A0A093HWN7_STRCA Loading...

Single-pass membrane and coiled-coil domain-containing protein 4

AlphaFold DB , UniProt , Accession A0A093HWN7, Species STRCA (Struthio camelus australis), Gene n/a, Length 59 aa.

						>A0A093HWN7_STRCA|A0A093HWN7
MRQLKGKPKKETSKDKKERKQAMQEARQQITTVVLPTLAIVVVLIVVFVYVATRPNTTE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.1	Low	50.7	Low	246 Å²	246	172.6 Å²	172.6	100%	1.212	83%	0.829	S	S	*	*				0	114	0	-73.1	-177.9	178.5	0	0	110.2
2	R	52	Low	51.3	Low	246 Å²	246	162.8 Å²	162.8	93%	0.928	79%	0.787	S	S	*	*			trans	-173.2	86.4	140.4	-112	168.3	80.8	170.3	1.5	106.6	L4	R2-L4 PolarHBondContact O-N 3.24Å
3	Q	58.7	Low	51.3	Low	159 Å²	159	157.6 Å²	157.6	74%	0.743	78%	0.778	S	S	*	*			trans	-66.2	123.8	167.7	-72.2	-129.4	56	0	0	107.7	K5	Q3-K5 PolarHBondContact O-N 3.35Å
4	L	55.8	Low	51.3	Low	161 Å²	161	157.5 Å²	157.5	84%	0.843	77%	0.771	S	S	*	*			trans	-55	120.1	177.6	-76.3	142.6	0	0	0	110	R2 G6	R2-L4 PolarHBondContact O-N 3.24Å; L4-G6 PolarHBondContact O-N 2.88Å
5	K	52.8	Low	51.3	Low	226 Å²	226	152.5 Å²	152.5	98%	0.983	75%	0.749	S	S	*	*	S	Bend	trans	-71.8	77	174.6	-169.2	166.2	-178.3	178.6	0	108.4	Q3	Q3-K5 PolarHBondContact O-N 3.35Å
6	G	50.5	Low	51.3	Low	63 Å²	63	153.9 Å²	153.9	65%	0.649	75%	0.75	S	S	*	*			trans	-172.4	17.4	-174.8	0	0	0	0	0	113.3	L4 P8	L4-G6 PolarHBondContact O-N 2.88Å; G6-P8 VanDerWaalsContact C-CD 3.43Å; G6-P8 WeakPolarHBondContact O-CD 2.91Å
7	K	48.8	Very low	51.5	Low	159 Å²	159	152.9 Å²	152.9	69%	0.691	74%	0.741	S	S	*	*			trans	-83.3	98.8	157.8	-62.9	-176.8	-174	-179.8	0	105.9	K9	K7-K9 PolarHBondContact O-N 2.85Å
8	P	49.7	Very low	51.6	Low	110 Å²	110	150.6 Å²	150.6	71%	0.714	73%	0.729	S	S	*	*			trans	-57.8	102.9	144.3	26.8	-27.3	0	0	0	104.3	G6 K10	G6-P8 VanDerWaalsContact C-CD 3.43Å; G6-P8 WeakPolarHBondContact O-CD 2.91Å; P8-K10 PolarHBondContact O-N 2.74Å
9	K	43.5	Very low	51.9	Low	173 Å²	173	152.6 Å²	152.6	75%	0.752	73%	0.728	S	S	*	*			trans	6.7	114.2	146.9	-166.4	171.7	-176.2	-179.1	0	109.9	K7 E11	K7-K9 PolarHBondContact O-N 2.85Å; K9-E11 PolarHBondContact O-N 2.57Å
10	K	42.3	Very low	52.1	Low	190 Å²	190	152.8 Å²	152.8	83%	0.826	73%	0.725	S	S	*	*			trans	-40.9	87.3	165.7	-169.9	169.8	-173.2	174.3	0	107.4	P8 T12	P8-K10 PolarHBondContact O-N 2.74Å; K10-T12 PolarHBondContact O-N 3.36Å
11	E	43.9	Very low	52.3	Low	166 Å²	166	150.1 Å²	150.1	78%	0.776	71%	0.712	S	S	*	*			trans	-74	82.4	173.2	-84	-168.1	101	0	0	102.8	K9 S13	K9-E11 PolarHBondContact O-N 2.57Å; E11-S13 PolarHBondContact O-N 3.29Å
12	T	58.2	Low	52.2	Low	54 Å²	54	141 Å²	141	33%	0.331	68%	0.676	S	S	.	*			trans	54.5	74	133.6	30.9	0	0	0	0	112.1	K10 K14 D15 K16	K10-T12 PolarHBondContact O-N 3.36Å; T12-K14 HydrophobicContact CG2-CB 4.11Å; T12-K14 PolarHBondContact O-N 3.26Å; T12-D15 HydrophobicContact CG2-CB 4.23Å; T12-D15 PolarHBondContact O-N 2.97Å; T12-D15 WeakPolarHBondContact OG1-CB 3.33Å; T12-K16 PolarHBondContact O-N 2.94Å; T12-K16 VanDerWaalsContact O-N 3.15Å
13	S	50.5	Low	52.5	Low	96 Å²	96	135.9 Å²	135.9	67%	0.671	66%	0.664	S	S	*	*	T	Hydrogen-bonded Turn	trans	-49.7	-15.6	145.6	-50.5	0	0	0	0	112.2	E11	E11-S13 PolarHBondContact O-N 3.29Å
14	K	52	Low	52.6	Low	156 Å²	156	134.3 Å²	134.3	68%	0.678	66%	0.657	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.1	-44.4	167.3	-57.5	-170.8	175	-168.8	0	113.5	T12 K16 K17 E18	T12-K14 HydrophobicContact CG2-CB 4.11Å; T12-K14 PolarHBondContact O-N 3.26Å; K14-K16 PolarHBondContact O-N 2.88Å; K14-K17 CarbonylContact O-C 3.5Å; K14-K17 WeakPolarHBondContact O-CA 3.25Å; K14-K17 WeakPolarHBondContact O-CB 3.31Å; K14-K17 PolarHBondContact O-N 3.36Å; K14-E18 WeakPolarHBondContact O-CG 3.45Å; K14-E18 PolarHBondContact O-N 2.85Å
15	D	50.8	Low	52.8	Low	82 Å²	82	132.3 Å²	132.3	44%	0.439	64%	0.644	S	S	.	*	H	α-helix	trans	-69.3	-37.4	-178.8	-174.4	-81.4	0	0	0	111.6	T12 K17 E18 R19	T12-D15 HydrophobicContact CG2-CB 4.23Å; T12-D15 PolarHBondContact O-N 2.97Å; T12-D15 WeakPolarHBondContact OG1-CB 3.33Å; D15-K17 PolarHBondContact O-N 3.15Å; D15-E18 PolarHBondContact O-N 3.42Å; D15-R19 PolarHBondContact O-N 2.96Å
16	K	52.2	Low	53.1	Low	175 Å²	175	123.7 Å²	123.7	76%	0.761	61%	0.614	S	S	*	*	H	α-helix	trans	-61.3	-27.9	168.1	-110.3	-173.7	-176.7	-170	0	113.1	T12 K14	T12-K16 PolarHBondContact O-N 2.94Å; T12-K16 VanDerWaalsContact O-N 3.15Å; K14-K16 PolarHBondContact O-N 2.88Å
17	K	54.6	Low	53.6	Low	138 Å²	138	129.6 Å²	129.6	60%	0.6	62%	0.617	S	S	*	*	H	α-helix	trans	-83.1	-40.9	177.6	-137.1	179.5	-177.4	-171.3	0	110.5	K14 D15 K20 Q21	K14-K17 CarbonylContact O-C 3.5Å; K14-K17 WeakPolarHBondContact O-CA 3.25Å; K14-K17 WeakPolarHBondContact O-CB 3.31Å; K14-K17 PolarHBondContact O-N 3.36Å; D15-K17 PolarHBondContact O-N 3.15Å; K17-K20 PolarHBondContact O-N 3.36Å; K17-Q21 WeakPolarHBondContact O-CB 3.34Å; K17-Q21 WeakPolarHBondContact O-CG 3.4Å; K17-Q21 PolarHBondContact O-N 2.88Å
18	E	53	Low	54.1	Low	111 Å²	111	128.3 Å²	128.3	52%	0.519	61%	0.613	S	S	.	*	H	α-helix	trans	-64.5	-39.7	177.9	-70.9	172.2	101.8	0	0	111.9	K14 D15 K20 Q21 A22	K14-E18 WeakPolarHBondContact O-CG 3.45Å; K14-E18 PolarHBondContact O-N 2.85Å; D15-E18 PolarHBondContact O-N 3.42Å; E18-K20 VanDerWaalsContact C-N 3.35Å; E18-K20 PolarHBondContact O-N 3.34Å; E18-Q21 PolarHBondContact O-N 3.43Å; E18-A22 VanDerWaalsContact O-CB 3.31Å; E18-A22 WeakPolarHBondContact O-CB 3.18Å; E18-A22 PolarHBondContact O-N 3.21Å
19	R	56.1	Low	54.6	Low	189 Å²	189	129.5 Å²	129.5	71%	0.713	61%	0.61	S	S	*	*	H	α-helix	trans	-65.2	-34.8	173.2	-78	-177.6	83.5	-164	7.4	113.6	D15 M23	D15-R19 PolarHBondContact O-N 2.96Å; R19-M23 PolarHBondContact O-N 3.49Å
20	K	57	Low	55.4	Low	156 Å²	156	126.5 Å²	126.5	68%	0.678	60%	0.6	S	S	*	*	H	α-helix	trans	-73.8	-38.4	175.2	-88.6	-170.7	174.3	-171.6	0	111.9	K17 E18 Q24	K17-K20 PolarHBondContact O-N 3.36Å; E18-K20 VanDerWaalsContact C-N 3.35Å; E18-K20 PolarHBondContact O-N 3.34Å; K20-Q24 WeakPolarHBondContact O-CG 3.46Å; K20-Q24 PolarHBondContact O-N 3.45Å; K20-Q24 VanDerWaalsContact O-N 3.14Å
21	Q	56.7	Low	56.3	Low	97 Å²	97	121.2 Å²	121.2	45%	0.453	58%	0.584	S	S	.	*	H	α-helix	trans	-67.9	-44	177.4	-77.7	174.7	-40.7	0	0	111.4	K17 E18 M23 Q24 E25	K17-Q21 WeakPolarHBondContact O-CB 3.34Å; K17-Q21 WeakPolarHBondContact O-CG 3.4Å; K17-Q21 PolarHBondContact O-N 2.88Å; E18-Q21 PolarHBondContact O-N 3.43Å; Q21-M23 VanDerWaalsContact C-N 3.33Å; Q21-M23 PolarHBondContact O-N 2.97Å; Q21-Q24 CarbonylContact O-C 3.57Å; Q21-Q24 PolarHBondContact O-N 2.82Å; Q21-E25 WeakPolarHBondContact O-CG 3.49Å; Q21-E25 PolarHBondContact O-N 3.29Å
22	A	58.2	Low	57.6	Low	55 Å²	55	118 Å²	118	46%	0.455	58%	0.576	S	S	.	*	H	α-helix	trans	-62.4	-37.3	177	0	0	0	0	0	112.9	E18 Q24 A26	E18-A22 VanDerWaalsContact O-CB 3.31Å; E18-A22 WeakPolarHBondContact O-CB 3.18Å; E18-A22 PolarHBondContact O-N 3.21Å; A22-Q24 VanDerWaalsContact C-N 3.34Å; A22-A26 VanDerWaalsContact O-CB 3.25Å; A22-A26 WeakPolarHBondContact O-CB 3.19Å; A22-A26 PolarHBondContact O-N 2.92Å
23	M	58.1	Low	58.6	Low	137 Å²	137	119.8 Å²	119.8	68%	0.675	59%	0.587	S	S	*	*	H	α-helix	trans	-67.7	-33.6	172.6	-91.2	-173.1	-178.4	0	0	112.9	R19 Q21 R27	R19-M23 PolarHBondContact O-N 3.49Å; Q21-M23 VanDerWaalsContact C-N 3.33Å; Q21-M23 PolarHBondContact O-N 2.97Å; M23-R27 WeakPolarHBondContact O-CB 3.4Å; M23-R27 WeakPolarHBondContact O-CG 3.46Å; M23-R27 PolarHBondContact O-N 2.8Å; M23-R27 VanDerWaalsContact O-N 3.09Å
24	Q	59.2	Low	60.1	Low	126 Å²	126	118.7 Å²	118.7	59%	0.589	58%	0.576	S	S	*	*	H	α-helix	trans	-75.4	-40.9	177.5	-77	-177	-19.3	0	0	112	K20 Q21 A22 R27 Q28	K20-Q24 WeakPolarHBondContact O-CG 3.46Å; K20-Q24 PolarHBondContact O-N 3.45Å; K20-Q24 VanDerWaalsContact O-N 3.14Å; Q21-Q24 CarbonylContact O-C 3.57Å; Q21-Q24 PolarHBondContact O-N 2.82Å; A22-Q24 VanDerWaalsContact C-N 3.34Å; Q24-R27 PolarHBondContact O-N 2.78Å; Q24-Q28 WeakPolarHBondContact O-CB 3.32Å; Q24-Q28 PolarHBondContact O-N 3.46Å
25	E	60	Low	61.6	Low	120 Å²	120	117.1 Å²	117.1	56%	0.561	57%	0.574	S	S	*	*	H	α-helix	trans	-64	-43	174	-75.7	-179.4	153	0	0	111.2	Q21 R27 Q28 Q29	Q21-E25 WeakPolarHBondContact O-CG 3.49Å; Q21-E25 PolarHBondContact O-N 3.29Å; E25-R27 VanDerWaalsContact C-N 3.34Å; E25-R27 PolarHBondContact O-N 3.03Å; E25-Q28 PolarHBondContact O-N 3.09Å; E25-Q29 WeakPolarHBondContact O-CB 3.37Å; E25-Q29 WeakPolarHBondContact O-CG 3.43Å; E25-Q29 PolarHBondContact O-N 2.83Å
26	A	60	Low	63.3	Low	45 Å²	45	116.1 Å²	116.1	37%	0.372	57%	0.572	S	S	.	*	H	α-helix	trans	-61.7	-42.3	173.8	0	0	0	0	0	111.7	A22 Q29 I30	A22-A26 VanDerWaalsContact O-CB 3.25Å; A22-A26 WeakPolarHBondContact O-CB 3.19Å; A22-A26 PolarHBondContact O-N 2.92Å; A26-Q29 PolarHBondContact O-N 3.2Å; A26-I30 WeakPolarHBondContact O-CD1 3.5Å; A26-I30 WeakPolarHBondContact O-CG1 3.33Å; A26-I30 PolarHBondContact O-N 3.15Å
27	R	60.1	Low	65.2	Low	186 Å²	186	111.3 Å²	111.3	70%	0.702	56%	0.558	S	S	*	*	H	α-helix	trans	-64.7	-38.8	173.8	-81.8	178	176.1	-129.8	-0.8	112.2	M23 Q24 E25 T31	M23-R27 WeakPolarHBondContact O-CB 3.4Å; M23-R27 WeakPolarHBondContact O-CG 3.46Å; M23-R27 PolarHBondContact O-N 2.8Å; M23-R27 VanDerWaalsContact O-N 3.09Å; Q24-R27 PolarHBondContact O-N 2.78Å; E25-R27 VanDerWaalsContact C-N 3.34Å; E25-R27 PolarHBondContact O-N 3.03Å; R27-T31 WeakPolarHBondContact O-CB 3.01Å; R27-T31 PolarHBondContact O-N 2.83Å; R27-T31 PolarHBondContact O-OG1 3.14Å
28	Q	59.9	Low	67	Low	132 Å²	132	109.8 Å²	109.8	62%	0.617	56%	0.556	S	S	*	*	H	α-helix	trans	-65.8	-44.3	176.2	-94.8	174	-25.2	0	0	111.4	Q24 E25 T31 T32	Q24-Q28 WeakPolarHBondContact O-CB 3.32Å; Q24-Q28 PolarHBondContact O-N 3.46Å; E25-Q28 PolarHBondContact O-N 3.09Å; Q28-T31 PolarHBondContact O-N 2.65Å; Q28-T32 PolarHBondContact O-N 2.94Å; Q28-T32 PolarHBondContact O-OG1 3.36Å
29	Q	60.1	Low	68.9	Low	136 Å²	136	107 Å²	107	64%	0.636	55%	0.552	S	S	*	*	H	α-helix	trans	-61.7	-43.2	175.6	-76.7	-173.7	-8.4	0	0	112.3	E25 A26 T31 T32 V33	E25-Q29 WeakPolarHBondContact O-CB 3.37Å; E25-Q29 WeakPolarHBondContact O-CG 3.43Å; E25-Q29 PolarHBondContact O-N 2.83Å; A26-Q29 PolarHBondContact O-N 3.2Å; Q29-T31 VanDerWaalsContact C-N 3.31Å; Q29-T31 PolarHBondContact O-N 3.48Å; Q29-T32 WeakPolarHBondContact CA-OG1 3.28Å; Q29-T32 PolarHBondContact O-N 3.17Å; Q29-T32 PolarHBondContact O-OG1 3.1Å; Q29-V33 WeakPolarHBondContact O-CG2 3.15Å; Q29-V33 PolarHBondContact O-N 3.4Å; Q29-V33 VanDerWaalsContact O-N 3.1Å
30	I	60.9	Low	70.8	Confident	109 Å²	109	103 Å²	103	56%	0.559	54%	0.543	S	S	*	.	H	α-helix	trans	-63.2	-43.1	175.5	-66.2	163.5	0	0	0	109.8	A26 V33 V34	A26-I30 WeakPolarHBondContact O-CD1 3.5Å; A26-I30 WeakPolarHBondContact O-CG1 3.33Å; A26-I30 PolarHBondContact O-N 3.15Å; I30-V33 PolarHBondContact O-N 3.42Å; I30-V34 HydrophobicContact CG2-CG2 4.09Å; I30-V34 WeakPolarHBondContact O-CB 3.39Å; I30-V34 WeakPolarHBondContact O-CG2 3.35Å; I30-V34 PolarHBondContact O-N 3.2Å
31	T	61.3	Low	72.6	Confident	79 Å²	79	98.7 Å²	98.7	49%	0.485	53%	0.53	S	S	.	.	H	α-helix	trans	-66.5	-40.9	179.9	-50.7	0	0	0	0	111.5	R27 Q28 Q29 V33 V34 L35	R27-T31 WeakPolarHBondContact O-CB 3.01Å; R27-T31 PolarHBondContact O-N 2.83Å; R27-T31 PolarHBondContact O-OG1 3.14Å; Q28-T31 PolarHBondContact O-N 2.65Å; Q29-T31 VanDerWaalsContact C-N 3.31Å; Q29-T31 PolarHBondContact O-N 3.48Å; T31-V33 VanDerWaalsContact C-N 3.3Å; T31-V33 PolarHBondContact O-N 2.79Å; T31-V34 PolarHBondContact O-N 2.93Å; T31-L35 HydrophobicContact CG2-CD1 4.43Å; T31-L35 VanDerWaalsContact O-CB 3.3Å; T31-L35 WeakPolarHBondContact O-CB 3.29Å; T31-L35 PolarHBondContact O-N 2.64Å
32	T	70.9	Confident	74.5	Confident	98 Å²	98	98.2 Å²	98.2	60%	0.601	53%	0.534	S	S	*	.	H	α-helix	trans	-72.4	-17.7	178.8	41.7	0	0	0	0	114	Q28 Q29 P36	Q28-T32 PolarHBondContact O-N 2.94Å; Q28-T32 PolarHBondContact O-OG1 3.36Å; Q29-T32 WeakPolarHBondContact CA-OG1 3.28Å; Q29-T32 PolarHBondContact O-N 3.17Å; Q29-T32 PolarHBondContact O-OG1 3.1Å; T32-P36 WeakPolarHBondContact O-CD 3.37Å; T32-P36 WeakPolarHBondContact O-CG 2.86Å
33	V	78	Confident	76.3	Confident	93 Å²	93	100 Å²	100	56%	0.564	54%	0.538	S	S	*	.	H	α-helix	trans	-90.8	-38.9	171.7	177	0	0	0	0	111.2	Q29 I30 T31 P36 T37	Q29-V33 WeakPolarHBondContact O-CG2 3.15Å; Q29-V33 PolarHBondContact O-N 3.4Å; Q29-V33 VanDerWaalsContact O-N 3.1Å; I30-V33 PolarHBondContact O-N 3.42Å; T31-V33 VanDerWaalsContact C-N 3.3Å; T31-V33 PolarHBondContact O-N 2.79Å; V33-P36 VanDerWaalsContact O-CD 3.28Å; V33-P36 WeakPolarHBondContact O-CD 3.35Å; V33-P36 VanDerWaalsContact O-CG 3.29Å; V33-P36 WeakPolarHBondContact O-CG 3.3Å; V33-T37 WeakPolarHBondContact O-CB 3.31Å; V33-T37 PolarHBondContact O-N 3.47Å; V33-T37 PolarHBondContact O-OG1 2.94Å
34	V	83.3	Confident	78.1	Confident	73 Å²	73	98.7 Å²	98.7	44%	0.442	53%	0.534	S	S	.	.	H	α-helix	trans	-67.8	-40.2	-178.9	172.3	0	0	0	0	111.5	I30 T31 T37 L38	I30-V34 HydrophobicContact CG2-CG2 4.09Å; I30-V34 WeakPolarHBondContact O-CB 3.39Å; I30-V34 WeakPolarHBondContact O-CG2 3.35Å; I30-V34 PolarHBondContact O-N 3.2Å; T31-V34 PolarHBondContact O-N 2.93Å; V34-T37 PolarHBondContact O-N 3.3Å; V34-L38 HydrophobicContact CG1-CD1 3.84Å; V34-L38 HydrophobicContact CG1-CG 4.22Å; V34-L38 WeakPolarHBondContact O-CB 3.35Å; V34-L38 WeakPolarHBondContact O-CG 3.29Å; V34-L38 PolarHBondContact O-N 3.29Å
35	L	82.3	Confident	79.8	Confident	122 Å²	122	97.1 Å²	97.1	64%	0.639	53%	0.528	S	S	*	.	H	α-helix	trans	-61.6	-48.7	-179	-141.7	141.2	0	0	0	113.7	T31 A39	T31-L35 HydrophobicContact CG2-CD1 4.43Å; T31-L35 VanDerWaalsContact O-CB 3.3Å; T31-L35 WeakPolarHBondContact O-CB 3.29Å; T31-L35 PolarHBondContact O-N 2.64Å; L35-A39 PolarHBondContact O-N 3.31Å; L35-A39 VanDerWaalsContact O-N 3.14Å
36	P	87.6	Confident	81.4	Confident	62 Å²	62	95.7 Å²	95.7	40%	0.403	53%	0.528	S	S	.	.	H	α-helix	trans	-69.6	-32.7	173.9	26.9	-34.3	0	0	0	112.5	T32 V33 A39 I40	T32-P36 WeakPolarHBondContact O-CD 3.37Å; T32-P36 WeakPolarHBondContact O-CG 2.86Å; V33-P36 VanDerWaalsContact O-CD 3.28Å; V33-P36 WeakPolarHBondContact O-CD 3.35Å; V33-P36 VanDerWaalsContact O-CG 3.29Å; V33-P36 WeakPolarHBondContact O-CG 3.3Å; P36-A39 PolarHBondContact O-N 2.97Å; P36-I40 VanDerWaalsContact O-CG1 3.29Å; P36-I40 WeakPolarHBondContact O-CG1 3.42Å; P36-I40 PolarHBondContact O-N 2.89Å
37	T	91.3	Very high	83	Confident	73 Å²	73	97.2 Å²	97.2	45%	0.448	53%	0.532	S	S	.	.	H	α-helix	trans	-63.9	-45.2	177	-54.4	0	0	0	0	111	V33 V34 A39 I40 V41	V33-T37 WeakPolarHBondContact O-CB 3.31Å; V33-T37 PolarHBondContact O-N 3.47Å; V33-T37 PolarHBondContact O-OG1 2.94Å; V34-T37 PolarHBondContact O-N 3.3Å; T37-A39 VanDerWaalsContact C-N 3.34Å; T37-A39 PolarHBondContact O-N 3.47Å; T37-I40 PolarHBondContact O-N 3.29Å; T37-V41 VanDerWaalsContact O-CG2 3.31Å; T37-V41 WeakPolarHBondContact O-CG2 3.2Å; T37-V41 PolarHBondContact O-N 3.05Å
38	L	92.2	Very high	84.5	Confident	107 Å²	107	95.4 Å²	95.4	56%	0.56	53%	0.529	S	S	*	.	H	α-helix	trans	-61.7	-41.3	174.7	-75.3	172.3	0	0	0	111.8	V34 I40 V41 V42	V34-L38 HydrophobicContact CG1-CD1 3.84Å; V34-L38 HydrophobicContact CG1-CG 4.22Å; V34-L38 WeakPolarHBondContact O-CB 3.35Å; V34-L38 WeakPolarHBondContact O-CG 3.29Å; V34-L38 PolarHBondContact O-N 3.29Å; L38-I40 PolarHBondContact O-N 3.14Å; L38-V41 PolarHBondContact O-N 2.81Å; L38-V42 VanDerWaalsContact O-CG2 3.32Å; L38-V42 WeakPolarHBondContact O-CG2 3.3Å; L38-V42 PolarHBondContact O-N 3.26Å
39	A	92.9	Very high	86.1	Confident	53 Å²	53	92.4 Å²	92.4	44%	0.438	52%	0.52	S	S	.	.	H	α-helix	trans	-60.5	-44.8	176.2	0	0	0	0	0	111.9	L35 P36 T37 V42 V43	L35-A39 PolarHBondContact O-N 3.31Å; L35-A39 VanDerWaalsContact O-N 3.14Å; P36-A39 PolarHBondContact O-N 2.97Å; T37-A39 VanDerWaalsContact C-N 3.34Å; T37-A39 PolarHBondContact O-N 3.47Å; A39-V42 PolarHBondContact O-N 3.44Å; A39-V43 VanDerWaalsContact O-CG2 3.3Å; A39-V43 WeakPolarHBondContact O-CG2 3.35Å; A39-V43 PolarHBondContact O-N 3.49Å
40	I	96	Very high	87.4	Confident	103 Å²	103	93.2 Å²	93.2	53%	0.528	52%	0.518	S	S	.	.	H	α-helix	trans	-62.4	-45	176.6	-67.3	164.2	0	0	0	110.7	P36 T37 L38 V42 V43 L44	P36-I40 VanDerWaalsContact O-CG1 3.29Å; P36-I40 WeakPolarHBondContact O-CG1 3.42Å; P36-I40 PolarHBondContact O-N 2.89Å; T37-I40 PolarHBondContact O-N 3.29Å; L38-I40 PolarHBondContact O-N 3.14Å; I40-V42 VanDerWaalsContact C-N 3.35Å; I40-V42 PolarHBondContact O-N 3.25Å; I40-V43 PolarHBondContact O-N 3.47Å; I40-L44 HydrophobicContact CG2-CD1 3.9Å; I40-L44 HydrophobicContact CG2-CG 4.24Å; I40-L44 WeakPolarHBondContact O-CB 3.26Å; I40-L44 VanDerWaalsContact O-CG 3.3Å; I40-L44 WeakPolarHBondContact O-CG 3.3Å; I40-L44 PolarHBondContact O-N 2.86Å
41	V	96.2	Very high	88.7	Confident	67 Å²	67	90.8 Å²	90.8	41%	0.406	51%	0.509	S	S	.	.	H	α-helix	trans	-60.2	-44.8	178.4	171	0	0	0	0	111.1	T37 L38 L44 I45	T37-V41 VanDerWaalsContact O-CG2 3.31Å; T37-V41 WeakPolarHBondContact O-CG2 3.2Å; T37-V41 PolarHBondContact O-N 3.05Å; L38-V41 PolarHBondContact O-N 2.81Å; V41-L44 PolarHBondContact O-N 3.27Å; V41-I45 HydrophobicContact CG1-CD1 3.85Å; V41-I45 VanDerWaalsContact O-CG1 3.26Å; V41-I45 WeakPolarHBondContact O-CG1 3.49Å; V41-I45 PolarHBondContact O-N 2.91Å
42	V	95.8	Very high	89.7	Confident	87 Å²	87	90.4 Å²	90.4	53%	0.527	51%	0.514	S	S	.	.	H	α-helix	trans	-62.3	-45.2	177	172.4	0	0	0	0	111.1	L38 A39 I40 L44 I45 V46	L38-V42 VanDerWaalsContact O-CG2 3.32Å; L38-V42 WeakPolarHBondContact O-CG2 3.3Å; L38-V42 PolarHBondContact O-N 3.26Å; A39-V42 PolarHBondContact O-N 3.44Å; I40-V42 VanDerWaalsContact C-N 3.35Å; I40-V42 PolarHBondContact O-N 3.25Å; V42-L44 VanDerWaalsContact C-N 3.35Å; V42-L44 PolarHBondContact O-N 3.26Å; V42-I45 PolarHBondContact O-N 3.44Å; V42-V46 HydrophobicContact CG1-CG2 4.47Å; V42-V46 WeakPolarHBondContact O-CG2 3.45Å; V42-V46 PolarHBondContact O-N 2.94Å
43	V	96	Very high	90	Very high	92 Å²	92	90.3 Å²	90.3	56%	0.558	51%	0.513	S	S	*	.	H	α-helix	trans	-61.4	-43.8	177	171.5	0	0	0	0	111.1	A39 I40 I45 V46 V47	A39-V43 VanDerWaalsContact O-CG2 3.3Å; A39-V43 WeakPolarHBondContact O-CG2 3.35Å; A39-V43 PolarHBondContact O-N 3.49Å; I40-V43 PolarHBondContact O-N 3.47Å; V43-I45 VanDerWaalsContact C-N 3.33Å; V43-I45 PolarHBondContact O-N 3.38Å; V43-V46 PolarHBondContact O-N 3.32Å; V43-V47 HydrophobicContact CG1-CG2 4.3Å; V43-V47 WeakPolarHBondContact O-CB 3.46Å; V43-V47 VanDerWaalsContact O-CG2 3.29Å; V43-V47 WeakPolarHBondContact O-CG2 2.94Å; V43-V47 PolarHBondContact O-N 2.85Å
44	L	96.2	Very high	89.5	Confident	109 Å²	109	90.8 Å²	90.8	57%	0.571	50%	0.504	S	S	*	.	H	α-helix	trans	-60.9	-41.5	176.5	-74	173.2	0	0	0	111.9	I40 V41 V42 V47 F48	I40-L44 HydrophobicContact CG2-CD1 3.9Å; I40-L44 HydrophobicContact CG2-CG 4.24Å; I40-L44 WeakPolarHBondContact O-CB 3.26Å; I40-L44 VanDerWaalsContact O-CG 3.3Å; I40-L44 WeakPolarHBondContact O-CG 3.3Å; I40-L44 PolarHBondContact O-N 2.86Å; V41-L44 PolarHBondContact O-N 3.27Å; V42-L44 VanDerWaalsContact C-N 3.35Å; V42-L44 PolarHBondContact O-N 3.26Å; L44-V47 PolarHBondContact O-N 2.98Å; L44-F48 WeakPolarHBondContact O-CB 3.29Å; L44-F48 PolarHBondContact O-N 3.48Å
45	I	94.8	Very high	88.4	Confident	94 Å²	94	92.1 Å²	92.1	48%	0.482	52%	0.515	S	S	.	.	H	α-helix	trans	-63.9	-46.7	175.7	-67.5	164.3	0	0	0	110.4	V41 V42 V43 V47 F48 V49	V41-I45 HydrophobicContact CG1-CD1 3.85Å; V41-I45 VanDerWaalsContact O-CG1 3.26Å; V41-I45 WeakPolarHBondContact O-CG1 3.49Å; V41-I45 PolarHBondContact O-N 2.91Å; V42-I45 PolarHBondContact O-N 3.44Å; V43-I45 VanDerWaalsContact C-N 3.33Å; V43-I45 PolarHBondContact O-N 3.38Å; I45-V47 VanDerWaalsContact C-N 3.34Å; I45-V47 PolarHBondContact O-N 2.96Å; I45-F48 PolarHBondContact O-N 2.82Å; I45-V49 HydrophobicContact CG2-CG2 4.16Å; I45-V49 WeakPolarHBondContact O-CB 3.48Å; I45-V49 VanDerWaalsContact O-CG2 3.28Å; I45-V49 WeakPolarHBondContact O-CG2 3.18Å; I45-V49 PolarHBondContact O-N 3.06Å
46	V	94	Very high	87.4	Confident	90 Å²	90	92.1 Å²	92.1	55%	0.545	52%	0.516	S	S	.	.	H	α-helix	trans	-61.2	-44.6	178.8	171.1	0	0	0	0	111	V42 V43 Y50	V42-V46 HydrophobicContact CG1-CG2 4.47Å; V42-V46 WeakPolarHBondContact O-CG2 3.45Å; V42-V46 PolarHBondContact O-N 2.94Å; V43-V46 PolarHBondContact O-N 3.32Å; V46-Y50 WeakPolarHBondContact O-CB 3.32Å; V46-Y50 PolarHBondContact O-N 2.77Å
47	V	93.4	Very high	85.9	Confident	76 Å²	76	95.3 Å²	95.3	46%	0.461	53%	0.534	S	S	.	.	H	α-helix	trans	-62.2	-48.3	175.6	171.6	0	0	0	0	110.1	V43 L44 I45 V49 Y50 V51	V43-V47 HydrophobicContact CG1-CG2 4.3Å; V43-V47 WeakPolarHBondContact O-CB 3.46Å; V43-V47 VanDerWaalsContact O-CG2 3.29Å; V43-V47 WeakPolarHBondContact O-CG2 2.94Å; V43-V47 PolarHBondContact O-N 2.85Å; L44-V47 PolarHBondContact O-N 2.98Å; I45-V47 VanDerWaalsContact C-N 3.34Å; I45-V47 PolarHBondContact O-N 2.96Å; V47-V49 PolarHBondContact O-N 3.15Å; V47-Y50 CarbonylContact O-C 3.54Å; V47-Y50 PolarHBondContact O-N 3.26Å; V47-V51 HydrophobicContact CG1-CG2 4.04Å; V47-V51 WeakPolarHBondContact O-CG2 3.28Å; V47-V51 PolarHBondContact O-N 2.82Å
48	F	92.4	Very high	84.3	Confident	148 Å²	148	97.1 Å²	97.1	65%	0.649	55%	0.545	S	S	*	.	H	α-helix	trans	-59.6	-48.3	179.5	177.8	-94.3	0	0	0	112	L44 I45 V51 A52	L44-F48 WeakPolarHBondContact O-CB 3.29Å; L44-F48 PolarHBondContact O-N 3.48Å; I45-F48 PolarHBondContact O-N 2.82Å; F48-V51 WeakPolarHBondContact O-CB 3.39Å; F48-V51 PolarHBondContact O-N 3.5Å; F48-V51 VanDerWaalsContact O-N 3.15Å; F48-A52 HydrophobicContact CE1-CB 4.46Å; F48-A52 WeakPolarHBondContact O-CB 3.34Å; F48-A52 PolarHBondContact O-N 3.45Å
49	V	91.6	Very high	82.2	Confident	69 Å²	69	104.4 Å²	104.4	42%	0.418	58%	0.576	S	S	.	*	H	α-helix	trans	-60.3	-50.6	175.5	171.4	0	0	0	0	109	I45 V47 V51 A52 T53	I45-V49 HydrophobicContact CG2-CG2 4.16Å; I45-V49 WeakPolarHBondContact O-CB 3.48Å; I45-V49 VanDerWaalsContact O-CG2 3.28Å; I45-V49 WeakPolarHBondContact O-CG2 3.18Å; I45-V49 PolarHBondContact O-N 3.06Å; V47-V49 PolarHBondContact O-N 3.15Å; V49-V51 PolarHBondContact O-N 2.79Å; V49-A52 CarbonylContact O-C 3.58Å; V49-A52 PolarHBondContact O-N 2.72Å; V49-T53 HydrophobicContact CG1-CG2 3.79Å; V49-T53 WeakPolarHBondContact O-CB 3.34Å; V49-T53 WeakPolarHBondContact O-CG2 3.38Å; V49-T53 PolarHBondContact O-N 2.75Å; V49-T53 PolarHBondContact O-OG1 3.2Å
50	Y	89.3	Confident	81.7	Confident	153 Å²	153	107 Å²	107	60%	0.6	58%	0.583	S	S	*	*	H	α-helix	trans	-58.6	-31.9	176.9	-177.8	-108.4	0	0	0	112.6	V46 V47 R54	V46-Y50 WeakPolarHBondContact O-CB 3.32Å; V46-Y50 PolarHBondContact O-N 2.77Å; V47-Y50 CarbonylContact O-C 3.54Å; V47-Y50 PolarHBondContact O-N 3.26Å; Y50-R54 WeakPolarHBondContact O-CB 3.12Å; Y50-R54 WeakPolarHBondContact O-CD 3.09Å; Y50-R54 WeakPolarHBondContact O-CG 2.95Å; Y50-R54 PolarHBondContact O-N 2.78Å
51	V	87.5	Confident	80.9	Confident	59 Å²	59	107.2 Å²	107.2	36%	0.358	59%	0.586	S	S	.	*	H	α-helix	trans	-71.2	-42.6	172.7	-177.8	0	0	0	0	112.8	V47 F48 V49 R54	V47-V51 HydrophobicContact CG1-CG2 4.04Å; V47-V51 WeakPolarHBondContact O-CG2 3.28Å; V47-V51 PolarHBondContact O-N 2.82Å; F48-V51 WeakPolarHBondContact O-CB 3.39Å; F48-V51 PolarHBondContact O-N 3.5Å; F48-V51 VanDerWaalsContact O-N 3.15Å; V49-V51 PolarHBondContact O-N 2.79Å; V51-R54 VanDerWaalsContact CG1-NH2 3.35Å; V51-R54 WeakPolarHBondContact O-CG 3.33Å
52	A	81.9	Confident	80.1	Confident	71 Å²	71	109.4 Å²	109.4	59%	0.587	60%	0.596	S	S	*	*	H	α-helix	trans	-80	-28.5	-176.7	0	0	0	0	0	112.6	F48 V49	F48-A52 HydrophobicContact CE1-CB 4.46Å; F48-A52 WeakPolarHBondContact O-CB 3.34Å; F48-A52 PolarHBondContact O-N 3.45Å; V49-A52 CarbonylContact O-C 3.58Å; V49-A52 PolarHBondContact O-N 2.72Å
53	T	78.3	Confident	79.2	Confident	96 Å²	96	110.8 Å²	110.8	59%	0.589	60%	0.6	S	S	*	*	H	α-helix	trans	-101.6	-16.2	-178.3	64.7	0	0	0	0	113.3	V49 P55	V49-T53 HydrophobicContact CG1-CG2 3.79Å; V49-T53 WeakPolarHBondContact O-CB 3.34Å; V49-T53 WeakPolarHBondContact O-CG2 3.38Å; V49-T53 PolarHBondContact O-N 2.75Å; V49-T53 PolarHBondContact O-OG1 3.2Å; T53-P55 WeakPolarHBondContact O-CD 3.36Å; T53-P55 VanDerWaalsContact O-N 3.15Å
54	R	66	Low	78.1	Confident	102 Å²	102	111.9 Å²	111.9	39%	0.385	60%	0.603	S	S	.	*	S	Bend	trans	-61.5	120.9	160.8	63.2	-161.9	175.8	-137.3	4.5	106.1	Y50 V51 N56	Y50-R54 WeakPolarHBondContact O-CB 3.12Å; Y50-R54 WeakPolarHBondContact O-CD 3.09Å; Y50-R54 WeakPolarHBondContact O-CG 2.95Å; Y50-R54 PolarHBondContact O-N 2.78Å; V51-R54 VanDerWaalsContact CG1-NH2 3.35Å; V51-R54 WeakPolarHBondContact O-CG 3.33Å; R54-N56 PolarHBondContact O-N 2.69Å
55	P	61.9	Low	76.9	Confident	102 Å²	102	112.1 Å²	112.1	66%	0.662	61%	0.605	S	S	*	*			trans	-53.5	126.6	168.9	24.8	-30.7	0	0	0	104.6	T53 T57	T53-P55 WeakPolarHBondContact O-CD 3.36Å; T53-P55 VanDerWaalsContact O-N 3.15Å; P55-T57 PolarHBondContact O-N 3.07Å
56	N	59.5	Low	75.6	Confident	122 Å²	122	113.4 Å²	113.4	65%	0.652	61%	0.614	S	S	*	*			trans	-53.9	98	164.2	-83.1	-35.3	0	0	0	104.8	R54 T58	R54-N56 PolarHBondContact O-N 2.69Å; N56-T58 CarbonylContact O-C 3.37Å; N56-T58 PolarHBondContact O-N 2.97Å
57	T	57.4	Low	74.2	Confident	128 Å²	128	115.2 Å²	115.2	79%	0.785	62%	0.619	S	S	*	*			trans	-72.5	71.3	165.8	-54.7	0	0	0	0	105	P55	P55-T57 PolarHBondContact O-N 3.07Å
58	T	57.8	Low	72.6	Confident	111 Å²	111	118.5 Å²	118.5	68%	0.681	63%	0.632	S	S	*	*			trans	-179.7	65.8	-174.9	0.6	0	0	0	0	99.5	N56	N56-T58 CarbonylContact O-C 3.37Å; N56-T58 PolarHBondContact O-N 2.97Å
59	E	47.8	Very low	70.8	Confident	261 Å²	261	115.8 Å²	115.8	100%	1.22	63%	0.631	S	S	*	*			cis	-141.5	0	44.3	-62.1	-174	99.4	0	0	113.1

Retrieved 59 of 59 residues in 24.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).