A0A093HRN6_STRCA Loading...

Ribosomal protein L37

Component of the large ribosomal subunit. The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell.

AlphaFold DB , UniProt , Accession A0A093HRN6, Species STRCA (Struthio camelus australis), Gene n/a, Length 96 aa.

						>A0A093HRN6_STRCA|A0A093HRN6
TKGTSSFGKRRNKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKKVYRRFRNGFREGTTPKPKRAAVAASSSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	T	86.3	Confident	93.9	Very high	154 Å²	154	122.5 Å²	122.5	95%	0.945	64%	0.643	S	S	*	*				0	136.4	0	37.9	0	0	0	0	110.4	S5 S6	T1-S5 WeakPolarHBondContact CB-OG 3.47Å; T1-S5 PolarHBondContact O-OG 3.47Å; T1-S5 PolarHBondContact OG1-OG 3.4Å; T1-S6 PolarHBondContact O-OG 2.8Å
2	K	92.1	Very high	94.1	Very high	207 Å²	207	123.8 Å²	123.8	90%	0.9	65%	0.651	S	S	*	*			trans	-89.5	158.1	177	-62.6	175.6	-177.9	173.1	0	109.3
3	G	92.6	Very high	94.2	Very high	32 Å²	32	124.2 Å²	124.2	33%	0.33	64%	0.644	S	S	.	*	S	Bend	trans	88.6	-122.2	174.6	0	0	0	0	0	114	S5 S6 F7	G3-S5 PolarHBondContact O-N 3.02Å; G3-S6 WeakPolarHBondContact O-CA 3.25Å; G3-S6 WeakPolarHBondContact O-CB 3.34Å; G3-S6 PolarHBondContact O-N 3.4Å; G3-F7 WeakPolarHBondContact O-CD2 3.15Å; G3-F7 PolarHBondContact O-N 3.01Å
4	T	95.3	Very high	94.5	Very high	128 Å²	128	120.4 Å²	120.4	79%	0.785	63%	0.629	S	S	*	*	H	α-helix	trans	-49.8	-52.6	-170.4	-51.5	0	0	0	0	113.7	S6 F7	T4-S6 PolarHBondContact O-N 2.82Å; T4-F7 PolarHBondContact O-N 3.18Å; T4-F7 VanDerWaalsContact O-N 3.16Å
5	S	94.6	Very high	94.7	Very high	58 Å²	58	117.9 Å²	117.9	41%	0.406	61%	0.613	S	S	.	*	H	α-helix	trans	-62.1	-27.5	178.7	60.3	0	0	0	0	113.5	T1 G3	T1-S5 WeakPolarHBondContact CB-OG 3.47Å; T1-S5 PolarHBondContact O-OG 3.47Å; T1-S5 PolarHBondContact OG1-OG 3.4Å; G3-S5 PolarHBondContact O-N 3.02Å
6	S	94.4	Very high	94.9	Very high	48 Å²	48	113.5 Å²	113.5	34%	0.336	59%	0.593	S	S	.	*	H	α-helix	trans	-82.3	-30.8	178.1	-60.2	0	0	0	0	112.5	T1 G3 T4 G8 K9	T1-S6 PolarHBondContact O-OG 2.8Å; G3-S6 WeakPolarHBondContact O-CA 3.25Å; G3-S6 WeakPolarHBondContact O-CB 3.34Å; G3-S6 PolarHBondContact O-N 3.4Å; T4-S6 PolarHBondContact O-N 2.82Å; S6-G8 VanDerWaalsContact C-N 3.34Å; S6-G8 PolarHBondContact O-N 3.49Å; S6-K9 PolarHBondContact O-N 3.41Å
7	F	95.6	Very high	95.1	Very high	113 Å²	113	114.2 Å²	114.2	50%	0.496	60%	0.597	S	S	.	*	H	α-helix	trans	-64.6	-36.4	-179.8	-70.9	-63.3	0	0	0	112.4	G3 T4 K9 R10	G3-F7 WeakPolarHBondContact O-CD2 3.15Å; G3-F7 PolarHBondContact O-N 3.01Å; T4-F7 PolarHBondContact O-N 3.18Å; T4-F7 VanDerWaalsContact O-N 3.16Å; F7-K9 PolarHBondContact O-N 3.29Å; F7-K9 VanDerWaalsContact O-N 3.13Å; F7-R10 VanDerWaalsContact CE1-NH1 3.25Å; F7-R10 WeakPolarHBondContact O-CB 3.5Å; F7-R10 WeakPolarHBondContact O-CG 3.39Å; F7-R10 PolarHBondContact O-N 3.3Å; F7-R10 VanDerWaalsContact O-N 3.15Å
8	G	95.7	Very high	95.3	Very high	75 Å²	75	108.1 Å²	108.1	77%	0.773	57%	0.565	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.9	-23	176.3	0	0	0	0	0	114	S6 R10	S6-G8 VanDerWaalsContact C-N 3.34Å; S6-G8 PolarHBondContact O-N 3.49Å; G8-R10 PolarHBondContact O-N 3.15Å
9	K	95.6	Very high	95.4	Very high	168 Å²	168	113.4 Å²	113.4	73%	0.73	58%	0.577	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.1	-2.8	-179.5	-59.5	-175.9	179	-175.3	0	113.9	S6 F7 R11	S6-K9 PolarHBondContact O-N 3.41Å; F7-K9 PolarHBondContact O-N 3.29Å; F7-K9 VanDerWaalsContact O-N 3.13Å; K9-R11 VanDerWaalsContact C-N 3.29Å; K9-R11 PolarHBondContact O-N 3.2Å
10	R	95.3	Very high	95.5	Very high	161 Å²	161	112 Å²	112	61%	0.608	56%	0.564	S	S	*	*			trans	-82.1	55.5	-171.7	-62.3	-176.4	178.8	-167.8	0.2	114.7	F7 G8 K13	F7-R10 VanDerWaalsContact CE1-NH1 3.25Å; F7-R10 WeakPolarHBondContact O-CB 3.5Å; F7-R10 WeakPolarHBondContact O-CG 3.39Å; F7-R10 PolarHBondContact O-N 3.3Å; F7-R10 VanDerWaalsContact O-N 3.15Å; G8-R10 PolarHBondContact O-N 3.15Å; R10-K13 PolarHBondContact O-NZ 3.07Å
11	R	95.8	Very high	95.6	Very high	204 Å²	204	109.1 Å²	109.1	77%	0.77	55%	0.554	S	S	*	*			trans	-85	-31.4	178.3	55.9	-177.5	164.1	127.7	-4.5	114.7	K9 K13	K9-R11 VanDerWaalsContact C-N 3.29Å; K9-R11 PolarHBondContact O-N 3.2Å; R11-K13 WeakPolarHBondContact O-CE 3.37Å
12	N	95.6	Very high	96.1	Very high	138 Å²	138	104.3 Å²	104.3	74%	0.738	54%	0.535	S	S	*	.	S	Bend	trans	-78	136.3	180	-61.2	-26.3	0	0	0	111.3
13	K	95.8	Very high	96.3	Very high	128 Å²	128	96.2 Å²	96.2	56%	0.557	50%	0.504	S	S	*	.			trans	-106.9	119.8	-178.6	-51.8	-53.7	174.4	-165.9	0	110.3	R10 R11 L28	R10-K13 PolarHBondContact O-NZ 3.07Å; R11-K13 WeakPolarHBondContact O-CE 3.37Å; K13-L28 WeakPolarHBondContact O-CD1 3.48Å
14	T	97.8	Very high	96.6	Very high	71 Å²	71	101.5 Å²	101.5	44%	0.436	52%	0.518	S	S	.	.	S	Bend	trans	-79.5	-35.2	176.3	-47.3	0	0	0	0	112.3	H27 L28	T14-H27 WeakPolarHBondContact CG2-CE1 3.15Å; T14-H27 WeakPolarHBondContact CG2-NE2 3.28Å; T14-H27 WeakPolarHBondContact O-CA 3.39Å; T14-L28 PolarHBondContact O-N 3.28Å
15	H	98.2	Very high	96.7	Very high	83 Å²	83	96.2 Å²	96.2	38%	0.384	49%	0.488	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.6	131.2	-174.1	-63.5	95.5	0	0	0	112.8	K24 Y26 H27	H15-K24 VanDerWaalsContact O-CE 3.25Å; H15-K24 WeakPolarHBondContact O-CE 3.43Å; H15-Y26 CarbonylContact C-O 3.47Å; H15-Y26 VanDerWaalsContact CA-O 3.23Å; H15-Y26 WeakPolarHBondContact CA-O 3.33Å; H15-H27 AromaticContact NE2-CD2 3.9Å
16	T	97.9	Very high	96.9	Very high	48 Å²	48	95.6 Å²	95.6	29%	0.294	48%	0.477	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.9	179.7	176.2	63.3	0	0	0	0	111.6	C18 K24 A25 Y26 L28	T16-C18 PolarHBondContact O-N 2.96Å; T16-K24 CarbonylContact O-C 3.54Å; T16-K24 VanDerWaalsContact O-CA 3.28Å; T16-K24 WeakPolarHBondContact O-CA 3.49Å; T16-A25 PolarHBondContact O-N 2.77Å; T16-Y26 PolarHBondContact N-O 3.17Å; T16-Y26 WeakPolarHBondContact O-CB 3.31Å; T16-Y26 PolarHBondContact O-N 3.32Å; T16-L28 HydrophobicContact CG2-CD1 3.77Å; T16-L28 HydrophobicContact CG2-CD2 3.73Å; T16-L28 HydrophobicContact CG2-CG 3.81Å
17	L	98.4	Very high	97.1	Very high	126 Å²	126	94.7 Å²	94.7	66%	0.66	47%	0.467	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-65.9	130.5	179	-67.1	175.4	0	0	0	111.3	G22 K24	L17-G22 WeakPolarHBondContact CD2-O 3.43Å; L17-K24 HydrophobicContact CD2-CB 4.19Å
18	C	98.3	Very high	97.2	Very high	3 Å²	3	93.2 Å²	93.2	2%	0.02	46%	0.464	C	S	.	.			trans	-86.3	125.4	175.4	178.7	0	0	0	0	111.2	T16 R20 C21 G22 S23 C33	T16-C18 PolarHBondContact O-N 2.96Å; C18-R20 PolarHBondContact O-N 3.11Å; C18-R20 VanDerWaalsContact O-N 3.17Å; C18-C21 PolarHBondContact O-N 2.96Å; C18-G22 WeakPolarHBondContact O-CA 3.47Å; C18-G22 PolarHBondContact O-N 3.14Å; C18-S23 WeakPolarHBondContact CB-O 3.07Å; C18-S23 PolarHBondContact N-O 3.35Å; C18-C33 HydrophobicContact CB-CB 4.3Å
19	R	97.5	Very high	97.3	Very high	209 Å²	209	98.1 Å²	98.1	79%	0.789	47%	0.467	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.6	-30.9	177.9	-64.1	-168.2	-73.2	-155	-2.1	114.7	Y38	R19-Y38 PolarHBondContact NH2-OH 3.17Å
20	R	97.5	Very high	97.4	Very high	86 Å²	86	97.3 Å²	97.3	33%	0.325	46%	0.463	S	S	.	.	T	Hydrogen-bonded Turn	trans	-82.7	-43.9	-177.2	-173.4	-174.6	-67.9	164.5	-2.9	113.6	C18 Y38 P39 A40	C18-R20 PolarHBondContact O-N 3.11Å; C18-R20 VanDerWaalsContact O-N 3.17Å; R20-Y38 HydrophobicContact CB-CD2 4.12Å; R20-Y38 HydrophobicContact CB-CG 4.43Å; R20-P39 PolarHBondContact NH2-O 2.77Å; R20-P39 VanDerWaalsContact NH2-O 3.16Å; R20-A40 PolarHBondContact NH1-O 3.33Å; R20-A40 PolarHBondContact NH2-O 3.45Å
21	C	96.8	Very high	97.5	Very high	51 Å²	51	92.7 Å²	92.7	35%	0.345	46%	0.455	S	S	.	.	T	Hydrogen-bonded Turn	trans	-116.5	-1.2	-170.8	65	0	0	0	0	114.5	C18 S23 C36	C18-C21 PolarHBondContact O-N 2.96Å; C21-S23 PolarHBondContact O-N 2.97Å; C21-S23 PolarHBondContact SG-OG 3.44Å; C21-C36 HydrophobicContact CB-CB 3.86Å; C21-C36 PolarHBondContact SG-SG 3.21Å
22	G	96.9	Very high	97.6	Very high	54 Å²	54	86.1 Å²	86.1	56%	0.557	44%	0.438	S	S	*	.			trans	70.8	-9.7	177.6	0	0	0	0	0	115.6	L17 C18	L17-G22 WeakPolarHBondContact CD2-O 3.43Å; C18-G22 WeakPolarHBondContact O-CA 3.47Å; C18-G22 PolarHBondContact O-N 3.14Å
23	S	97.3	Very high	97.8	Very high	36 Å²	36	79.6 Å²	79.6	25%	0.252	40%	0.403	S	S	.	.	S	Bend	trans	-77.5	146.2	179.7	63.4	0	0	0	0	112.5	C18 C21 A25 K35	C18-S23 WeakPolarHBondContact CB-O 3.07Å; C18-S23 PolarHBondContact N-O 3.35Å; C21-S23 PolarHBondContact O-N 2.97Å; C21-S23 PolarHBondContact SG-OG 3.44Å; S23-A25 PolarHBondContact O-N 3.48Å; S23-K35 WeakPolarHBondContact OG-CB 3.31Å
24	K	98.2	Very high	97.8	Very high	143 Å²	143	75.4 Å²	75.4	62%	0.622	40%	0.396	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-72.7	70.1	170.3	-169.4	178.3	177.8	172.5	0	111.9	H15 T16 L17	H15-K24 VanDerWaalsContact O-CE 3.25Å; H15-K24 WeakPolarHBondContact O-CE 3.43Å; T16-K24 CarbonylContact O-C 3.54Å; T16-K24 VanDerWaalsContact O-CA 3.28Å; T16-K24 WeakPolarHBondContact O-CA 3.49Å; L17-K24 HydrophobicContact CD2-CB 4.19Å
25	A	97.9	Very high	97.8	Very high	18 Å²	18	75.7 Å²	75.7	15%	0.149	39%	0.392	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.1	8.8	-175.3	0	0	0	0	0	112.9	T16 S23 H27 C33 G34 K35	T16-A25 PolarHBondContact O-N 2.77Å; S23-A25 PolarHBondContact O-N 3.48Å; A25-H27 PolarHBondContact O-N 2.91Å; A25-C33 CarbonylContact O-C 3.36Å; A25-C33 WeakPolarHBondContact O-CA 3.36Å; A25-G34 PolarHBondContact O-N 3.15Å; A25-K35 HydrophobicContact CB-CB 3.74Å
26	Y	98.5	Very high	97.8	Very high	44 Å²	44	72.3 Å²	72.3	17%	0.173	38%	0.377	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.5	112.5	175	-175	-103.8	0	0	0	109.9	H15 T16 L28 S31 C33 Y38	H15-Y26 CarbonylContact C-O 3.47Å; H15-Y26 VanDerWaalsContact CA-O 3.23Å; H15-Y26 WeakPolarHBondContact CA-O 3.33Å; T16-Y26 PolarHBondContact N-O 3.17Å; T16-Y26 WeakPolarHBondContact O-CB 3.31Å; T16-Y26 PolarHBondContact O-N 3.32Å; Y26-L28 HydrophobicContact CD1-CD2 4.28Å; Y26-L28 HydrophobicContact CE1-CD2 4.39Å; Y26-S31 VanDerWaalsContact OH-CA 3.3Å; Y26-S31 WeakPolarHBondContact OH-CA 3.5Å; Y26-S31 WeakPolarHBondContact OH-CB 3.07Å; Y26-C33 HydrophobicContact CD2-CB 4.22Å; Y26-Y38 AromaticContact CD2-CD1 3.97Å; Y26-Y38 HydrophobicContact CD2-CD1 3.97Å; Y26-Y38 AromaticContact CE2-CD1 3.68Å; Y26-Y38 HydrophobicContact CE2-CD1 3.68Å; Y26-Y38 AromaticContact CE2-CE1 3.98Å; Y26-Y38 HydrophobicContact CE2-CE1 3.98Å
27	H	98.5	Very high	97.8	Very high	29 Å²	29	70.6 Å²	70.6	13%	0.134	37%	0.369	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.2	120.6	178.2	-169.2	-51.1	0	0	0	109.5	T14 H15 A25 Q29 K30 S31 T32	T14-H27 WeakPolarHBondContact CG2-CE1 3.15Å; T14-H27 WeakPolarHBondContact CG2-NE2 3.28Å; T14-H27 WeakPolarHBondContact O-CA 3.39Å; H15-H27 AromaticContact NE2-CD2 3.9Å; A25-H27 PolarHBondContact O-N 2.91Å; H27-Q29 PolarHBondContact ND1-N 3.09Å; H27-K30 HydrophobicContact CB-CB 4.25Å; H27-K30 PolarHBondContact ND1-N 2.91Å; H27-S31 WeakPolarHBondContact O-CA 3.32Å; H27-S31 PolarHBondContact O-N 3.45Å; H27-T32 VanDerWaalsContact CB-O 3.31Å; H27-T32 WeakPolarHBondContact CB-O 3.49Å; H27-T32 PolarHBondContact N-O 3.39Å; H27-T32 PolarHBondContact O-N 2.86Å
28	L	97.7	Very high	97.8	Very high	83 Å²	83	66.9 Å²	66.9	44%	0.435	35%	0.347	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63.7	-56.9	-172.7	-70.3	175.5	0	0	0	112.5	K13 T14 T16 Y26 S31	K13-L28 WeakPolarHBondContact O-CD1 3.48Å; T14-L28 PolarHBondContact O-N 3.28Å; T16-L28 HydrophobicContact CG2-CD1 3.77Å; T16-L28 HydrophobicContact CG2-CD2 3.73Å; T16-L28 HydrophobicContact CG2-CG 3.81Å; Y26-L28 HydrophobicContact CD1-CD2 4.28Å; Y26-L28 HydrophobicContact CE1-CD2 4.39Å; L28-S31 PolarHBondContact O-N 3.4Å; L28-S31 PolarHBondContact O-OG 2.84Å
29	Q	97.8	Very high	97.8	Very high	177 Å²	177	70.3 Å²	70.3	83%	0.827	37%	0.369	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.1	-43.9	-176.2	-65.6	168.9	-10.3	0	0	112.9	H27 S31	H27-Q29 PolarHBondContact ND1-N 3.09Å; Q29-S31 PolarHBondContact O-N 2.71Å
30	K	97.9	Very high	97.8	Very high	152 Å²	152	63 Å²	63	66%	0.661	35%	0.352	S	S	*	.	T	Hydrogen-bonded Turn	trans	-76.8	-1.5	178.1	-63.6	-175.5	-179.6	-173.9	0	113.7	H27 T32	H27-K30 HydrophobicContact CB-CB 4.25Å; H27-K30 PolarHBondContact ND1-N 2.91Å; K30-T32 WeakPolarHBondContact O-CB 3.34Å; K30-T32 PolarHBondContact O-N 3.16Å; K30-T32 PolarHBondContact O-OG1 2.84Å
31	S	97.3	Very high	97.8	Very high	63 Å²	63	68.9 Å²	68.9	44%	0.441	38%	0.38	S	S	.	.	T	Hydrogen-bonded Turn	trans	42.8	38.9	-176.5	-67.7	0	0	0	0	114.1	Y26 H27 L28 Q29 P39	Y26-S31 VanDerWaalsContact OH-CA 3.3Å; Y26-S31 WeakPolarHBondContact OH-CA 3.5Å; Y26-S31 WeakPolarHBondContact OH-CB 3.07Å; H27-S31 WeakPolarHBondContact O-CA 3.32Å; H27-S31 PolarHBondContact O-N 3.45Å; L28-S31 PolarHBondContact O-N 3.4Å; L28-S31 PolarHBondContact O-OG 2.84Å; Q29-S31 PolarHBondContact O-N 2.71Å; S31-P39 WeakPolarHBondContact O-CD 3.3Å
32	T	98.3	Very high	97.8	Very high	66 Å²	66	77 Å²	77	41%	0.405	40%	0.404	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.2	136.6	-170.7	-60.1	0	0	0	0	111.5	H27 K30 Y38	H27-T32 VanDerWaalsContact CB-O 3.31Å; H27-T32 WeakPolarHBondContact CB-O 3.49Å; H27-T32 PolarHBondContact N-O 3.39Å; H27-T32 PolarHBondContact O-N 2.86Å; K30-T32 WeakPolarHBondContact O-CB 3.34Å; K30-T32 PolarHBondContact O-N 3.16Å; K30-T32 PolarHBondContact O-OG1 2.84Å; T32-Y38 CarbonylContact C-O 3.26Å; T32-Y38 VanDerWaalsContact CA-O 3.32Å; T32-Y38 WeakPolarHBondContact CA-O 3.39Å
33	C	98.4	Very high	97.7	Very high	1 Å²	1	82 Å²	82	1%	0.007	41%	0.41	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.4	114.8	176.9	-178.3	0	0	0	0	111.8	C18 A25 Y26 K35 C36 G37 Y38	C18-C33 HydrophobicContact CB-CB 4.3Å; A25-C33 CarbonylContact O-C 3.36Å; A25-C33 WeakPolarHBondContact O-CA 3.36Å; Y26-C33 HydrophobicContact CD2-CB 4.22Å; C33-K35 PolarHBondContact O-N 2.98Å; C33-K35 VanDerWaalsContact O-N 3.14Å; C33-K35 PolarHBondContact SG-N 2.96Å; C33-K35 VanDerWaalsContact SG-N 3.41Å; C33-C36 PolarHBondContact SG-N 3.25Å; C33-C36 VanDerWaalsContact SG-SG 3.66Å; C33-G37 VanDerWaalsContact O-CA 3.28Å; C33-G37 WeakPolarHBondContact O-CA 3.36Å; C33-G37 PolarHBondContact O-N 3.48Å; C33-Y38 PolarHBondContact N-O 3.23Å
34	G	97.5	Very high	97.8	Very high	40 Å²	40	85.7 Å²	85.7	41%	0.412	42%	0.419	S	S	.	.	T	Hydrogen-bonded Turn	trans	-66.5	-10.1	175.3	0	0	0	0	0	114.3	A25 R44	A25-G34 PolarHBondContact O-N 3.15Å; G34-R44 PolarHBondContact O-NE 3.3Å; G34-R44 PolarHBondContact O-NH1 3.42Å; G34-R44 PolarHBondContact O-NH2 2.85Å
35	K	97.7	Very high	97.7	Very high	78 Å²	78	86.1 Å²	86.1	34%	0.339	42%	0.421	S	S	.	.	T	Hydrogen-bonded Turn	trans	-92.4	-65.2	175.1	-175.9	68.6	170.1	-164.6	0	111.9	S23 A25 C33 R44	S23-K35 WeakPolarHBondContact OG-CB 3.31Å; A25-K35 HydrophobicContact CB-CB 3.74Å; C33-K35 PolarHBondContact O-N 2.98Å; C33-K35 VanDerWaalsContact O-N 3.14Å; C33-K35 PolarHBondContact SG-N 2.96Å; C33-K35 VanDerWaalsContact SG-N 3.41Å; K35-R44 PolarHBondContact O-NE 2.74Å; K35-R44 VanDerWaalsContact O-NE 3.13Å
36	C	97.6	Very high	97.7	Very high	12 Å²	12	90.1 Å²	90.1	8%	0.081	43%	0.433	C	S	.	.	T	Hydrogen-bonded Turn	trans	-105.3	-5.3	-169.8	74.6	0	0	0	0	114.7	C21 C33 K43 R44	C21-C36 HydrophobicContact CB-CB 3.86Å; C21-C36 PolarHBondContact SG-SG 3.21Å; C33-C36 PolarHBondContact SG-N 3.25Å; C33-C36 VanDerWaalsContact SG-SG 3.66Å; C36-K43 WeakPolarHBondContact O-CA 3.41Å; C36-R44 PolarHBondContact O-N 3.04Å
37	G	97.8	Very high	97.6	Very high	11 Å²	11	93.9 Å²	93.9	11%	0.113	46%	0.456	C	S	.	.			trans	80.7	8.4	179.1	0	0	0	0	0	116	C33 A40	C33-G37 VanDerWaalsContact O-CA 3.28Å; C33-G37 WeakPolarHBondContact O-CA 3.36Å; C33-G37 PolarHBondContact O-N 3.48Å; G37-A40 WeakPolarHBondContact O-CB 3.35Å; G37-A40 PolarHBondContact O-N 2.89Å
38	Y	98	Very high	97.6	Very high	49 Å²	49	102.1 Å²	102.1	19%	0.192	49%	0.486	C	S	.	.	T	Hydrogen-bonded Turn	trans	-51.5	132.5	171.2	178.4	-95.5	0	0	0	110.4	R19 R20 Y26 T32 C33	R19-Y38 PolarHBondContact NH2-OH 3.17Å; R20-Y38 HydrophobicContact CB-CD2 4.12Å; R20-Y38 HydrophobicContact CB-CG 4.43Å; Y26-Y38 AromaticContact CD2-CD1 3.97Å; Y26-Y38 HydrophobicContact CD2-CD1 3.97Å; Y26-Y38 AromaticContact CE2-CD1 3.68Å; Y26-Y38 HydrophobicContact CE2-CD1 3.68Å; Y26-Y38 AromaticContact CE2-CE1 3.98Å; Y26-Y38 HydrophobicContact CE2-CE1 3.98Å; T32-Y38 CarbonylContact C-O 3.26Å; T32-Y38 VanDerWaalsContact CA-O 3.32Å; T32-Y38 WeakPolarHBondContact CA-O 3.39Å; C33-Y38 PolarHBondContact N-O 3.23Å
39	P	97.6	Very high	97.5	Very high	75 Å²	75	99.8 Å²	99.8	49%	0.487	48%	0.476	S	S	.	.	T	Hydrogen-bonded Turn	cis	-85.9	-6.9	15	32.6	-37.8	0	0	0	116.3	R20 S31 K41	R20-P39 PolarHBondContact NH2-O 2.77Å; R20-P39 VanDerWaalsContact NH2-O 3.16Å; S31-P39 WeakPolarHBondContact O-CD 3.3Å; P39-K41 PolarHBondContact O-N 2.95Å
40	A	97.9	Very high	97.5	Very high	54 Å²	54	94.5 Å²	94.5	45%	0.446	46%	0.463	S	S	.	.	S	Bend	trans	-49.2	139.8	-175.7	0	0	0	0	0	112.5	R20 G37 R42	R20-A40 PolarHBondContact NH1-O 3.33Å; R20-A40 PolarHBondContact NH2-O 3.45Å; G37-A40 WeakPolarHBondContact O-CB 3.35Å; G37-A40 PolarHBondContact O-N 2.89Å; A40-R42 VanDerWaalsContact C-N 3.35Å; A40-R42 PolarHBondContact O-N 3.28Å
41	K	97.3	Very high	97.5	Very high	210 Å²	210	94 Å²	94	91%	0.913	46%	0.461	S	S	*	.	S	Bend	trans	-59.6	-45	-176	-64.8	-179.1	-179.5	178.6	0	111.5	P39	P39-K41 PolarHBondContact O-N 2.95Å
42	R	96.9	Very high	97.5	Very high	222 Å²	222	92.4 Å²	92.4	84%	0.838	45%	0.451	S	S	*	.	S	Bend	trans	-80.3	138	177.7	-63.2	179.4	72.1	179.9	3.7	110.8	A40	A40-R42 VanDerWaalsContact C-N 3.35Å; A40-R42 PolarHBondContact O-N 3.28Å
43	K	96.4	Very high	97.4	Very high	159 Å²	159	92.8 Å²	92.8	69%	0.691	45%	0.447	S	S	*	.	P	Polyproline II helix	trans	-69.3	132.4	171.5	-72.2	-176.1	-179.3	176.5	0	109.9	C36 K45	C36-K43 WeakPolarHBondContact O-CA 3.41Å; K43-K45 PolarHBondContact O-N 3.21Å
44	R	97.5	Very high	97.4	Very high	114 Å²	114	101 Å²	101	43%	0.43	48%	0.478	S	S	.	.	P	Polyproline II helix	trans	-61.6	123.5	174.8	-167.5	-175.8	79.2	135.3	10	110.6	G34 K35 C36 Y46	G34-R44 PolarHBondContact O-NE 3.3Å; G34-R44 PolarHBondContact O-NH1 3.42Å; G34-R44 PolarHBondContact O-NH2 2.85Å; K35-R44 PolarHBondContact O-NE 2.74Å; K35-R44 VanDerWaalsContact O-NE 3.13Å; C36-R44 PolarHBondContact O-N 3.04Å; R44-Y46 HydrophobicContact CG-CD2 4.48Å; R44-Y46 HydrophobicContact CG-CE2 3.79Å
45	K	97.1	Very high	97.4	Very high	152 Å²	152	106.2 Å²	106.2	66%	0.661	49%	0.485	S	S	*	.			trans	-140.6	134.6	174.9	-173.2	179.8	72	176.1	0	108.5	K43 K53	K43-K45 PolarHBondContact O-N 3.21Å; K45-K53 HydrophobicContact CD-CD 4.23Å; K45-K53 HydrophobicContact CD-CG 4.26Å; K45-K53 HydrophobicContact CG-CD 4.21Å; K45-K53 HydrophobicContact CG-CG 4Å
46	Y	97.3	Very high	97.3	Very high	102 Å²	102	107.3 Å²	107.3	40%	0.4	50%	0.495	S	S	.	.			trans	-121.4	138.7	173.2	-61.7	-63	0	0	0	110.6	R44 W48 S49	R44-Y46 HydrophobicContact CG-CD2 4.48Å; R44-Y46 HydrophobicContact CG-CE2 3.79Å; Y46-W48 VanDerWaalsContact CB-NE1 3.34Å; Y46-W48 AromaticContact CD1-NE1 3.9Å; Y46-W48 AromaticContact CD2-CZ2 3.74Å; Y46-W48 HydrophobicContact CD2-CZ2 3.74Å; Y46-W48 HydrophobicContact CE2-CZ2 4.38Å; Y46-W48 AromaticContact CG-CE2 3.86Å; Y46-W48 HydrophobicContact CG-CZ2 4.04Å; Y46-W48 AromaticContact CG-NE1 3.55Å; Y46-S49 PolarHBondContact O-N 3.46Å
47	N	97.3	Very high	97.2	Very high	122 Å²	122	110.4 Å²	110.4	65%	0.652	51%	0.514	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.9	-32.4	-175.6	-71.3	-23.7	0	0	0	112.5	S49 K53	N47-S49 PolarHBondContact O-N 3.17Å; N47-K53 PolarHBondContact O-NZ 3.43Å; N47-K53 VanDerWaalsContact O-NZ 3.09Å
48	W	97.6	Very high	97.1	Very high	203 Å²	203	115.4 Å²	115.4	77%	0.769	54%	0.542	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.8	-18.8	176	58.8	-105.9	0	0	0	113.8	Y46	Y46-W48 VanDerWaalsContact CB-NE1 3.34Å; Y46-W48 AromaticContact CD1-NE1 3.9Å; Y46-W48 AromaticContact CD2-CZ2 3.74Å; Y46-W48 HydrophobicContact CD2-CZ2 3.74Å; Y46-W48 HydrophobicContact CE2-CZ2 4.38Å; Y46-W48 AromaticContact CG-CE2 3.86Å; Y46-W48 HydrophobicContact CG-CZ2 4.04Å; Y46-W48 AromaticContact CG-NE1 3.55Å
49	S	96.7	Very high	97	Very high	34 Å²	34	114.9 Å²	114.9	24%	0.238	55%	0.552	C	S	.	*			trans	-104.4	73.5	-178.7	-158.9	0	0	0	0	112.9	Y46 N47 K51 A52 K53	Y46-S49 PolarHBondContact O-N 3.46Å; N47-S49 PolarHBondContact O-N 3.17Å; S49-K51 PolarHBondContact O-N 3.16Å; S49-A52 PolarHBondContact O-N 3.13Å; S49-A52 WeakPolarHBondContact OG-CB 3.38Å; S49-K53 PolarHBondContact O-N 3.45Å; S49-K53 VanDerWaalsContact O-N 3.1Å
50	A	97.7	Very high	96.9	Very high	65 Å²	65	115.6 Å²	115.6	54%	0.537	56%	0.555	S	S	.	*	H	α-helix	trans	-57	-47.4	-179.1	0	0	0	0	0	113.4	A52 K53 R54	A50-A52 VanDerWaalsContact C-N 3.3Å; A50-A52 PolarHBondContact O-N 3.3Å; A50-K53 WeakPolarHBondContact O-CB 3.23Å; A50-K53 PolarHBondContact O-N 3.42Å; A50-R54 PolarHBondContact O-N 2.99Å
51	K	97.9	Very high	96.9	Very high	142 Å²	142	115.3 Å²	115.3	62%	0.617	56%	0.557	S	S	*	*	H	α-helix	trans	-63.6	-34.1	178.5	-67.3	-177.5	-179.1	176.3	0	112.3	S49 R55	S49-K51 PolarHBondContact O-N 3.16Å; K51-R55 WeakPolarHBondContact O-CG 3.42Å; K51-R55 PolarHBondContact O-N 3.41Å; K51-R55 PolarHBondContact O-NH1 2.83Å
52	A	97.2	Very high	96.8	Very high	29 Å²	29	114.3 Å²	114.3	24%	0.24	55%	0.548	C	S	.	.	H	α-helix	trans	-69.8	-39.3	176.7	0	0	0	0	0	112	S49 A50 R55 N56	S49-A52 PolarHBondContact O-N 3.13Å; S49-A52 WeakPolarHBondContact OG-CB 3.38Å; A50-A52 VanDerWaalsContact C-N 3.3Å; A50-A52 PolarHBondContact O-N 3.3Å; A52-R55 PolarHBondContact O-N 2.86Å; A52-N56 PolarHBondContact O-ND2 2.92Å; A52-N56 VanDerWaalsContact O-ND2 3.16Å
53	K	96.9	Very high	96.9	Very high	74 Å²	74	106.8 Å²	106.8	32%	0.322	52%	0.523	S	S	.	.	H	α-helix	trans	-57.2	-52.7	171.5	-68.7	-177.8	-63	-172.3	0	110.2	K45 N47 S49 A50 R55 N56 T57	K45-K53 HydrophobicContact CD-CD 4.23Å; K45-K53 HydrophobicContact CD-CG 4.26Å; K45-K53 HydrophobicContact CG-CD 4.21Å; K45-K53 HydrophobicContact CG-CG 4Å; N47-K53 PolarHBondContact O-NZ 3.43Å; N47-K53 VanDerWaalsContact O-NZ 3.09Å; S49-K53 PolarHBondContact O-N 3.45Å; S49-K53 VanDerWaalsContact O-N 3.1Å; A50-K53 WeakPolarHBondContact O-CB 3.23Å; A50-K53 PolarHBondContact O-N 3.42Å; K53-R55 VanDerWaalsContact C-N 3.3Å; K53-R55 PolarHBondContact O-N 3.14Å; K53-N56 PolarHBondContact O-N 3.48Å; K53-N56 VanDerWaalsContact O-N 3.1Å; K53-T57 WeakPolarHBondContact O-CB 3.28Å; K53-T57 PolarHBondContact O-N 2.84Å
54	R	97.2	Very high	96.9	Very high	174 Å²	174	107.5 Å²	107.5	66%	0.657	52%	0.521	S	S	*	.	H	α-helix	trans	-54.7	-40.8	-179.6	-171.1	178.9	70.9	179	4.2	113.5	A50 N56 T60	A50-R54 PolarHBondContact O-N 2.99Å; R54-N56 VanDerWaalsContact C-N 3.33Å; R54-N56 PolarHBondContact O-N 2.93Å; R54-T60 VanDerWaalsContact O-CG2 3.3Å; R54-T60 WeakPolarHBondContact O-CG2 3.47Å
55	R	96.9	Very high	96.9	Very high	149 Å²	149	108.7 Å²	108.7	56%	0.562	53%	0.531	S	S	*	.	H	α-helix	trans	-68.6	-26.8	-178.9	-69.3	-179.1	-168.1	108.3	-11.8	114.1	K51 A52 K53 T60	K51-R55 WeakPolarHBondContact O-CG 3.42Å; K51-R55 PolarHBondContact O-N 3.41Å; K51-R55 PolarHBondContact O-NH1 2.83Å; A52-R55 PolarHBondContact O-N 2.86Å; K53-R55 VanDerWaalsContact C-N 3.3Å; K53-R55 PolarHBondContact O-N 3.14Å; R55-T60 PolarHBondContact O-OG1 3.5Å
56	N	95.6	Very high	96.9	Very high	101 Å²	101	104.3 Å²	104.3	54%	0.54	52%	0.515	S	S	.	.	H	α-helix	trans	-124.1	7.7	-171	-59.3	-78.6	0	0	0	114	A52 K53 R54	A52-N56 PolarHBondContact O-ND2 2.92Å; A52-N56 VanDerWaalsContact O-ND2 3.16Å; K53-N56 PolarHBondContact O-N 3.48Å; K53-N56 VanDerWaalsContact O-N 3.1Å; R54-N56 VanDerWaalsContact C-N 3.33Å; R54-N56 PolarHBondContact O-N 2.93Å
57	T	96.1	Very high	96.8	Very high	78 Å²	78	105.4 Å²	105.4	48%	0.479	52%	0.522	S	S	.	.	S	Bend	trans	-70.3	159.4	178.4	-169.3	0	0	0	0	111	K53 G59 T60	K53-T57 WeakPolarHBondContact O-CB 3.28Å; K53-T57 PolarHBondContact O-N 2.84Å; T57-G59 PolarHBondContact O-N 2.93Å; T57-T60 HydrophobicContact CG2-CG2 4.31Å; T57-T60 PolarHBondContact O-N 3.04Å; T57-T60 PolarHBondContact O-OG1 2.85Å
58	T	95.9	Very high	96.8	Very high	115 Å²	115	105.6 Å²	105.6	71%	0.706	52%	0.517	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.2	132.8	168	-54	0	0	0	0	109	L66	T58-L66 HydrophobicContact CG2-CD1 3.88Å
59	G	95.8	Very high	96.8	Very high	39 Å²	39	97.7 Å²	97.7	40%	0.402	49%	0.491	S	S	.	.	T	Hydrogen-bonded Turn	trans	120.3	-42.4	-171.2	0	0	0	0	0	113.3	T57 G61 M63	T57-G59 PolarHBondContact O-N 2.93Å; G59-G61 VanDerWaalsContact C-N 3.34Å; G59-G61 PolarHBondContact O-N 2.93Å; G59-M63 VanDerWaalsContact CA-SD 3.53Å
60	T	96.6	Very high	96.8	Very high	89 Å²	89	102.2 Å²	102.2	55%	0.546	50%	0.504	S	S	.	.	S	Bend	trans	-76.9	-20.4	-173.3	64	0	0	0	0	114.1	R54 R55 T57	R54-T60 VanDerWaalsContact O-CG2 3.3Å; R54-T60 WeakPolarHBondContact O-CG2 3.47Å; R55-T60 PolarHBondContact O-OG1 3.5Å; T57-T60 HydrophobicContact CG2-CG2 4.31Å; T57-T60 PolarHBondContact O-N 3.04Å; T57-T60 PolarHBondContact O-OG1 2.85Å
61	G	95.9	Very high	96.7	Very high	49 Å²	49	106.3 Å²	106.3	51%	0.505	51%	0.505	S	S	.	.	S	Bend	trans	-88.3	-170.7	178.5	0	0	0	0	0	113.7	G59 M63	G59-G61 VanDerWaalsContact C-N 3.34Å; G59-G61 PolarHBondContact O-N 2.93Å; G61-M63 PolarHBondContact O-N 3.08Å; G61-M63 VanDerWaalsContact O-N 3.16Å
62	R	97	Very high	96.6	Very high	188 Å²	188	104.6 Å²	104.6	71%	0.709	50%	0.495	S	S	*	.			trans	-63.5	-23.9	-177	-66.3	179.4	172	172.9	-4.1	114.5	R64	R62-R64 HydrophobicContact CB-CG 3.97Å; R62-R64 PolarHBondContact O-N 3.43Å; R62-R64 VanDerWaalsContact O-N 3.15Å
63	M	97.4	Very high	96.6	Very high	64 Å²	64	109.5 Å²	109.5	32%	0.315	51%	0.511	S	S	.	.			trans	47.8	38.9	-177.4	-62.6	-156.2	-71.7	0	0	114.3	G59 G61 H65 L66 K67	G59-M63 VanDerWaalsContact CA-SD 3.53Å; G61-M63 PolarHBondContact O-N 3.08Å; G61-M63 VanDerWaalsContact O-N 3.16Å; M63-H65 VanDerWaalsContact C-N 3.32Å; M63-H65 PolarHBondContact O-N 3.15Å; M63-L66 PolarHBondContact O-N 3.35Å; M63-K67 HydrophobicContact CB-CD 4.2Å; M63-K67 HydrophobicContact CB-CG 3.94Å; M63-K67 WeakPolarHBondContact O-CB 3.41Å; M63-K67 VanDerWaalsContact O-CG 3.31Å; M63-K67 WeakPolarHBondContact O-CG 3.43Å; M63-K67 PolarHBondContact O-N 3Å
64	R	96.9	Very high	96.6	Very high	175 Å²	175	115.5 Å²	115.5	66%	0.66	53%	0.532	S	S	*	.	H	α-helix	trans	-54.3	-44.3	-172.1	-69.3	-178.5	173.4	175.4	-6.5	113.6	R62	R62-R64 HydrophobicContact CB-CG 3.97Å; R62-R64 PolarHBondContact O-N 3.43Å; R62-R64 VanDerWaalsContact O-N 3.15Å
65	H	97.3	Very high	96.4	Very high	139 Å²	139	112 Å²	112	64%	0.644	53%	0.526	S	S	*	.	H	α-helix	trans	-78.3	-55.7	-179.8	179.4	72.2	0	0	0	111.5	M63 K67 K68 V69	M63-H65 VanDerWaalsContact C-N 3.32Å; M63-H65 PolarHBondContact O-N 3.15Å; H65-K67 VanDerWaalsContact C-N 3.29Å; H65-K67 PolarHBondContact O-N 3.39Å; H65-K68 WeakPolarHBondContact O-CA 3.3Å; H65-K68 WeakPolarHBondContact O-CB 3.25Å; H65-K68 PolarHBondContact O-N 3.09Å; H65-V69 VanDerWaalsContact NE2-CG2 3.34Å; H65-V69 WeakPolarHBondContact NE2-CG2 3.16Å; H65-V69 WeakPolarHBondContact O-CG2 3.45Å; H65-V69 PolarHBondContact O-N 2.78Å
66	L	97.3	Very high	96.3	Very high	59 Å²	59	107.7 Å²	107.7	31%	0.309	53%	0.527	S	S	.	.	H	α-helix	trans	-57.4	-37.8	-176.3	-67.5	177.3	0	0	0	113.3	T58 M63 K68 V69 Y70	T58-L66 HydrophobicContact CG2-CD1 3.88Å; M63-L66 PolarHBondContact O-N 3.35Å; L66-K68 VanDerWaalsContact C-N 3.32Å; L66-K68 PolarHBondContact O-N 3.35Å; L66-V69 PolarHBondContact O-N 3.25Å; L66-Y70 HydrophobicContact CB-CD2 4.38Å; L66-Y70 HydrophobicContact CB-CE2 4.01Å; L66-Y70 WeakPolarHBondContact O-CD2 3.4Å; L66-Y70 PolarHBondContact O-N 3.37Å
67	K	96.6	Very high	96.3	Very high	125 Å²	125	107.6 Å²	107.6	54%	0.543	52%	0.522	S	S	.	.	H	α-helix	trans	-59.6	-41.6	175	-75.6	177.2	174.4	-179.5	0	112.3	M63 H65 R71	M63-K67 HydrophobicContact CB-CD 4.2Å; M63-K67 HydrophobicContact CB-CG 3.94Å; M63-K67 WeakPolarHBondContact O-CB 3.41Å; M63-K67 VanDerWaalsContact O-CG 3.31Å; M63-K67 WeakPolarHBondContact O-CG 3.43Å; M63-K67 PolarHBondContact O-N 3Å; H65-K67 VanDerWaalsContact C-N 3.29Å; H65-K67 PolarHBondContact O-N 3.39Å; K67-R71 PolarHBondContact O-N 3.35Å
68	K	96.4	Very high	96.1	Very high	126 Å²	126	112.6 Å²	112.6	55%	0.548	53%	0.533	S	S	.	.	H	α-helix	trans	-68.3	-41.9	175.4	-68.4	-176.6	178.5	-174.1	0	111	H65 L66 R71 R72	H65-K68 WeakPolarHBondContact O-CA 3.3Å; H65-K68 WeakPolarHBondContact O-CB 3.25Å; H65-K68 PolarHBondContact O-N 3.09Å; L66-K68 VanDerWaalsContact C-N 3.32Å; L66-K68 PolarHBondContact O-N 3.35Å; K68-R71 PolarHBondContact O-N 3.22Å; K68-R72 WeakPolarHBondContact O-CG 3.43Å; K68-R72 PolarHBondContact O-N 3.43Å
69	V	96.8	Very high	95.9	Very high	38 Å²	38	114.3 Å²	114.3	23%	0.23	53%	0.533	C	S	.	.	H	α-helix	trans	-60	-48.7	177.1	174.1	0	0	0	0	111	H65 L66 R71 R72 F73 F77	H65-V69 VanDerWaalsContact NE2-CG2 3.34Å; H65-V69 WeakPolarHBondContact NE2-CG2 3.16Å; H65-V69 WeakPolarHBondContact O-CG2 3.45Å; H65-V69 PolarHBondContact O-N 2.78Å; L66-V69 PolarHBondContact O-N 3.25Å; V69-R71 VanDerWaalsContact C-N 3.28Å; V69-R71 PolarHBondContact O-N 3.01Å; V69-R72 CarbonylContact O-C 3.59Å; V69-R72 PolarHBondContact O-N 3.22Å; V69-R72 VanDerWaalsContact O-N 3.11Å; V69-F73 WeakPolarHBondContact O-CB 3.46Å; V69-F73 PolarHBondContact O-N 3.1Å; V69-F77 HydrophobicContact CG1-CE1 4.22Å
70	Y	96.9	Very high	95.6	Very high	129 Å²	129	116.6 Å²	116.6	51%	0.506	56%	0.556	S	S	.	*	H	α-helix	trans	-62.2	-34.9	178.2	-68.2	-50.1	0	0	0	113	L66 R74	L66-Y70 HydrophobicContact CB-CD2 4.38Å; L66-Y70 HydrophobicContact CB-CE2 4.01Å; L66-Y70 WeakPolarHBondContact O-CD2 3.4Å; L66-Y70 PolarHBondContact O-N 3.37Å; Y70-R74 WeakPolarHBondContact O-CG 3.15Å; Y70-R74 PolarHBondContact O-N 3.21Å
71	R	95.8	Very high	95.2	Very high	151 Å²	151	116.6 Å²	116.6	57%	0.57	56%	0.556	S	S	*	*	H	α-helix	trans	-66.5	-44.6	172.5	-176.3	-179.6	64.4	-165.6	4.4	111.8	K67 K68 V69 R74 N75	K67-R71 PolarHBondContact O-N 3.35Å; K68-R71 PolarHBondContact O-N 3.22Å; V69-R71 VanDerWaalsContact C-N 3.28Å; V69-R71 PolarHBondContact O-N 3.01Å; R71-R74 PolarHBondContact O-N 3.16Å; R71-N75 PolarHBondContact O-N 3.41Å
72	R	95.6	Very high	94.8	Very high	105 Å²	105	120.5 Å²	120.5	40%	0.396	57%	0.57	S	S	.	*	H	α-helix	trans	-62.2	-42.9	175.1	-72.1	179.2	69.6	179.3	5.7	111.3	K68 V69 R74 N75 G76 F77 E79	K68-R72 WeakPolarHBondContact O-CG 3.43Å; K68-R72 PolarHBondContact O-N 3.43Å; V69-R72 CarbonylContact O-C 3.59Å; V69-R72 PolarHBondContact O-N 3.22Å; V69-R72 VanDerWaalsContact O-N 3.11Å; R72-R74 PolarHBondContact O-N 3.46Å; R72-N75 CarbonylContact O-C 3.51Å; R72-N75 VanDerWaalsContact O-C 3.26Å; R72-N75 WeakPolarHBondContact O-CA 3.43Å; R72-N75 PolarHBondContact O-N 3.1Å; R72-G76 PolarHBondContact O-N 3.24Å; R72-G76 VanDerWaalsContact O-N 3.14Å; R72-F77 HydrophobicContact CB-CD1 3.82Å; R72-F77 HydrophobicContact CB-CE1 4.27Å; R72-F77 WeakPolarHBondContact O-CA 3.43Å; R72-F77 PolarHBondContact O-N 2.95Å; R72-E79 IonicContact CZ-OE2 3.96Å; R72-E79 IonicContact NH2-OE2 2.8Å; R72-E79 PolarHBondContact NH2-OE2 3.15Å
73	F	97.1	Very high	94.3	Very high	133 Å²	133	117.2 Å²	117.2	58%	0.583	57%	0.573	S	S	*	*	H	α-helix	trans	-56.1	-48.3	177.9	175.2	-97	0	0	0	111.6	V69 N75 G76 F77	V69-F73 WeakPolarHBondContact O-CB 3.46Å; V69-F73 PolarHBondContact O-N 3.1Å; F73-N75 PolarHBondContact O-N 3.23Å; F73-G76 PolarHBondContact O-N 3.45Å; F73-F77 HydrophobicContact CB-CE1 4.08Å; F73-F77 HydrophobicContact CB-CE2 4.21Å; F73-F77 HydrophobicContact CB-CZ 3.73Å; F73-F77 AromaticContact CD2-CE2 3.52Å; F73-F77 HydrophobicContact CD2-CE2 3.52Å; F73-F77 AromaticContact CD2-CZ 3.62Å; F73-F77 HydrophobicContact CD2-CZ 3.62Å; F73-F77 HydrophobicContact CE2-CE2 4.39Å; F73-F77 HydrophobicContact CG-CE2 4.34Å; F73-F77 HydrophobicContact CG-CZ 4.17Å
74	R	96.6	Very high	93.8	Very high	200 Å²	200	122.9 Å²	122.9	76%	0.755	60%	0.596	S	S	*	*	H	α-helix	trans	-60.9	-25	175.2	-70.9	-176.2	-173.5	113.7	-1.2	113.7	Y70 R71 R72	Y70-R74 WeakPolarHBondContact O-CG 3.15Å; Y70-R74 PolarHBondContact O-N 3.21Å; R71-R74 PolarHBondContact O-N 3.16Å; R72-R74 PolarHBondContact O-N 3.46Å
75	N	93.6	Very high	93.4	Very high	101 Å²	101	119.8 Å²	119.8	54%	0.54	60%	0.598	S	S	.	*	T	Hydrogen-bonded Turn	trans	-97.7	16	177.2	-62.5	-10.3	0	0	0	112.3	R71 R72 F73 F77 R78	R71-N75 PolarHBondContact O-N 3.41Å; R72-N75 CarbonylContact O-C 3.51Å; R72-N75 VanDerWaalsContact O-C 3.26Å; R72-N75 WeakPolarHBondContact O-CA 3.43Å; R72-N75 PolarHBondContact O-N 3.1Å; F73-N75 PolarHBondContact O-N 3.23Å; N75-F77 VanDerWaalsContact C-N 3.34Å; N75-F77 PolarHBondContact O-N 3.21Å; N75-R78 VanDerWaalsContact O-CD 3.25Å; N75-R78 WeakPolarHBondContact O-CD 3.33Å; N75-R78 WeakPolarHBondContact O-CG 3.12Å; N75-R78 PolarHBondContact O-N 3.46Å
76	G	95.1	Very high	92.7	Very high	57 Å²	57	123.2 Å²	123.2	59%	0.588	61%	0.611	S	S	*	*	T	Hydrogen-bonded Turn	trans	68.1	26.9	178	0	0	0	0	0	114.7	R72 F73 R78	R72-G76 PolarHBondContact O-N 3.24Å; R72-G76 VanDerWaalsContact O-N 3.14Å; F73-G76 PolarHBondContact O-N 3.45Å; G76-R78 PolarHBondContact O-N 3.48Å
77	F	95.2	Very high	92	Very high	99 Å²	99	131.2 Å²	131.2	43%	0.434	64%	0.637	S	S	.	*	T	Hydrogen-bonded Turn	trans	53.8	20.3	-175.4	-61.7	-74.5	0	0	0	115.6	V69 R72 F73 N75 E79	V69-F77 HydrophobicContact CG1-CE1 4.22Å; R72-F77 HydrophobicContact CB-CD1 3.82Å; R72-F77 HydrophobicContact CB-CE1 4.27Å; R72-F77 WeakPolarHBondContact O-CA 3.43Å; R72-F77 PolarHBondContact O-N 2.95Å; F73-F77 HydrophobicContact CB-CE1 4.08Å; F73-F77 HydrophobicContact CB-CE2 4.21Å; F73-F77 HydrophobicContact CB-CZ 3.73Å; F73-F77 AromaticContact CD2-CE2 3.52Å; F73-F77 HydrophobicContact CD2-CE2 3.52Å; F73-F77 AromaticContact CD2-CZ 3.62Å; F73-F77 HydrophobicContact CD2-CZ 3.62Å; F73-F77 HydrophobicContact CE2-CE2 4.39Å; F73-F77 HydrophobicContact CG-CE2 4.34Å; F73-F77 HydrophobicContact CG-CZ 4.17Å; N75-F77 VanDerWaalsContact C-N 3.34Å; N75-F77 PolarHBondContact O-N 3.21Å; F77-E79 PolarHBondContact O-N 3.24Å
78	R	91.8	Very high	91	Very high	184 Å²	184	129.5 Å²	129.5	69%	0.694	65%	0.647	S	S	*	*			trans	-47.7	134.8	177.5	-68.9	170.5	74	173.3	7.3	111.6	N75 G76	N75-R78 VanDerWaalsContact O-CD 3.25Å; N75-R78 WeakPolarHBondContact O-CD 3.33Å; N75-R78 WeakPolarHBondContact O-CG 3.12Å; N75-R78 PolarHBondContact O-N 3.46Å; G76-R78 PolarHBondContact O-N 3.48Å
79	E	92.5	Very high	89.9	Confident	151 Å²	151	128.4 Å²	128.4	71%	0.706	66%	0.661	S	S	*	*			trans	-139.4	157.9	-175.9	-170.4	157.7	175.2	0	0	109.3	R72 F77 T81	R72-E79 IonicContact CZ-OE2 3.96Å; R72-E79 IonicContact NH2-OE2 2.8Å; R72-E79 PolarHBondContact NH2-OE2 3.15Å; F77-E79 PolarHBondContact O-N 3.24Å; E79-T81 PolarHBondContact O-N 3.13Å
80	G	89.5	Confident	88.4	Confident	86 Å²	86	133.1 Å²	133.1	89%	0.887	69%	0.69	S	S	*	*	S	Bend	trans	70.6	-5.5	176.4	0	0	0	0	0	116.8
81	T	88.3	Confident	86.9	Confident	90 Å²	90	131.1 Å²	131.1	55%	0.552	70%	0.7	S	S	*	*	P	Polyproline II helix	trans	-93.3	136	179.4	60.1	0	0	0	0	111.8	E79	E79-T81 PolarHBondContact O-N 3.13Å
82	T	87	Confident	85.5	Confident	130 Å²	130	128.6 Å²	128.6	80%	0.798	71%	0.711	S	S	*	*	P	Polyproline II helix	trans	-91.4	147.9	168	53.6	0	0	0	0	110.9
83	P	86.2	Confident	84	Confident	119 Å²	119	129.1 Å²	129.1	77%	0.773	73%	0.731	S	S	*	*	P	Polyproline II helix	trans	-60.8	140	172	-21.3	33.1	0	0	0	111
84	K	88	Confident	82.4	Confident	184 Å²	184	128.3 Å²	128.3	80%	0.8	74%	0.742	S	S	*	*	P	Polyproline II helix	trans	-56.4	130.8	174.1	-172.7	178.7	-178.7	177.7	0	109.3
85	P	88.2	Confident	81	Confident	109 Å²	109	124.4 Å²	124.4	71%	0.708	75%	0.745	S	S	*	*	P	Polyproline II helix	trans	-61.3	141	178.2	25.4	-34.1	0	0	0	110.2	R87	P85-R87 PolarHBondContact O-N 3.15Å
86	K	83	Confident	79.2	Confident	211 Å²	211	128.8 Å²	128.8	92%	0.917	78%	0.784	S	S	*	*	P	Polyproline II helix	trans	-72.3	121.2	174.1	-65.6	-176	179.6	-177	0	108.4
87	R	81.2	Confident	78.5	Confident	227 Å²	227	132.4 Å²	132.4	86%	0.857	79%	0.794	S	S	*	*	P	Polyproline II helix	trans	-79.2	135.3	167.6	-65.8	-172.9	175.8	-163.7	-2.1	108.1	P85 A89	P85-R87 PolarHBondContact O-N 3.15Å; R87-A89 PolarHBondContact O-N 2.76Å
88	A	76.7	Confident	77.6	Confident	90 Å²	90	134.2 Å²	134.2	74%	0.744	81%	0.813	S	S	*	*	P	Polyproline II helix	trans	-58.3	137.3	171	0	0	0	0	0	108.8	V90	A88-V90 PolarHBondContact O-N 2.93Å
89	A	71.9	Confident	76.8	Confident	102 Å²	102	131.4 Å²	131.4	84%	0.843	82%	0.819	S	S	*	*	P	Polyproline II helix	trans	-62.8	119.1	172.7	0	0	0	0	0	107.7	R87 A91	R87-A89 PolarHBondContact O-N 2.76Å; A89-A91 PolarHBondContact O-N 3.18Å
90	V	66	Low	75.9	Confident	137 Å²	137	130.2 Å²	130.2	83%	0.83	83%	0.826	S	S	*	*	P	Polyproline II helix	trans	-67.6	120.2	170.8	-166.8	0	0	0	0	105.7	A88 A92	A88-V90 PolarHBondContact O-N 2.93Å; V90-A92 PolarHBondContact O-N 3.2Å
91	A	66.2	Low	75	Confident	87 Å²	87	133 Å²	133	72%	0.719	82%	0.822	S	S	*	*	P	Polyproline II helix	trans	-57	129.2	173.3	0	0	0	0	0	108.1	A89 S93	A89-A91 PolarHBondContact O-N 3.18Å; A91-S93 PolarHBondContact O-N 3.02Å; A91-S93 VanDerWaalsContact O-N 3.15Å
92	A	65.5	Low	74.1	Confident	99 Å²	99	135.9 Å²	135.9	82%	0.818	84%	0.84	S	S	*	*	P	Polyproline II helix	trans	-61	119.6	174.8	0	0	0	0	0	108.1	V90 S94	V90-A92 PolarHBondContact O-N 3.2Å; A92-S94 PolarHBondContact O-N 3.16Å; A92-S94 VanDerWaalsContact O-N 3.09Å
93	S	64.5	Low	73.2	Confident	116 Å²	116	136.3 Å²	136.3	81%	0.811	84%	0.843	S	S	*	*			trans	-60.1	112.6	173.2	-40.1	0	0	0	0	107.9	A91 S95	A91-S93 PolarHBondContact O-N 3.02Å; A91-S93 VanDerWaalsContact O-N 3.15Å; S93-S95 PolarHBondContact O-N 3.33Å
94	S	62.7	Low	72.2	Confident	116 Å²	116	137.6 Å²	137.6	81%	0.811	85%	0.849	S	S	*	*			trans	-65	104.7	167.1	47.1	0	0	0	0	107.9	A92	A92-S94 PolarHBondContact O-N 3.16Å; A92-S94 VanDerWaalsContact O-N 3.09Å
95	S	67.1	Low	70.9	Confident	117 Å²	117	133.8 Å²	133.8	82%	0.818	85%	0.853	S	S	*	*			trans	-67	132.1	168.3	36.1	0	0	0	0	109.4	S93	S93-S95 PolarHBondContact O-N 3.33Å
96	S	57.6	Low	69.3	Low	194 Å²	194	136 Å²	136	100%	1.357	87%	0.866	S	S	*	*			trans	-56.5	0	-179.6	-53.7	0	0	0	0	114.1

Retrieved 96 of 96 residues in 50.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).