CG-CD1 4Å; P33-L36 PolarHBondContact O-N 3.29Å; L36-Q38 VanDerWaalsContact C-N 3.35Å
37	G	53.8	Low	68.9	Low	82 Å²	82	92.3 Å²	92.3	85%	0.845	48%	0.484	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.7	-16.6	174.9	0	0	0	0	0	114.1	S35	S35-G37 PolarHBondContact O-N 2.74Å
38	Q	68.4	Low	70.3	Confident	148 Å²	148	88.8 Å²	88.8	69%	0.692	47%	0.465	S	S	*	.	S	Bend	trans	-125.8	114.9	-179.5	-173	173.6	3.4	0	0	109.3	S35 L36 D40	S35-Q38 CarbonylContact O-C 3.52Å; S35-Q38 PolarHBondContact O-N 2.94Å; L36-Q38 VanDerWaalsContact C-N 3.35Å; Q38-D40 PolarHBondContact O-N 2.97Å; Q38-D40 VanDerWaalsContact O-N 3.12Å
39	I	79.4	Confident	71.7	Confident	90 Å²	90	85 Å²	85	46%	0.462	45%	0.453	S	S	.	.			trans	-53.9	121.1	-179.7	-59.4	176.2	0	0	0	109.6	H41 W44 Y96	I39-H41 PolarHBondContact O-N 3.43Å; I39-H41 VanDerWaalsContact O-N 3.09Å; I39-W44 HydrophobicContact CD1-CZ3 4.48Å; I39-W44 HydrophobicContact CG2-CB 4.05Å; I39-W44 HydrophobicContact CG2-CD2 4Å; I39-W44 HydrophobicContact CG2-CE3 3.55Å; I39-W44 HydrophobicContact CG2-CG 4.23Å; I39-W44 HydrophobicContact CG2-CZ3 4.35Å; I39-Y96 HydrophobicContact CG2-CE2 4.48Å
40	D	86.9	Confident	73.1	Confident	34 Å²	34	79 Å²	79	18%	0.182	43%	0.428	C	S	.	.			trans	-73.3	102.6	172.5	-174.5	-56.8	0	0	0	107.8	Q38 Q42 C43 W44 Y96 V100 R103	Q38-D40 PolarHBondContact O-N 2.97Å; Q38-D40 VanDerWaalsContact O-N 3.12Å; D40-Q42 PolarHBondContact O-N 2.95Å; D40-Q42 WeakPolarHBondContact OD1-CA 3.46Å; D40-Q42 WeakPolarHBondContact OD1-CB 3.4Å; D40-Q42 PolarHBondContact OD1-N 3.29Å; D40-C43 HydrophobicContact CB-CB 4.12Å; D40-C43 PolarHBondContact O-N 3.34Å; D40-C43 PolarHBondContact OD1-N 3.4Å; D40-W44 WeakPolarHBondContact O-CB 3.25Å; D40-W44 PolarHBondContact O-N 3Å; D40-Y96 PolarHBondContact N-OH 3.48Å; D40-V100 HydrophobicContact CB-CG2 4.23Å; D40-R103 WeakPolarHBondContact OD2-CD 3.3Å; D40-R103 IonicContact OD2-NE 3.39Å; D40-R103 PolarHBondContact OD2-NE 2.98Å
41	H	87.6	Confident	74.6	Confident	146 Å²	146	71.1 Å²	71.1	68%	0.676	39%	0.394	S	S	*	.	H	α-helix	trans	-57.3	-33.2	-176.8	-73.1	-76.4	0	0	0	113.3	I39 E45	I39-H41 PolarHBondContact O-N 3.43Å; I39-H41 VanDerWaalsContact O-N 3.09Å; H41-E45 WeakPolarHBondContact O-CB 3.28Å; H41-E45 PolarHBondContact O-N 2.88Å
42	Q	87.5	Confident	76.1	Confident	94 Å²	94	64.3 Å²	64.3	44%	0.439	36%	0.363	S	S	.	.	H	α-helix	trans	-73.7	-42.7	-178.3	-173	-175.5	-17.4	0	0	110.6	D40 E45 M46	D40-Q42 PolarHBondContact O-N 2.95Å; D40-Q42 WeakPolarHBondContact OD1-CA 3.46Å; D40-Q42 WeakPolarHBondContact OD1-CB 3.4Å; D40-Q42 PolarHBondContact OD1-N 3.29Å; Q42-E45 PolarHBondContact O-N 3.02Å; Q42-M46 HydrophobicContact CG-CE 3.81Å; Q42-M46 PolarHBondContact O-N 2.97Å
43	C	90.2	Very high	77.5	Confident	0 Å²	0	68.1 Å²	68.1	0%	0	38%	0.376	C	S	.	.	H	α-helix	trans	-67.9	-39.7	174.3	-75.4	0	0	0	0	112.2	D40 E45 M46 S47 Y96 C99 V100	D40-C43 HydrophobicContact CB-CB 4.12Å; D40-C43 PolarHBondContact O-N 3.34Å; D40-C43 PolarHBondContact OD1-N 3.4Å; C43-E45 VanDerWaalsContact C-N 3.31Å; C43-E45 PolarHBondContact O-N 3.24Å; C43-M46 PolarHBondContact O-N 3.11Å; C43-S47 VanDerWaalsContact O-CB 3.32Å; C43-S47 WeakPolarHBondContact O-CB 3.41Å; C43-S47 PolarHBondContact O-N 3.33Å; C43-S47 PolarHBondContact O-OG 3.2Å; C43-Y96 HydrophobicContact CB-CD2 3.94Å; C43-Y96 HydrophobicContact CB-CE2 3.89Å; C43-C99 WeakPolarHBondContact CA-SG 3.32Å; C43-C99 HydrophobicContact CB-CB 3.61Å; C43-C99 WeakPolarHBondContact CB-SG 3.49Å; C43-C99 WeakPolarHBondContact SG-CB 3.46Å; C43-C99 CovalentContact SG-SG 2.05Å; C43-C99 PolarHBondContact SG-SG 3.48Å; C43-V100 HydrophobicContact CB-CG2 3.96Å; C43-V100 PolarHBondContact SG-N 2.9Å; C43-V100 VanDerWaalsContact SG-N 3.45Å
44	W	91.3	Very high	78.4	Confident	63 Å²	63	70.1 Å²	70.1	24%	0.239	38%	0.383	C	S	.	.	H	α-helix	trans	-55.4	-47.6	174	-174.7	-83	0	0	0	111.9	I39 D40 S48 W67 F92 W93 Y96	I39-W44 HydrophobicContact CD1-CZ3 4.48Å; I39-W44 HydrophobicContact CG2-CB 4.05Å; I39-W44 HydrophobicContact CG2-CD2 4Å; I39-W44 HydrophobicContact CG2-CE3 3.55Å; I39-W44 HydrophobicContact CG2-CG 4.23Å; I39-W44 HydrophobicContact CG2-CZ3 4.35Å; D40-W44 WeakPolarHBondContact O-CB 3.25Å; D40-W44 PolarHBondContact O-N 3Å; W44-S48 WeakPolarHBondContact O-CB 3.43Å; W44-S48 PolarHBondContact O-N 3.08Å; W44-S48 PolarHBondContact O-OG 2.87Å; W44-W67 AromaticContact CE2-CZ2 3.55Å; W44-W67 AromaticContact CH2-CH2 3.78Å; W44-W67 HydrophobicContact CH2-CH2 3.78Å; W44-W67 HydrophobicContact CH2-CZ2 4.12Å; W44-W67 HydrophobicContact CH2-CZ3 4.42Å; W44-W67 AromaticContact CZ2-CE2 3.92Å; W44-W67 AromaticContact CZ2-CH2 3.38Å; W44-W67 HydrophobicContact CZ2-CH2 3.38Å; W44-W67 AromaticContact CZ2-CZ2 3.29Å; W44-W67 HydrophobicContact CZ2-CZ2 3.29Å; W44-W67 HydrophobicContact CZ2-CZ3 4.08Å; W44-W67 AromaticContact NE1-CE2 3.9Å; W44-W67 AromaticContact NE1-CZ2 3.66Å; W44-W67 AromaticContact NE1-NE1 3.87Å; W44-F92 HydrophobicContact CD2-CE2 4.49Å; W44-F92 AromaticContact CD2-CZ 3.68Å; W44-F92 HydrophobicContact CD2-CZ 3.68Å; W44-F92 AromaticContact CE2-CZ 3.99Å; W44-F92 AromaticContact CE3-CE1 3.92Å; W44-F92 HydrophobicContact CE3-CE1 3.92Å; W44-F92 AromaticContact CE3-CZ 3.47Å; W44-F92 HydrophobicContact CE3-CZ 3.47Å; W44-F92 VanDerWaalsContact CE3-CZ 3.47Å; W44-F92 HydrophobicContact CG-CZ 4.35Å; W44-F92 AromaticContact CH2-CE1 3.96Å; W44-F92 HydrophobicContact CH2-CE1 3.96Å; W44-F92 AromaticContact CH2-CZ 3.93Å; W44-F92 HydrophobicContact CH2-CZ 3.93Å; W44-F92 HydrophobicContact CZ2-CZ 4.13Å; W44-F92 AromaticContact CZ3-CE1 3.61Å; W44-F92 HydrophobicContact CZ3-CE1 3.61Å; W44-F92 AromaticContact CZ3-CZ 3.61Å; W44-F92 HydrophobicContact CZ3-CZ 3.61Å; W44-W93 HydrophobicContact CZ3-CH2 4.22Å; W44-Y96 HydrophobicContact CB-CE2 4.25Å; W44-Y96 HydrophobicContact CE3-CE2 4.35Å
45	E	89.6	Confident	79.2	Confident	87 Å²	87	68.8 Å²	68.8	41%	0.407	36%	0.357	S	S	.	.	H	α-helix	trans	-67.2	-45.8	-179.9	-166.7	62.4	-163.6	0	0	112	H41 Q42 C43 S47 S48 H49	H41-E45 WeakPolarHBondContact O-CB 3.28Å; H41-E45 PolarHBondContact O-N 2.88Å; Q42-E45 PolarHBondContact O-N 3.02Å; C43-E45 VanDerWaalsContact C-N 3.31Å; C43-E45 PolarHBondContact O-N 3.24Å; E45-S47 PolarHBondContact O-N 3.18Å; E45-S48 PolarHBondContact O-N 3.46Å; E45-H49 PolarHBondContact O-CD2 3.3Å; E45-H49 PolarHBondContact O-N 2.87Å; E45-H49 IonicContact OE1-CD2 3.85Å; E45-H49 PolarHBondContact OE1-CD2 2.93Å; E45-H49 IonicContact OE1-NE2 2.73Å; E45-H49 PolarHBondContact OE1-NE2 3.04Å
46	M	88.8	Confident	79.9	Confident	88 Å²	88	75 Å²	75	43%	0.433	38%	0.378	S	S	.	.	H	α-helix	trans	-61.6	-43.4	177.7	-81.7	-162.3	-88.4	0	0	112.5	Q42 C43 H49 G50	Q42-M46 HydrophobicContact CG-CE 3.81Å; Q42-M46 PolarHBondContact O-N 2.97Å; C43-M46 PolarHBondContact O-N 3.11Å; M46-H49 PolarHBondContact O-N 3.29Å; M46-G50 PolarHBondContact O-N 3.3Å
47	S	90.7	Very high	80.3	Confident	1 Å²	1	70.3 Å²	70.3	1%	0.007	35%	0.354	C	S	.	.	H	α-helix	trans	-69.4	-35.4	178.7	-58.1	0	0	0	0	112	C43 E45 G50 L51 M95 Y96	C43-S47 VanDerWaalsContact O-CB 3.32Å; C43-S47 WeakPolarHBondContact O-CB 3.41Å; C43-S47 PolarHBondContact O-N 3.33Å; C43-S47 PolarHBondContact O-OG 3.2Å; E45-S47 PolarHBondContact O-N 3.18Å; S47-G50 PolarHBondContact O-N 3.16Å; S47-L51 WeakPolarHBondContact O-CB 3.33Å; S47-L51 PolarHBondContact O-N 3.48Å; S47-M95 VanDerWaalsContact OG-C 3.28Å; S47-M95 PolarHBondContact OG-O 3.36Å; S47-Y96 WeakPolarHBondContact OG-CA 3.29Å; S47-Y96 PolarHBondContact OG-N 3.32Å; S47-Y96 VanDerWaalsContact OG-N 3.16Å
48	S	90.2	Very high	80.5	Confident	0 Å²	0	75.7 Å²	75.7	0%	0	35%	0.354	C	S	.	.	H	α-helix	trans	-62.9	-47.4	173.6	-59.3	0	0	0	0	111.3	W44 E45 L51 V52 W67	W44-S48 WeakPolarHBondContact O-CB 3.43Å; W44-S48 PolarHBondContact O-N 3.08Å; W44-S48 PolarHBondContact O-OG 2.87Å; E45-S48 PolarHBondContact O-N 3.46Å; S48-L51 PolarHBondContact O-N 3.07Å; S48-V52 WeakPolarHBondContact O-CG2 3.16Å; S48-V52 PolarHBondContact O-N 3.44Å; S48-V52 VanDerWaalsContact O-N 3.11Å; S48-W67 WeakPolarHBondContact OG-CZ2 3.34Å; S48-W67 PolarHBondContact OG-NE1 3.21Å
49	H	88.6	Confident	79.8	Confident	92 Å²	92	74 Å²	74	43%	0.426	35%	0.353	S	S	.	.	H	α-helix	trans	-61.2	-45.3	175	-92.3	-78.8	0	0	0	112.2	E45 M46 L51 V52 E53	E45-H49 PolarHBondContact O-CD2 3.3Å; E45-H49 PolarHBondContact O-N 2.87Å; E45-H49 IonicContact OE1-CD2 3.85Å; E45-H49 PolarHBondContact OE1-CD2 2.93Å; E45-H49 IonicContact OE1-NE2 2.73Å; E45-H49 PolarHBondContact OE1-NE2 3.04Å; M46-H49 PolarHBondContact O-N 3.29Å; H49-L51 VanDerWaalsContact C-N 3.28Å; H49-L51 PolarHBondContact O-N 3.46Å; H49-V52 PolarHBondContact O-N 2.95Å; H49-E53 WeakPolarHBondContact O-CG 3.45Å; H49-E53 PolarHBondContact O-N 2.7Å
50	G	87.2	Confident	78.8	Confident	11 Å²	11	69.7 Å²	69.7	11%	0.113	33%	0.331	C	S	.	.	H	α-helix	trans	-57.8	-40.7	176	0	0	0	0	0	112.3	M46 S47 E53 M54	M46-G50 PolarHBondContact O-N 3.3Å; S47-G50 PolarHBondContact O-N 3.16Å; G50-E53 PolarHBondContact O-N 2.93Å; G50-M54 WeakPolarHBondContact O-CB 3.49Å; G50-M54 WeakPolarHBondContact O-CG 3.16Å; G50-M54 PolarHBondContact O-N 3.35Å
51	L	86.9	Confident	77.9	Confident	1 Å²	1	74.3 Å²	74.3	1%	0.005	36%	0.356	C	S	.	.	H	α-helix	trans	-66.4	-41.7	178.5	-171.5	59.2	0	0	0	112.6	S47 S48 H49 K55 L66 L88 N91 F92 M95	S47-L51 WeakPolarHBondContact O-CB 3.33Å; S47-L51 PolarHBondContact O-N 3.48Å; S48-L51 PolarHBondContact O-N 3.07Å; H49-L51 VanDerWaalsContact C-N 3.28Å; H49-L51 PolarHBondContact O-N 3.46Å; L51-K55 HydrophobicContact CD1-CG 3.91Å; L51-K55 PolarHBondContact O-N 2.97Å; L51-L66 HydrophobicContact CB-CD2 4.12Å; L51-L66 HydrophobicContact CD2-CD1 4.01Å; L51-L66 HydrophobicContact CD2-CD2 3.98Å; L51-L66 HydrophobicContact CG-CD1 4.3Å; L51-L66 HydrophobicContact CG-CD2 4.26Å; L51-L88 HydrophobicContact CD1-CD2 4.18Å; L51-L88 HydrophobicContact CD2-CB 4.44Å; L51-L88 HydrophobicContact CD2-CD2 4.47Å; L51-N91 HydrophobicContact CD1-CB 3.85Å; L51-F92 HydrophobicContact CD2-CB 3.95Å; L51-M95 HydrophobicContact CB-CE 3.69Å; L51-M95 HydrophobicContact CD1-CE 3.95Å; L51-M95 HydrophobicContact CG-CE 4.38Å
52	V	85.2	Confident	77.6	Confident	19 Å²	19	71.1 Å²	71.1	12%	0.115	35%	0.347	C	S	.	.	H	α-helix	trans	-58.2	-49.4	174.5	168.3	0	0	0	0	110.6	S48 H49 A60 L66	S48-V52 WeakPolarHBondContact O-CG2 3.16Å; S48-V52 PolarHBondContact O-N 3.44Å; S48-V52 VanDerWaalsContact O-N 3.11Å; H49-V52 PolarHBondContact O-N 2.95Å; V52-A60 VanDerWaalsContact CG1-O 3.25Å; V52-A60 WeakPolarHBondContact CG1-O 3.41Å; V52-L66 HydrophobicContact CG2-CB 3.84Å; V52-L66 HydrophobicContact CG2-CD2 3.88Å; V52-L66 HydrophobicContact CG2-CG 4.35Å
53	E	78.9	Confident	77.5	Confident	146 Å²	146	67.5 Å²	67.5	68%	0.682	33%	0.331	S	S	*	.	H	α-helix	trans	-66.6	-43.3	-177.8	-70.2	-174.2	154.9	0	0	112.7	H49 G50	H49-E53 WeakPolarHBondContact O-CG 3.45Å; H49-E53 PolarHBondContact O-N 2.7Å; G50-E53 PolarHBondContact O-N 2.93Å
54	M	69.3	Low	77.3	Confident	85 Å²	85	73.4 Å²	73.4	42%	0.419	36%	0.361	S	S	.	.	H	α-helix	trans	-70.6	-42.5	-174.2	-73.6	-177.7	-154.4	0	0	113	G50 K56 M95 A114	G50-M54 WeakPolarHBondContact O-CB 3.49Å; G50-M54 WeakPolarHBondContact O-CG 3.16Å; G50-M54 PolarHBondContact O-N 3.35Å; M54-K56 VanDerWaalsContact C-N 3.28Å; M54-K56 PolarHBondContact O-N 3.31Å; M54-M95 HydrophobicContact CE-CG 4.44Å; M54-M95 HydrophobicContact CE-SD 3.38Å; M54-M95 WeakPolarHBondContact CE-SD 3.31Å; M54-M95 HydrophobicContact SD-CE 4.47Å; M54-M95 HydrophobicContact SD-SD 3.86Å; M54-A114 HydrophobicContact CE-CB 3.69Å
55	K	65.9	Low	77	Confident	78 Å²	78	71.7 Å²	71.7	34%	0.339	36%	0.361	S	S	.	.	H	α-helix	trans	-82.8	-6	-174.7	-69.8	-66.8	-155.8	-168.8	0	113.2	L51 L57 D87 L88 N91	L51-K55 HydrophobicContact CD1-CG 3.91Å; L51-K55 PolarHBondContact O-N 2.97Å; K55-L57 HydrophobicContact CB-CD1 3.88Å; K55-L57 HydrophobicContact CB-CD2 4.35Å; K55-L57 HydrophobicContact CB-CG 3.62Å; K55-L57 PolarHBondContact O-N 3.43Å; K55-D87 VanDerWaalsContact CE-OD2 3.3Å; K55-D87 WeakPolarHBondContact CE-OD2 3.49Å; K55-D87 IonicContact NZ-OD1 3.4Å; K55-D87 IonicContact NZ-OD2 3.49Å; K55-D87 PolarHBondContact NZ-OD2 2.99Å; K55-L88 HydrophobicContact CD-CD2 4.35Å; K55-L88 HydrophobicContact CG-CD2 3.83Å; K55-N91 WeakPolarHBondContact CE-ND2 3.37Å; K55-N91 PolarHBondContact NZ-ND2 3.49Å; K55-N91 VanDerWaalsContact NZ-ND2 3.19Å
56	K	61	Low	77	Confident	178 Å²	178	67.5 Å²	67.5	77%	0.774	34%	0.341	S	S	*	.	T	Hydrogen-bonded Turn	trans	41.5	40.9	-174.7	-65.1	-173.7	178.2	179.4	0	111	M54 K58	M54-K56 VanDerWaalsContact C-N 3.28Å; M54-K56 PolarHBondContact O-N 3.31Å; K56-K58 VanDerWaalsContact C-N 3.27Å; K56-K58 PolarHBondContact O-N 3.11Å
57	L	58.7	Low	77.1	Confident	33 Å²	33	66.2 Å²	66.2	17%	0.173	33%	0.331	C	S	.	.			trans	-67.2	94.7	-178.9	-72.5	165.1	0	0	0	105.7	K55 V59 A60 L66 F69 L88	K55-L57 HydrophobicContact CB-CD1 3.88Å; K55-L57 HydrophobicContact CB-CD2 4.35Å; K55-L57 HydrophobicContact CB-CG 3.62Å; K55-L57 PolarHBondContact O-N 3.43Å; L57-V59 PolarHBondContact O-N 3.18Å; L57-A60 HydrophobicContact CB-CB 4.22Å; L57-A60 CarbonylContact O-C 3.6Å; L57-A60 PolarHBondContact O-N 2.99Å; L57-L66 HydrophobicContact CD1-CD1 4.11Å; L57-F69 HydrophobicContact CD2-CE1 4.28Å; L57-L88 HydrophobicContact CD1-CD1 4.49Å; L57-L88 HydrophobicContact CD1-CD2 4.04Å
58	K	57.6	Low	77.1	Confident	196 Å²	196	71.2 Å²	71.2	85%	0.852	36%	0.358	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.4	-8.8	177.7	-68.5	-175.3	175.1	-178.2	0	113.9	K56	K56-K58 VanDerWaalsContact C-N 3.27Å; K56-K58 PolarHBondContact O-N 3.11Å
59	V	55.2	Low	77.1	Confident	111 Å²	111	73.1 Å²	73.1	67%	0.673	37%	0.367	S	S	*	.	T	Hydrogen-bonded Turn	trans	-96.9	-15.2	-178.3	-176	0	0	0	0	111.5	L57	L57-V59 PolarHBondContact O-N 3.18Å
60	A	57.1	Low	77.3	Confident	0 Å²	0	69.3 Å²	69.3	0%	0	35%	0.349	C	S	.	.			trans	-140	63.6	-171.1	0	0	0	0	0	111.8	V52 L57 T62 A65 L66	V52-A60 VanDerWaalsContact CG1-O 3.25Å; V52-A60 WeakPolarHBondContact CG1-O 3.41Å; L57-A60 HydrophobicContact CB-CB 4.22Å; L57-A60 CarbonylContact O-C 3.6Å; L57-A60 PolarHBondContact O-N 2.99Å; A60-T62 PolarHBondContact O-N 3.21Å; A60-A65 HydrophobicContact CB-CB 4.11Å; A60-L66 HydrophobicContact CB-CB 4.21Å
61	D	68.9	Low	77.6	Confident	132 Å²	132	73.1 Å²	73.1	71%	0.706	37%	0.365	S	S	*	.	S	Bend	trans	-70.8	-6.7	178.6	-63.8	-25.1	0	0	0	113.2
62	T	81	Confident	77.9	Confident	79 Å²	79	78.5 Å²	78.5	49%	0.485	39%	0.389	S	S	.	.	S	Bend	trans	-125.6	153.7	177	71.1	0	0	0	0	110.8	A60 I64 A65 L66	A60-T62 PolarHBondContact O-N 3.21Å; T62-I64 PolarHBondContact O-N 3.39Å; T62-A65 PolarHBondContact O-N 3.49Å; T62-A65 WeakPolarHBondContact OG1-CB 3.32Å; T62-A65 PolarHBondContact OG1-N 3.21Å; T62-L66 PolarHBondContact O-N 3.1Å
63	V	84.1	Confident	78.2	Confident	18 Å²	18	77.7 Å²	77.7	11%	0.109	38%	0.384	C	S	.	.	H	α-helix	trans	-56.3	-38.5	175.5	170	0	0	0	0	111.7	L66 W67	V63-L66 WeakPolarHBondContact O-CB 3.38Å; V63-L66 PolarHBondContact O-N 3.16Å; V63-W67 PolarHBondContact O-N 2.89Å
64	I	86.8	Confident	78.9	Confident	123 Å²	123	77 Å²	77	63%	0.631	38%	0.379	S	S	*	.	H	α-helix	trans	-63.6	-48.8	178.3	-60.6	172.9	0	0	0	110.3	T62 L66 W67 D68	T62-I64 PolarHBondContact O-N 3.39Å; I64-L66 PolarHBondContact O-N 2.7Å; I64-W67 PolarHBondContact O-N 3.47Å; I64-W67 VanDerWaalsContact O-N 3.11Å; I64-D68 PolarHBondContact O-N 3.4Å
65	A	85.8	Confident	80	Confident	27 Å²	27	80 Å²	80	22%	0.223	39%	0.392	C	S	.	.	H	α-helix	trans	-63.8	-30.8	179.1	0	0	0	0	0	112.7	A60 T62 F69	A60-A65 HydrophobicContact CB-CB 4.11Å; T62-A65 PolarHBondContact O-N 3.49Å; T62-A65 WeakPolarHBondContact OG1-CB 3.32Å; T62-A65 PolarHBondContact OG1-N 3.21Å; A65-F69 VanDerWaalsContact O-CB 3.28Å; A65-F69 WeakPolarHBondContact O-CB 3.31Å; A65-F69 PolarHBondContact O-N 3.36Å
66	L	88.6	Confident	81.4	Confident	0 Å²	0	77.5 Å²	77.5	0%	0	38%	0.383	C	S	.	.	H	α-helix	trans	-60.8	-50.2	171.6	169.2	70	0	0	0	110.9	L51 V52 L57 A60 T62 V63 I64 F69 M70	L51-L66 HydrophobicContact CB-CD2 4.12Å; L51-L66 HydrophobicContact CD2-CD1 4.01Å; L51-L66 HydrophobicContact CD2-CD2 3.98Å; L51-L66 HydrophobicContact CG-CD1 4.3Å; L51-L66 HydrophobicContact CG-CD2 4.26Å; V52-L66 HydrophobicContact CG2-CB 3.84Å; V52-L66 HydrophobicContact CG2-CD2 3.88Å; V52-L66 HydrophobicContact CG2-CG 4.35Å; L57-L66 HydrophobicContact CD1-CD1 4.11Å; A60-L66 HydrophobicContact CB-CB 4.21Å; T62-L66 PolarHBondContact O-N 3.1Å; V63-L66 WeakPolarHBondContact O-CB 3.38Å; V63-L66 PolarHBondContact O-N 3.16Å; I64-L66 PolarHBondContact O-N 2.7Å; L66-F69 WeakPolarHBondContact O-CB 3.45Å; L66-F69 PolarHBondContact O-N 3.08Å; L66-M70 HydrophobicContact CD1-CG 4.39Å; L66-M70 WeakPolarHBondContact O-CG 3.37Å; L66-M70 PolarHBondContact O-N 3.21Å
67	W	90.6	Very high	82.9	Confident	60 Å²	60	75.1 Å²	75.1	23%	0.227	39%	0.386	C	S	.	.	H	α-helix	trans	-68.3	-36.9	-177.6	-69.4	116.8	0	0	0	112.3	W44 S48 V63 I64 F69 M70 M71 F92	W44-W67 AromaticContact CE2-CZ2 3.55Å; W44-W67 AromaticContact CH2-CH2 3.78Å; W44-W67 HydrophobicContact CH2-CH2 3.78Å; W44-W67 HydrophobicContact CH2-CZ2 4.12Å; W44-W67 HydrophobicContact CH2-CZ3 4.42Å; W44-W67 AromaticContact CZ2-CE2 3.92Å; W44-W67 AromaticContact CZ2-CH2 3.38Å; W44-W67 HydrophobicContact CZ2-CH2 3.38Å; W44-W67 AromaticContact CZ2-CZ2 3.29Å; W44-W67 HydrophobicContact CZ2-CZ2 3.29Å; W44-W67 HydrophobicContact CZ2-CZ3 4.08Å; W44-W67 AromaticContact NE1-CE2 3.9Å; W44-W67 AromaticContact NE1-CZ2 3.66Å; W44-W67 AromaticContact NE1-NE1 3.87Å; S48-W67 WeakPolarHBondContact OG-CZ2 3.34Å; S48-W67 PolarHBondContact OG-NE1 3.21Å; V63-W67 PolarHBondContact O-N 2.89Å; I64-W67 PolarHBondContact O-N 3.47Å; I64-W67 VanDerWaalsContact O-N 3.11Å; W67-F69 VanDerWaalsContact C-N 3.32Å; W67-F69 PolarHBondContact O-N 3.04Å; W67-M70 HydrophobicContact CE3-CB 4.4Å; W67-M70 HydrophobicContact CE3-CE 4.41Å; W67-M70 HydrophobicContact CE3-SD 3.67Å; W67-M70 HydrophobicContact CH2-SD 4.22Å; W67-M70 HydrophobicContact CZ3-CE 3.85Å; W67-M70 HydrophobicContact CZ3-SD 3.44Å; W67-M70 WeakPolarHBondContact CZ3-SD 3.49Å; W67-M70 PolarHBondContact O-N 3.24Å; W67-M71 WeakPolarHBondContact O-CG 3.36Å; W67-M71 PolarHBondContact O-N 3.02Å; W67-F92 HydrophobicContact CH2-CD1 4.16Å; W67-F92 AromaticContact CH2-CD2 3.93Å; W67-F92 HydrophobicContact CH2-CD2 3.93Å; W67-F92 HydrophobicContact CH2-CE1 4.01Å; W67-F92 AromaticContact CH2-CE2 3.77Å; W67-F92 HydrophobicContact CH2-CE2 3.77Å; W67-F92 HydrophobicContact CH2-CG 4.12Å; W67-F92 AromaticContact CH2-CZ 3.82Å; W67-F92 HydrophobicContact CH2-CZ 3.82Å; W67-F92 HydrophobicContact CZ2-CD2 4.03Å; W67-F92 AromaticContact CZ2-CE2 3.6Å; W67-F92 HydrophobicContact CZ2-CE2 3.6Å; W67-F92 AromaticContact CZ2-CZ 3.89Å; W67-F92 HydrophobicContact CZ2-CZ 3.89Å
68	D	90.9	Very high	84.6	Confident	107 Å²	107	79.5 Å²	79.5	57%	0.572	40%	0.404	S	S	*	.	H	α-helix	trans	-60.8	-42.8	171.4	-71.2	-20.8	0	0	0	111.4	I64 M71 F72	I64-D68 PolarHBondContact O-N 3.4Å; D68-M71 PolarHBondContact O-N 3.29Å; D68-F72 PolarHBondContact O-N 3.24Å
69	F	90.6	Very high	86.3	Confident	40 Å²	40	74.6 Å²	74.6	18%	0.175	39%	0.392	C	S	.	.	H	α-helix	trans	-65.1	-42.1	175.6	-178.5	-118.5	0	0	0	112.1	L57 A65 L66 W67 M71 F72 L73 L84 L88	L57-F69 HydrophobicContact CD2-CE1 4.28Å; A65-F69 VanDerWaalsContact O-CB 3.28Å; A65-F69 WeakPolarHBondContact O-CB 3.31Å; A65-F69 PolarHBondContact O-N 3.36Å; L66-F69 WeakPolarHBondContact O-CB 3.45Å; L66-F69 PolarHBondContact O-N 3.08Å; W67-F69 VanDerWaalsContact C-N 3.32Å; W67-F69 PolarHBondContact O-N 3.04Å; F69-M71 VanDerWaalsContact C-N 3.32Å; F69-M71 PolarHBondContact O-N 3Å; F69-F72 HydrophobicContact CD2-CD1 4.33Å; F69-F72 HydrophobicContact CE2-CD1 4.35Å; F69-F72 WeakPolarHBondContact O-CB 3.4Å; F69-F72 PolarHBondContact O-N 2.96Å; F69-L73 HydrophobicContact CD1-CD1 3.99Å; F69-L73 HydrophobicContact CD2-CG 4.49Å; F69-L73 HydrophobicContact CE1-CD1 3.56Å; F69-L73 HydrophobicContact CE1-CG 4.19Å; F69-L73 HydrophobicContact CE2-CD1 4.42Å; F69-L73 HydrophobicContact CE2-CD2 4.12Å; F69-L73 HydrophobicContact CE2-CG 4.16Å; F69-L73 HydrophobicContact CZ-CD1 3.8Å; F69-L73 HydrophobicContact CZ-CD2 3.95Å; F69-L73 HydrophobicContact CZ-CG 4Å; F69-L73 WeakPolarHBondContact O-CG 3Å; F69-L73 PolarHBondContact O-N 2.95Å; F69-L84 HydrophobicContact CE1-CD2 4.23Å; F69-L84 HydrophobicContact CZ-CD2 3.95Å; F69-L88 HydrophobicContact CD1-CD1 4.22Å; F69-L88 HydrophobicContact CE1-CD1 3.94Å
70	M	91.9	Very high	88.1	Confident	12 Å²	12	76.9 Å²	76.9	6%	0.059	39%	0.393	C	S	.	.	H	α-helix	trans	-61.2	-40.6	174.7	-76	-167.3	61.6	0	0	112.2	L66 W67 L73 K74 F85 A89	L66-M70 HydrophobicContact CD1-CG 4.39Å; L66-M70 WeakPolarHBondContact O-CG 3.37Å; L66-M70 PolarHBondContact O-N 3.21Å; W67-M70 HydrophobicContact CE3-CB 4.4Å; W67-M70 HydrophobicContact CE3-CE 4.41Å; W67-M70 HydrophobicContact CE3-SD 3.67Å; W67-M70 HydrophobicContact CH2-SD 4.22Å; W67-M70 HydrophobicContact CZ3-CE 3.85Å; W67-M70 HydrophobicContact CZ3-SD 3.44Å; W67-M70 WeakPolarHBondContact CZ3-SD 3.49Å; W67-M70 PolarHBondContact O-N 3.24Å; M70-L73 PolarHBondContact O-N 3.35Å; M70-K74 WeakPolarHBondContact O-CB 3.3Å; M70-K74 PolarHBondContact O-N 2.85Å; M70-F85 HydrophobicContact CB-CD2 4.4Å; M70-F85 HydrophobicContact CB-CE2 4.34Å; M70-F85 HydrophobicContact CE-CD2 4.06Å; M70-F85 HydrophobicContact CE-CE2 3.6Å; M70-F85 HydrophobicContact CE-CZ 4.27Å; M70-F85 WeakPolarHBondContact O-CD2 3.36Å; M70-A89 HydrophobicContact CE-CB 4.13Å
71	M	93.7	Very high	89.9	Confident	91 Å²	91	78.9 Å²	78.9	45%	0.448	40%	0.402	S	S	.	.	H	α-helix	trans	-63	-45.8	174.3	-77.3	-63.3	-67.9	0	0	111.6	W67 D68 F69 L73 K74 E75	W67-M71 WeakPolarHBondContact O-CG 3.36Å; W67-M71 PolarHBondContact O-N 3.02Å; D68-M71 PolarHBondContact O-N 3.29Å; F69-M71 VanDerWaalsContact C-N 3.32Å; F69-M71 PolarHBondContact O-N 3Å; M71-L73 VanDerWaalsContact C-N 3.32Å; M71-L73 PolarHBondContact O-N 3.45Å; M71-K74 PolarHBondContact O-N 3.38Å; M71-K74 HydrophobicContact SD-CD 4.49Å; M71-E75 WeakPolarHBondContact O-CG 3.38Å; M71-E75 PolarHBondContact O-N 3.39Å
72	F	93.1	Very high	91	Very high	114 Å²	114	76.4 Å²	76.4	50%	0.5	39%	0.389	S	S	.	.	H	α-helix	trans	-57.3	-43.8	174.9	168.3	-97.6	0	0	0	112.6	D68 F69 E75 S76 H81	D68-F72 PolarHBondContact O-N 3.24Å; F69-F72 HydrophobicContact CD2-CD1 4.33Å; F69-F72 HydrophobicContact CE2-CD1 4.35Å; F69-F72 WeakPolarHBondContact O-CB 3.4Å; F69-F72 PolarHBondContact O-N 2.96Å; F72-E75 PolarHBondContact O-N 3.19Å; F72-S76 PolarHBondContact O-N 2.68Å; F72-H81 AromaticContact CE1-CE1 3.83Å; F72-H81 AromaticContact CE1-ND1 3.89Å; F72-H81 AromaticContact CZ-CE1 3.98Å
73	L	92.9	Very high	91.7	Very high	2 Å²	2	78.7 Å²	78.7	1%	0.01	39%	0.394	C	S	.	.	H	α-helix	trans	-64.4	-42.7	178.6	-69.1	175.2	0	0	0	111.7	F69 M70 M71 S76 H81 L84 F85 L88	F69-L73 HydrophobicContact CD1-CD1 3.99Å; F69-L73 HydrophobicContact CD2-CG 4.49Å; F69-L73 HydrophobicContact CE1-CD1 3.56Å; F69-L73 HydrophobicContact CE1-CG 4.19Å; F69-L73 HydrophobicContact CE2-CD1 4.42Å; F69-L73 HydrophobicContact CE2-CD2 4.12Å; F69-L73 HydrophobicContact CE2-CG 4.16Å; F69-L73 HydrophobicContact CZ-CD1 3.8Å; F69-L73 HydrophobicContact CZ-CD2 3.95Å; F69-L73 HydrophobicContact CZ-CG 4Å; F69-L73 WeakPolarHBondContact O-CG 3Å; F69-L73 PolarHBondContact O-N 2.95Å; M70-L73 PolarHBondContact O-N 3.35Å; M71-L73 VanDerWaalsContact C-N 3.32Å; M71-L73 PolarHBondContact O-N 3.45Å; L73-S76 WeakPolarHBondContact O-CB 3.43Å; L73-S76 PolarHBondContact O-N 2.05Å; L73-H81 HydrophobicContact CD2-CB 3.84Å; L73-L84 HydrophobicContact CD1-CB 4.26Å; L73-L84 HydrophobicContact CD1-CD2 3.9Å; L73-L84 HydrophobicContact CD1-CG 3.83Å; L73-L84 HydrophobicContact CD2-CD2 3.95Å; L73-F85 HydrophobicContact CB-CB 3.91Å; L73-F85 HydrophobicContact CB-CD2 4.45Å; L73-F85 HydrophobicContact CD1-CB 4.47Å; L73-L88 HydrophobicContact CD1-CD1 3.76Å
74	K	92.6	Very high	92	Very high	132 Å²	132	81 Å²	81	57%	0.574	41%	0.406	S	S	*	.	H	α-helix	trans	-62.4	-40.9	178.7	-179.5	-174.8	175.2	-173.3	0	112.6	M70 M71 S76 F85	M70-K74 WeakPolarHBondContact O-CB 3.3Å; M70-K74 PolarHBondContact O-N 2.85Å; M71-K74 PolarHBondContact O-N 3.38Å; M71-K74 HydrophobicContact SD-CD 4.49Å; K74-S76 VanDerWaalsContact C-N 3.26Å; K74-S76 PolarHBondContact O-N 2.9Å; K74-F85 HydrophobicContact CB-CD2 4.05Å; K74-F85 HydrophobicContact CB-CE2 3.99Å; K74-F85 HydrophobicContact CB-CZ 4.47Å; K74-F85 HydrophobicContact CD-CZ 4.5Å
75	E	94	Very high	92.3	Very high	148 Å²	148	77.3 Å²	77.3	69%	0.692	39%	0.385	S	S	*	.	H	α-helix	trans	-77.3	-14.1	-179.3	-69.9	-178	174.4	0	0	113	M71 F72	M71-E75 WeakPolarHBondContact O-CG 3.38Å; M71-E75 PolarHBondContact O-N 3.39Å; F72-E75 PolarHBondContact O-N 3.19Å
76	S	93.8	Very high	92.7	Very high	24 Å²	24	79.9 Å²	79.9	17%	0.168	40%	0.395	C	S	.	.			trans	-74.6	133.3	-175.7	-163.6	0	0	0	0	112.4	F72 L73 K74 K78 H81	F72-S76 PolarHBondContact O-N 2.68Å; L73-S76 WeakPolarHBondContact O-CB 3.43Å; L73-S76 PolarHBondContact O-N 2.05Å; K74-S76 VanDerWaalsContact C-N 3.26Å; K74-S76 PolarHBondContact O-N 2.9Å; S76-K78 PolarHBondContact O-N 3.04Å; S76-K78 VanDerWaalsContact O-N 3.16Å; S76-H81 WeakPolarHBondContact CB-ND1 3.39Å; S76-H81 PolarHBondContact OG-ND1 3.43Å
77	P	93.2	Very high	92.9	Very high	128 Å²	128	83 Å²	83	83%	0.831	41%	0.412	S	S	*	.			trans	-74.8	-2.1	176.5	31.2	-36.3	0	0	0	113.2
78	K	95.2	Very high	93	Very high	125 Å²	125	80.2 Å²	80.2	54%	0.543	40%	0.401	S	S	.	.			trans	-81.4	125.6	-176.9	-68.7	179.5	-178.5	175.3	0	110	S76 K80 H81 N82	S76-K78 PolarHBondContact O-N 3.04Å; S76-K78 VanDerWaalsContact O-N 3.16Å; K78-K80 VanDerWaalsContact C-N 3.25Å; K78-K80 PolarHBondContact O-N 3.36Å; K78-H81 HydrophobicContact CB-CB 4.3Å; K78-H81 WeakPolarHBondContact O-CB 3.07Å; K78-H81 PolarHBondContact O-N 3.5Å; K78-N82 PolarHBondContact O-N 3.33Å
79	P	92.8	Very high	93.1	Very high	93 Å²	93	75.7 Å²	75.7	60%	0.604	38%	0.379	S	S	*	.	H	α-helix	trans	-59.3	-37.1	-178.6	21.7	-32	0	0	0	112.5	H81 N82 E83	P79-H81 VanDerWaalsContact C-N 3.28Å; P79-H81 PolarHBondContact O-N 3.06Å; P79-N82 WeakPolarHBondContact O-CB 3.36Å; P79-N82 PolarHBondContact O-N 3.3Å; P79-N82 VanDerWaalsContact O-N 3.14Å; P79-E83 PolarHBondContact O-N 2.92Å
80	K	92.9	Very high	93.2	Very high	160 Å²	160	79.6 Å²	79.6	70%	0.696	40%	0.398	S	S	*	.	H	α-helix	trans	-60.5	-32.7	175.1	-68.6	-171.9	175.1	-173.6	0	114.1	K78 L84	K78-K80 VanDerWaalsContact C-N 3.25Å; K78-K80 PolarHBondContact O-N 3.36Å; K80-L84 PolarHBondContact O-N 2.97Å; K80-L84 VanDerWaalsContact O-N 3.16Å
81	H	93.7	Very high	93.1	Very high	42 Å²	42	81.4 Å²	81.4	19%	0.194	41%	0.407	C	S	.	.	H	α-helix	trans	-72.7	-37.1	177.4	-71.6	-165	0	0	0	110.7	F72 L73 S76 K78 P79 L84 F85	F72-H81 AromaticContact CE1-CE1 3.83Å; F72-H81 AromaticContact CE1-ND1 3.89Å; F72-H81 AromaticContact CZ-CE1 3.98Å; L73-H81 HydrophobicContact CD2-CB 3.84Å; S76-H81 WeakPolarHBondContact CB-ND1 3.39Å; S76-H81 PolarHBondContact OG-ND1 3.43Å; K78-H81 HydrophobicContact CB-CB 4.3Å; K78-H81 WeakPolarHBondContact O-CB 3.07Å; K78-H81 PolarHBondContact O-N 3.5Å; P79-H81 VanDerWaalsContact C-N 3.28Å; P79-H81 PolarHBondContact O-N 3.06Å; H81-L84 PolarHBondContact O-N 3.23Å; H81-F85 WeakPolarHBondContact O-CB 3.41Å; H81-F85 PolarHBondContact O-N 2.86Å
82	N	93.2	Very high	93.1	Very high	80 Å²	80	77.1 Å²	77.1	43%	0.428	39%	0.387	S	S	.	.	H	α-helix	trans	-66.4	-39.9	174.3	-169.8	49.9	0	0	0	112.1	K78 P79 L84 F85 N86	K78-N82 PolarHBondContact O-N 3.33Å; P79-N82 WeakPolarHBondContact O-CB 3.36Å; P79-N82 PolarHBondContact O-N 3.3Å; P79-N82 VanDerWaalsContact O-N 3.14Å; N82-L84 VanDerWaalsContact C-N 3.33Å; N82-L84 PolarHBondContact O-N 3.48Å; N82-F85 PolarHBondContact O-N 3.26Å; N82-N86 WeakPolarHBondContact O-CB 3.16Å; N82-N86 VanDerWaalsContact O-CG 3.23Å; N82-N86 PolarHBondContact O-N 2.82Å; N82-N86 PolarHBondContact O-ND2 3.32Å; N82-N86 VanDerWaalsContact O-ND2 3.13Å
83	E	94.5	Very high	93.1	Very high	127 Å²	127	77.8 Å²	77.8	59%	0.593	39%	0.386	S	S	*	.	H	α-helix	trans	-57.3	-46.4	171.9	-72.6	168.4	-169.4	0	0	111.4	P79 N86 D87	P79-E83 PolarHBondContact O-N 2.92Å; E83-N86 PolarHBondContact O-N 3.4Å; E83-D87 PolarHBondContact O-N 2.6Å
84	L	91.8	Very high	93	Very high	67 Å²	67	81.8 Å²	81.8	35%	0.351	41%	0.407	S	S	.	.	H	α-helix	trans	-65.5	-40.5	177.1	-176.5	61.3	0	0	0	112.4	F69 L73 K80 H81 N82 N86 D87 L88	F69-L84 HydrophobicContact CE1-CD2 4.23Å; F69-L84 HydrophobicContact CZ-CD2 3.95Å; L73-L84 HydrophobicContact CD1-CB 4.26Å; L73-L84 HydrophobicContact CD1-CD2 3.9Å; L73-L84 HydrophobicContact CD1-CG 3.83Å; L73-L84 HydrophobicContact CD2-CD2 3.95Å; K80-L84 PolarHBondContact O-N 2.97Å; K80-L84 VanDerWaalsContact O-N 3.16Å; H81-L84 PolarHBondContact O-N 3.23Å; N82-L84 VanDerWaalsContact C-N 3.33Å; N82-L84 PolarHBondContact O-N 3.48Å; L84-N86 VanDerWaalsContact C-N 3.32Å; L84-N86 PolarHBondContact O-N 3.39Å; L84-D87 PolarHBondContact O-N 3.15Å; L84-L88 HydrophobicContact CD1-CD1 4.36Å; L84-L88 HydrophobicContact CD1-CG 4.37Å; L84-L88 HydrophobicContact CG-CD1 4.12Å; L84-L88 WeakPolarHBondContact O-CB 3.33Å; L84-L88 VanDerWaalsContact O-CG 3.31Å; L84-L88 WeakPolarHBondContact O-CG 3.31Å; L84-L88 PolarHBondContact O-N 2.91Å
85	F	93.5	Very high	92.9	Very high	44 Å²	44	76.5 Å²	76.5	19%	0.193	39%	0.385	C	S	.	.	H	α-helix	trans	-58.1	-46.7	174.1	172.9	-95.5	0	0	0	111.1	M70 L73 K74 H81 N82 L88 A89	M70-F85 HydrophobicContact CB-CD2 4.4Å; M70-F85 HydrophobicContact CB-CE2 4.34Å; M70-F85 HydrophobicContact CE-CD2 4.06Å; M70-F85 HydrophobicContact CE-CE2 3.6Å; M70-F85 HydrophobicContact CE-CZ 4.27Å; M70-F85 WeakPolarHBondContact O-CD2 3.36Å; L73-F85 HydrophobicContact CB-CB 3.91Å; L73-F85 HydrophobicContact CB-CD2 4.45Å; L73-F85 HydrophobicContact CD1-CB 4.47Å; K74-F85 HydrophobicContact CB-CD2 4.05Å; K74-F85 HydrophobicContact CB-CE2 3.99Å; K74-F85 HydrophobicContact CB-CZ 4.47Å; K74-F85 HydrophobicContact CD-CZ 4.5Å; H81-F85 WeakPolarHBondContact O-CB 3.41Å; H81-F85 PolarHBondContact O-N 2.86Å; N82-F85 PolarHBondContact O-N 3.26Å; F85-L88 PolarHBondContact O-N 3.21Å; F85-A89 HydrophobicContact CE1-CB 4.39Å; F85-A89 VanDerWaalsContact O-CB 3.24Å; F85-A89 WeakPolarHBondContact O-CB 3.5Å; F85-A89 PolarHBondContact O-N 3.23Å
86	N	94.1	Very high	92.8	Very high	81 Å²	81	70.5 Å²	70.5	43%	0.433	36%	0.356	S	S	.	.	H	α-helix	trans	-64.1	-43	-179.6	-70	-31.9	0	0	0	111.7	N82 E83 L84 A89 Q90	N82-N86 WeakPolarHBondContact O-CB 3.16Å; N82-N86 VanDerWaalsContact O-CG 3.23Å; N82-N86 PolarHBondContact O-N 2.82Å; N82-N86 PolarHBondContact O-ND2 3.32Å; N82-N86 VanDerWaalsContact O-ND2 3.13Å; E83-N86 PolarHBondContact O-N 3.4Å; L84-N86 VanDerWaalsContact C-N 3.32Å; L84-N86 PolarHBondContact O-N 3.39Å; N86-A89 PolarHBondContact O-N 3.36Å; N86-Q90 VanDerWaalsContact O-CB 3.27Å; N86-Q90 WeakPolarHBondContact O-CB 3.35Å; N86-Q90 PolarHBondContact O-N 3.12Å
87	D	92.4	Very high	92.6	Very high	66 Å²	66	72.7 Å²	72.7	35%	0.353	37%	0.368	S	S	.	.	H	α-helix	trans	-60.2	-46.8	174.8	177.5	65.3	0	0	0	111.4	K55 E83 L84 Q90 N91	K55-D87 VanDerWaalsContact CE-OD2 3.3Å; K55-D87 WeakPolarHBondContact CE-OD2 3.49Å; K55-D87 IonicContact NZ-OD1 3.4Å; K55-D87 IonicContact NZ-OD2 3.49Å; K55-D87 PolarHBondContact NZ-OD2 2.99Å; E83-D87 PolarHBondContact O-N 2.6Å; L84-D87 PolarHBondContact O-N 3.15Å; D87-Q90 PolarHBondContact O-N 3.4Å; D87-N91 PolarHBondContact O-N 3.09Å; D87-N91 PolarHBondContact O-ND2 3.16Å; D87-N91 PolarHBondContact OD1-ND2 3.36Å; D87-N91 PolarHBondContact OD2-ND2 3.48Å
88	L	91.8	Very high	92.4	Very high	1 Å²	1	70.6 Å²	70.6	1%	0.005	35%	0.35	C	S	.	.	H	α-helix	trans	-64.5	-44.7	178.8	-70.2	172.9	0	0	0	112.1	L51 K55 L57 F69 L73 L84 F85 N91 F92	L51-L88 HydrophobicContact CD1-CD2 4.18Å; L51-L88 HydrophobicContact CD2-CB 4.44Å; L51-L88 HydrophobicContact CD2-CD2 4.47Å; K55-L88 HydrophobicContact CD-CD2 4.35Å; K55-L88 HydrophobicContact CG-CD2 3.83Å; L57-L88 HydrophobicContact CD1-CD1 4.49Å; L57-L88 HydrophobicContact CD1-CD2 4.04Å; F69-L88 HydrophobicContact CD1-CD1 4.22Å; F69-L88 HydrophobicContact CE1-CD1 3.94Å; L73-L88 HydrophobicContact CD1-CD1 3.76Å; L84-L88 HydrophobicContact CD1-CD1 4.36Å; L84-L88 HydrophobicContact CD1-CG 4.37Å; L84-L88 HydrophobicContact CG-CD1 4.12Å; L84-L88 WeakPolarHBondContact O-CB 3.33Å; L84-L88 VanDerWaalsContact O-CG 3.31Å; L84-L88 WeakPolarHBondContact O-CG 3.31Å; L84-L88 PolarHBondContact O-N 2.91Å; F85-L88 PolarHBondContact O-N 3.21Å; L88-N91 PolarHBondContact O-N 2.86Å; L88-F92 WeakPolarHBondContact O-CB 3.41Å; L88-F92 PolarHBondContact O-N 3.03Å
89	A	93.1	Very high	92.1	Very high	13 Å²	13	65 Å²	65	11%	0.107	33%	0.327	C	S	.	.	H	α-helix	trans	-62.5	-43.3	178.3	0	0	0	0	0	111.2	M70 F85 N86 F92 W93	M70-A89 HydrophobicContact CE-CB 4.13Å; F85-A89 HydrophobicContact CE1-CB 4.39Å; F85-A89 VanDerWaalsContact O-CB 3.24Å; F85-A89 WeakPolarHBondContact O-CB 3.5Å; F85-A89 PolarHBondContact O-N 3.23Å; N86-A89 PolarHBondContact O-N 3.36Å; A89-F92 WeakPolarHBondContact O-CB 2.99Å; A89-F92 PolarHBondContact O-N 3.44Å; A89-W93 PolarHBondContact O-N 3.36Å
90	Q	92.8	Very high	91.8	Very high	122 Å²	122	61.1 Å²	61.1	57%	0.57	30%	0.301	S	S	*	.	H	α-helix	trans	-61.1	-49.7	177.6	-175.1	170.2	4.9	0	0	111.1	N86 D87 F92 W93 D94	N86-Q90 VanDerWaalsContact O-CB 3.27Å; N86-Q90 WeakPolarHBondContact O-CB 3.35Å; N86-Q90 PolarHBondContact O-N 3.12Å; D87-Q90 PolarHBondContact O-N 3.4Å; Q90-F92 VanDerWaalsContact C-N 3.29Å; Q90-F92 PolarHBondContact O-N 3.43Å; Q90-W93 PolarHBondContact O-N 2.9Å; Q90-W93 VanDerWaalsContact O-N 3.15Å; Q90-D94 VanDerWaalsContact O-CG 3.26Å; Q90-D94 PolarHBondContact O-N 3.29Å
91	N	90.7	Very high	91.4	Very high	49 Å²	49	57.1 Å²	57.1	26%	0.262	29%	0.287	S	S	.	.	H	α-helix	trans	-58.7	-41.2	176.9	-71.6	-58.6	0	0	0	112	L51 K55 D87 L88 M95	L51-N91 HydrophobicContact CD1-CB 3.85Å; K55-N91 WeakPolarHBondContact CE-ND2 3.37Å; K55-N91 PolarHBondContact NZ-ND2 3.49Å; K55-N91 VanDerWaalsContact NZ-ND2 3.19Å; D87-N91 PolarHBondContact O-N 3.09Å; D87-N91 PolarHBondContact O-ND2 3.16Å; D87-N91 PolarHBondContact OD1-ND2 3.36Å; D87-N91 PolarHBondContact OD2-ND2 3.48Å; L88-N91 PolarHBondContact O-N 2.86Å; N91-M95 WeakPolarHBondContact O-CE 3.47Å; N91-M95 WeakPolarHBondContact O-CG 3.33Å; N91-M95 PolarHBondContact O-N 3.48Å
92	F	93.5	Very high	90.8	Very high	2 Å²	2	56.5 Å²	56.5	1%	0.009	29%	0.288	C	S	.	.	H	α-helix	trans	-58.9	-51.1	174.4	173.3	-97.7	0	0	0	111.9	W44 L51 W67 L88 A89 Q90 D94 M95 Y96	W44-F92 HydrophobicContact CD2-CE2 4.49Å; W44-F92 AromaticContact CD2-CZ 3.68Å; W44-F92 HydrophobicContact CD2-CZ 3.68Å; W44-F92 AromaticContact CE2-CZ 3.99Å; W44-F92 AromaticContact CE3-CE1 3.92Å; W44-F92 HydrophobicContact CE3-CE1 3.92Å; W44-F92 AromaticContact CE3-CZ 3.47Å; W44-F92 HydrophobicContact CE3-CZ 3.47Å; W44-F92 VanDerWaalsContact CE3-CZ 3.47Å; W44-F92 HydrophobicContact CG-CZ 4.35Å; W44-F92 AromaticContact CH2-CE1 3.96Å; W44-F92 HydrophobicContact CH2-CE1 3.96Å; W44-F92 AromaticContact CH2-CZ 3.93Å; W44-F92 HydrophobicContact CH2-CZ 3.93Å; W44-F92 HydrophobicContact CZ2-CZ 4.13Å; W44-F92 AromaticContact CZ3-CE1 3.61Å; W44-F92 HydrophobicContact CZ3-CE1 3.61Å; W44-F92 AromaticContact CZ3-CZ 3.61Å; W44-F92 HydrophobicContact CZ3-CZ 3.61Å; L51-F92 HydrophobicContact CD2-CB 3.95Å; W67-F92 HydrophobicContact CH2-CD1 4.16Å; W67-F92 AromaticContact CH2-CD2 3.93Å; W67-F92 HydrophobicContact CH2-CD2 3.93Å; W67-F92 HydrophobicContact CH2-CE1 4.01Å; W67-F92 AromaticContact CH2-CE2 3.77Å; W67-F92 HydrophobicContact CH2-CE2 3.77Å; W67-F92 HydrophobicContact CH2-CG 4.12Å; W67-F92 AromaticContact CH2-CZ 3.82Å; W67-F92 HydrophobicContact CH2-CZ 3.82Å; W67-F92 HydrophobicContact CZ2-CD2 4.03Å; W67-F92 AromaticContact CZ2-CE2 3.6Å; W67-F92 HydrophobicContact CZ2-CE2 3.6Å; W67-F92 AromaticContact CZ2-CZ 3.89Å; W67-F92 HydrophobicContact CZ2-CZ 3.89Å; L88-F92 WeakPolarHBondContact O-CB 3.41Å; L88-F92 PolarHBondContact O-N 3.03Å; A89-F92 WeakPolarHBondContact O-CB 2.99Å; A89-F92 PolarHBondContact O-N 3.44Å; Q90-F92 VanDerWaalsContact C-N 3.29Å; Q90-F92 PolarHBondContact O-N 3.43Å; F92-D94 PolarHBondContact O-N 2.94Å; F92-M95 PolarHBondContact O-N 3.34Å; F92-Y96 HydrophobicContact CZ-CD2 4.45Å; F92-Y96 WeakPolarHBondContact O-CB 3.28Å; F92-Y96 PolarHBondContact O-N 2.89Å
93	W	93.2	Very high	90	Very high	127 Å²	127	58.3 Å²	58.3	48%	0.481	29%	0.288	S	S	.	.	H	α-helix	trans	-65.5	-39.4	-176.4	-76.2	119.5	0	0	0	112.3	W44 A89 Q90 M95 Y96 V97	W44-W93 HydrophobicContact CZ3-CH2 4.22Å; A89-W93 PolarHBondContact O-N 3.36Å; Q90-W93 PolarHBondContact O-N 2.9Å; Q90-W93 VanDerWaalsContact O-N 3.15Å; W93-M95 VanDerWaalsContact C-N 3.34Å; W93-M95 PolarHBondContact O-N 3Å; W93-Y96 AromaticContact CE3-CD1 3.79Å; W93-Y96 HydrophobicContact CE3-CD1 3.79Å; W93-Y96 HydrophobicContact CE3-CE1 4.49Å; W93-Y96 HydrophobicContact CE3-CG 4.32Å; W93-Y96 AromaticContact CZ3-CD1 3.69Å; W93-Y96 HydrophobicContact CZ3-CD1 3.69Å; W93-Y96 AromaticContact CZ3-CE1 3.97Å; W93-Y96 HydrophobicContact CZ3-CE1 3.97Å; W93-Y96 HydrophobicContact CZ3-CG 4.35Å; W93-Y96 PolarHBondContact O-N 3.25Å; W93-V97 WeakPolarHBondContact O-CB 3.49Å; W93-V97 WeakPolarHBondContact O-CG2 3.45Å; W93-V97 PolarHBondContact O-N 3.35Å
94	D	91.2	Very high	89	Confident	87 Å²	87	55.8 Å²	55.8	47%	0.465	29%	0.285	S	S	.	.	H	α-helix	trans	-57.5	-49.4	175.1	-69.5	-17.8	0	0	0	110.3	Q90 F92 Y96 D98	Q90-D94 VanDerWaalsContact O-CG 3.26Å; Q90-D94 PolarHBondContact O-N 3.29Å; F92-D94 PolarHBondContact O-N 2.94Å; D94-Y96 PolarHBondContact O-N 2.9Å; D94-D98 WeakPolarHBondContact O-CB 3.35Å; D94-D98 PolarHBondContact O-N 3.26Å; D94-D98 VanDerWaalsContact O-N 3.08Å
95	M	89.8	Confident	88	Confident	21 Å²	21	59.3 Å²	59.3	10%	0.103	30%	0.299	C	S	.	.	H	α-helix	trans	-64	-39.6	175.8	-72	-175.4	-79.1	0	0	113.3	S47 L51 M54 N91 F92 W93 C99	S47-M95 VanDerWaalsContact OG-C 3.28Å; S47-M95 PolarHBondContact OG-O 3.36Å; L51-M95 HydrophobicContact CB-CE 3.69Å; L51-M95 HydrophobicContact CD1-CE 3.95Å; L51-M95 HydrophobicContact CG-CE 4.38Å; M54-M95 HydrophobicContact CE-CG 4.44Å; M54-M95 HydrophobicContact CE-SD 3.38Å; M54-M95 WeakPolarHBondContact CE-SD 3.31Å; M54-M95 HydrophobicContact SD-CE 4.47Å; M54-M95 HydrophobicContact SD-SD 3.86Å; N91-M95 WeakPolarHBondContact O-CE 3.47Å; N91-M95 WeakPolarHBondContact O-CG 3.33Å; N91-M95 PolarHBondContact O-N 3.48Å; F92-M95 PolarHBondContact O-N 3.34Å; W93-M95 VanDerWaalsContact C-N 3.34Å; W93-M95 PolarHBondContact O-N 3Å; M95-C99 WeakPolarHBondContact O-CB 3.48Å; M95-C99 PolarHBondContact O-N 2.96Å
96	Y	91.1	Very high	86.6	Confident	21 Å²	21	60.6 Å²	60.6	8%	0.082	33%	0.325	C	S	.	.	H	α-helix	trans	-65.7	-47.2	-179	175.6	-96.9	0	0	0	111.4	I39 D40 C43 W44 S47 F92 W93 D94 C99 V100	I39-Y96 HydrophobicContact CG2-CE2 4.48Å; D40-Y96 PolarHBondContact N-OH 3.48Å; C43-Y96 HydrophobicContact CB-CD2 3.94Å; C43-Y96 HydrophobicContact CB-CE2 3.89Å; W44-Y96 HydrophobicContact CB-CE2 4.25Å; W44-Y96 HydrophobicContact CE3-CE2 4.35Å; S47-Y96 WeakPolarHBondContact OG-CA 3.29Å; S47-Y96 PolarHBondContact OG-N 3.32Å; S47-Y96 VanDerWaalsContact OG-N 3.16Å; F92-Y96 HydrophobicContact CZ-CD2 4.45Å; F92-Y96 WeakPolarHBondContact O-CB 3.28Å; F92-Y96 PolarHBondContact O-N 2.89Å; W93-Y96 AromaticContact CE3-CD1 3.79Å; W93-Y96 HydrophobicContact CE3-CD1 3.79Å; W93-Y96 HydrophobicContact CE3-CE1 4.49Å; W93-Y96 HydrophobicContact CE3-CG 4.32Å; W93-Y96 AromaticContact CZ3-CD1 3.69Å; W93-Y96 HydrophobicContact CZ3-CD1 3.69Å; W93-Y96 AromaticContact CZ3-CE1 3.97Å; W93-Y96 HydrophobicContact CZ3-CE1 3.97Å; W93-Y96 HydrophobicContact CZ3-CG 4.35Å; W93-Y96 PolarHBondContact O-N 3.25Å; D94-Y96 PolarHBondContact O-N 2.9Å; Y96-C99 WeakPolarHBondContact O-CB 3.49Å; Y96-C99 PolarHBondContact O-N 2.95Å; Y96-V100 HydrophobicContact CD1-CG2 4.27Å; Y96-V100 HydrophobicContact CD2-CG2 4.49Å; Y96-V100 HydrophobicContact CE1-CG2 3.83Å; Y96-V100 HydrophobicContact CE2-CG2 4.06Å; Y96-V100 WeakPolarHBondContact O-CG2 3.42Å; Y96-V100 PolarHBondContact O-N 3.49Å
97	V	89.8	Confident	85	Confident	70 Å²	70	61.2 Å²	61.2	42%	0.424	33%	0.326	S	S	.	.	H	α-helix	trans	-62.7	-44.3	178	171.8	0	0	0	0	110.3	W93 C99 V100 L101	W93-V97 WeakPolarHBondContact O-CB 3.49Å; W93-V97 WeakPolarHBondContact O-CG2 3.45Å; W93-V97 PolarHBondContact O-N 3.35Å; V97-C99 VanDerWaalsContact C-N 3.3Å; V97-C99 PolarHBondContact O-N 2.81Å; V97-V100 PolarHBondContact O-N 2.91Å; V97-L101 HydrophobicContact CG1-CD1 3.72Å; V97-L101 HydrophobicContact CG1-CG 4.17Å; V97-L101 WeakPolarHBondContact O-CB 3.49Å; V97-L101 VanDerWaalsContact O-CG 3.31Å; V97-L101 WeakPolarHBondContact O-CG 3.22Å; V97-L101 PolarHBondContact O-N 2.9Å
98	D	88.6	Confident	83.2	Confident	84 Å²	84	60 Å²	60	45%	0.449	33%	0.329	S	S	.	.	H	α-helix	trans	-58.2	-41.9	175.6	-82.4	-7.7	0	0	0	112.3	D94 S102	D94-D98 WeakPolarHBondContact O-CB 3.35Å; D94-D98 PolarHBondContact O-N 3.26Å; D94-D98 VanDerWaalsContact O-N 3.08Å; D98-S102 WeakPolarHBondContact O-CB 3.48Å; D98-S102 PolarHBondContact O-N 3.43Å
99	C	88.8	Confident	81.5	Confident	8 Å²	8	71.4 Å²	71.4	5%	0.054	37%	0.372	C	S	.	.	H	α-helix	trans	-63.5	-49.2	175.7	179.8	0	0	0	0	112.2	C43 M95 Y96 V97 L101 S102 R103 L112	C43-C99 WeakPolarHBondContact CA-SG 3.32Å; C43-C99 HydrophobicContact CB-CB 3.61Å; C43-C99 WeakPolarHBondContact CB-SG 3.49Å; C43-C99 WeakPolarHBondContact SG-CB 3.46Å; C43-C99 CovalentContact SG-SG 2.05Å; C43-C99 PolarHBondContact SG-SG 3.48Å; M95-C99 WeakPolarHBondContact O-CB 3.48Å; M95-C99 PolarHBondContact O-N 2.96Å; Y96-C99 WeakPolarHBondContact O-CB 3.49Å; Y96-C99 PolarHBondContact O-N 2.95Å; V97-C99 VanDerWaalsContact C-N 3.3Å; V97-C99 PolarHBondContact O-N 2.81Å; C99-L101 PolarHBondContact O-N 2.87Å; C99-S102 PolarHBondContact O-N 2.98Å; C99-R103 WeakPolarHBondContact O-CB 3.38Å; C99-R103 PolarHBondContact O-N 3.2Å; C99-L112 HydrophobicContact CB-CD1 4.08Å
100	V	87.8	Confident	79.7	Confident	11 Å²	11	79.6 Å²	79.6	7%	0.067	40%	0.4	C	S	.	.	H	α-helix	trans	-61.6	-45.6	-178.3	171	0	0	0	0	110.4	D40 C43 Y96 V97 R103 S104	D40-V100 HydrophobicContact CB-CG2 4.23Å; C43-V100 HydrophobicContact CB-CG2 3.96Å; C43-V100 PolarHBondContact SG-N 2.9Å; C43-V100 VanDerWaalsContact SG-N 3.45Å; Y96-V100 HydrophobicContact CD1-CG2 4.27Å; Y96-V100 HydrophobicContact CD2-CG2 4.49Å; Y96-V100 HydrophobicContact CE1-CG2 3.83Å; Y96-V100 HydrophobicContact CE2-CG2 4.06Å; Y96-V100 WeakPolarHBondContact O-CG2 3.42Å; Y96-V100 PolarHBondContact O-N 3.49Å; V97-V100 PolarHBondContact O-N 2.91Å; V100-R103 PolarHBondContact O-N 3.43Å; V100-S104 PolarHBondContact O-N 3.4Å
101	L	84.1	Confident	77.6	Confident	76 Å²	76	82.3 Å²	82.3	40%	0.398	41%	0.413	S	S	.	.	H	α-helix	trans	-62	-51.5	176.5	-69.7	176.1	0	0	0	110.8	V97 C99 R103 S104 H105	V97-L101 HydrophobicContact CG1-CD1 3.72Å; V97-L101 HydrophobicContact CG1-CG 4.17Å; V97-L101 WeakPolarHBondContact O-CB 3.49Å; V97-L101 VanDerWaalsContact O-CG 3.31Å; V97-L101 WeakPolarHBondContact O-CG 3.22Å; V97-L101 PolarHBondContact O-N 2.9Å; C99-L101 PolarHBondContact O-N 2.87Å; L101-R103 VanDerWaalsContact C-N 3.25Å; L101-R103 PolarHBondContact O-N 3.38Å; L101-S104 PolarHBondContact O-N 3.46Å; L101-S104 VanDerWaalsContact O-N 3.08Å; L101-S104 PolarHBondContact O-OG 3.34Å; L101-H105 PolarHBondContact O-CD2 3.03Å; L101-H105 PolarHBondContact O-N 3.07Å; L101-H105 VanDerWaalsContact O-N 3.16Å
102	S	81	Confident	75.6	Confident	30 Å²	30	84 Å²	84	21%	0.21	42%	0.422	C	S	.	.	H	α-helix	trans	-54.9	-40.3	178.4	178.7	0	0	0	0	112.8	D98 C99 M107	D98-S102 WeakPolarHBondContact O-CB 3.48Å; D98-S102 PolarHBondContact O-N 3.43Å; C99-S102 PolarHBondContact O-N 2.98Å; S102-M107 CarbonylContact O-C 3.6Å; S102-M107 WeakPolarHBondContact O-CA 3.3Å; S102-M107 WeakPolarHBondContact O-CB 3.45Å; S102-M107 PolarHBondContact O-N 3.45Å
103	R	77.7	Confident	73.3	Confident	117 Å²	117	91.5 Å²	91.5	44%	0.442	46%	0.46	S	S	.	.	H	α-helix	trans	-68.1	-41.3	177.9	-172.7	179.3	168.7	91.8	-4.7	112.3	D40 C99 V100 L101 H105 G106	D40-R103 WeakPolarHBondContact OD2-CD 3.3Å; D40-R103 IonicContact OD2-NE 3.39Å; D40-R103 PolarHBondContact OD2-NE 2.98Å; C99-R103 WeakPolarHBondContact O-CB 3.38Å; C99-R103 PolarHBondContact O-N 3.2Å; V100-R103 PolarHBondContact O-N 3.43Å; L101-R103 VanDerWaalsContact C-N 3.25Å; L101-R103 PolarHBondContact O-N 3.38Å; R103-H105 VanDerWaalsContact C-N 3.28Å; R103-H105 PolarHBondContact O-N 2.98Å; R103-G106 PolarHBondContact O-N 3.04Å; R103-G106 VanDerWaalsContact O-N 3.15Å
104	S	72.1	Confident	71.1	Confident	74 Å²	74	87.9 Å²	87.9	52%	0.517	46%	0.457	S	S	.	.	H	α-helix	trans	-64.3	-31.4	178.9	71.7	0	0	0	0	113.2	V100 L101 G106	V100-S104 PolarHBondContact O-N 3.4Å; L101-S104 PolarHBondContact O-N 3.46Å; L101-S104 VanDerWaalsContact O-N 3.08Å; L101-S104 PolarHBondContact O-OG 3.34Å; S104-G106 VanDerWaalsContact C-N 3.27Å; S104-G106 PolarHBondContact O-N 2.93Å
105	H	70.4	Confident	68.8	Low	142 Å²	142	86.9 Å²	86.9	66%	0.657	46%	0.456	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.5	10.9	176	-66.6	-72.9	0	0	0	114	L101 R103 M107	L101-H105 PolarHBondContact O-CD2 3.03Å; L101-H105 PolarHBondContact O-N 3.07Å; L101-H105 VanDerWaalsContact O-N 3.16Å; R103-H105 VanDerWaalsContact C-N 3.28Å; R103-H105 PolarHBondContact O-N 2.98Å; H105-M107 PolarHBondContact O-N 2.94Å
106	G	64.4	Low	66.8	Low	71 Å²	71	96 Å²	96	73%	0.732	50%	0.495	S	S	*	.	T	Hydrogen-bonded Turn	trans	72.7	10.2	180	0	0	0	0	0	114.4	R103 S104 G108	R103-G106 PolarHBondContact O-N 3.04Å; R103-G106 VanDerWaalsContact O-N 3.15Å; S104-G106 VanDerWaalsContact C-N 3.27Å; S104-G106 PolarHBondContact O-N 2.93Å; G106-G108 VanDerWaalsContact C-N 3.33Å
107	M	60.5	Low	64.6	Low	94 Å²	94	104.3 Å²	104.3	46%	0.463	53%	0.527	S	S	.	.			trans	-90.7	11.3	179	-79.2	-179.8	157.2	0	0	113.7	S102 H105 R109 R110	S102-M107 CarbonylContact O-C 3.6Å; S102-M107 WeakPolarHBondContact O-CA 3.3Å; S102-M107 WeakPolarHBondContact O-CB 3.45Å; S102-M107 PolarHBondContact O-N 3.45Å; H105-M107 PolarHBondContact O-N 2.94Å; M107-R109 PolarHBondContact O-N 2.96Å; M107-R110 PolarHBondContact O-N 3.1Å
108	G	54.2	Low	62.5	Low	40 Å²	40	108.7 Å²	108.7	41%	0.412	54%	0.541	S	S	.	.	T	Hydrogen-bonded Turn	trans	-61.7	25.2	-171.4	0	0	0	0	0	118.2	G106	G106-G108 VanDerWaalsContact C-N 3.33Å
109	R	56.1	Low	60.3	Low	241 Å²	241	110.3 Å²	110.3	91%	0.909	56%	0.559	S	S	*	*	T	Hydrogen-bonded Turn	trans	-133.7	1	174.9	-72.6	-171.9	170.9	173	-2.2	115.1	M107 Q111	M107-R109 PolarHBondContact O-N 2.96Å; R109-Q111 PolarHBondContact O-N 3.47Å
110	R	55.6	Low	58.2	Low	185 Å²	185	115.2 Å²	115.2	70%	0.698	59%	0.588	S	S	*	*	S	Bend	trans	-78	108.2	167.4	-65	-174.7	-175.1	-168.4	1.6	106.7	M107 L112	M107-R110 PolarHBondContact O-N 3.1Å; R110-L112 PolarHBondContact O-N 2.93Å
111	Q	48.2	Very low	55.7	Low	178 Å²	178	125 Å²	125	83%	0.832	63%	0.626	S	S	*	*			trans	-45.3	121	164.7	-62.8	-164.9	34.7	0	0	106.7	R109 I113	R109-Q111 PolarHBondContact O-N 3.47Å; Q111-I113 PolarHBondContact O-N 3.03Å
112	L	50.4	Low	53.4	Low	86 Å²	86	130.7 Å²	130.7	45%	0.45	67%	0.672	S	S	.	*			trans	-62.8	90.5	175.5	-71.4	166.1	0	0	0	105.8	C99 R110 A114	C99-L112 HydrophobicContact CB-CD1 4.08Å; R110-L112 PolarHBondContact O-N 2.93Å; L112-A114 PolarHBondContact O-N 2.99Å
113	I	44.3	Very low	52	Low	158 Å²	158	135.8 Å²	135.8	81%	0.81	70%	0.695	S	S	*	*			trans	-58.5	112.3	166.8	-67.3	164.4	0	0	0	103.3	Q111	Q111-I113 PolarHBondContact O-N 3.03Å
114	A	46.3	Very low	50.6	Low	51 Å²	51	136.7 Å²	136.7	42%	0.421	71%	0.708	S	S	.	*			trans	-36.9	119.4	176.6	0	0	0	0	0	108.6	M54 L112 K116	M54-A114 HydrophobicContact CE-CB 3.69Å; L112-A114 PolarHBondContact O-N 2.99Å; A114-K116 PolarHBondContact O-N 3.31Å; A114-K116 VanDerWaalsContact O-N 3.13Å
115	P	43.8	Very low	49.5	Very low	67 Å²	67	140.2 Å²	140.2	44%	0.435	72%	0.719	S	S	.	*			trans	-54.9	128.5	174.6	-19.5	29.8	0	0	0	106.7	Y117	P115-Y117 HydrophobicContact CB-CD2 3.63Å; P115-Y117 HydrophobicContact CB-CE2 4.38Å; P115-Y117 PolarHBondContact O-N 2.92Å
116	K	47.1	Very low	48.2	Very low	213 Å²	213	140.1 Å²	140.1	93%	0.926	72%	0.723	S	S	*	*			trans	-66.2	66.6	164.8	-73	-179.4	176.7	178.1	0	108.5	A114	A114-K116 PolarHBondContact O-N 3.31Å; A114-K116 VanDerWaalsContact O-N 3.13Å
117	Y	46.4	Very low	47.2	Very low	195 Å²	195	144.4 Å²	144.4	77%	0.765	72%	0.722	S	S	*	*			trans	-106.2	120.6	167.9	-87.8	-92.4	0	0	0	107	P115	P115-Y117 HydrophobicContact CB-CD2 3.63Å; P115-Y117 HydrophobicContact CB-CE2 4.38Å; P115-Y117 PolarHBondContact O-N 2.92Å
118	F	45.3	Very low	46.3	Very low	161 Å²	161	147.8 Å²	147.8	71%	0.706	74%	0.739	S	S	*	*			trans	80.8	63.8	-180	-62.8	-83.5	0	0	0	117.5	Y121	F118-Y121 HydrophobicContact CD1-CD2 4.34Å; F118-Y121 HydrophobicContact CD1-CE2 4.26Å; F118-Y121 HydrophobicContact CE1-CD2 4.47Å; F118-Y121 AromaticContact CE1-CE2 3.95Å; F118-Y121 HydrophobicContact CE1-CE2 3.95Å
119	S	42.8	Very low	45.8	Very low	119 Å²	119	155.5 Å²	155.5	83%	0.832	76%	0.763	S	S	*	*			trans	-101	70.9	134.3	-175.3	0	0	0	0	109.1
120	T	42.8	Very low	45	Very low	110 Å²	110	148.9 Å²	148.9	68%	0.675	75%	0.751	S	S	*	*			trans	-164.1	85	156.8	-28.6	0	0	0	0	109.7
121	Y	37.1	Very low	44.1	Very low	218 Å²	218	145.9 Å²	145.9	86%	0.855	76%	0.756	S	S	*	*			trans	-157.3	88.1	140.8	-78.9	-62.6	0	0	0	105.6	F118	F118-Y121 HydrophobicContact CD1-CD2 4.34Å; F118-Y121 HydrophobicContact CD1-CE2 4.26Å; F118-Y121 HydrophobicContact CE1-CD2 4.47Å; F118-Y121 AromaticContact CE1-CE2 3.95Å; F118-Y121 HydrophobicContact CE1-CE2 3.95Å
122	S	34.5	Very low	43.7	Very low	195 Å²	195	143 Å²	143	100%	1.364	75%	0.749	S	S	*	*			trans	-79.9	0	159.1	-65.4	0	0	0	0	109.6

Retrieved 122 of 122 residues in 33.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).