A0A093HYY0_STRCA Loading...

Cholecystokinin

AlphaFold DB , UniProt , Accession A0A093HYY0, Species STRCA (Struthio camelus australis), Gene n/a, Length 130 aa.

						>A0A093HYY0_STRCA|A0A093HYY0
MYSGICICVFLAVLSASSFGQQTAGSHNGNPLAAELEQSLTEHHRHVRAPSSAGPLKPVPRLDGSIDQRANIGALLAKYLQQARKGPTGRISVMGNRVQSIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	67.4	Low	86.5	Confident	209 Å²	209	109.5 Å²	109.5	100%	1.03	59%	0.591	S	S	*	*				0	-40.6	0	-65	177.2	77.3	0	0	112.6	S3 G4	M1-S3 VanDerWaalsContact C-N 3.33Å; M1-S3 PolarHBondContact O-N 3.22Å; M1-G4 PolarHBondContact O-N 3.12Å
2	Y	77.9	Confident	86.9	Confident	196 Å²	196	105.3 Å²	105.3	77%	0.769	58%	0.583	S	S	*	*	H	α-helix	trans	-66.2	-25.2	-180	-58.3	-74.4	0	0	0	116	G4 I5 C6	Y2-G4 VanDerWaalsContact C-N 3.32Å; Y2-G4 PolarHBondContact O-N 3.41Å; Y2-I5 HydrophobicContact CD1-CD1 4.3Å; Y2-I5 PolarHBondContact O-N 2.84Å; Y2-C6 WeakPolarHBondContact O-CB 3.21Å; Y2-C6 PolarHBondContact O-N 3.3Å
3	S	78	Confident	87.3	Confident	93 Å²	93	104.5 Å²	104.5	65%	0.65	58%	0.582	S	S	*	*	H	α-helix	trans	-62.9	-35.6	178.3	-172.4	0	0	0	0	113.2	M1 I7	M1-S3 VanDerWaalsContact C-N 3.33Å; M1-S3 PolarHBondContact O-N 3.22Å; S3-I7 WeakPolarHBondContact O-CD1 3.5Å; S3-I7 WeakPolarHBondContact O-CG1 3.39Å; S3-I7 PolarHBondContact O-N 3.45Å
4	G	87.8	Confident	87.4	Confident	38 Å²	38	104.6 Å²	104.6	39%	0.392	58%	0.58	S	S	.	*	H	α-helix	trans	-71.8	-43.4	176.9	0	0	0	0	0	111.5	M1 Y2 C6 I7 C8	M1-G4 PolarHBondContact O-N 3.12Å; Y2-G4 VanDerWaalsContact C-N 3.32Å; Y2-G4 PolarHBondContact O-N 3.41Å; G4-C6 VanDerWaalsContact C-N 3.27Å; G4-C6 PolarHBondContact O-N 2.71Å; G4-I7 PolarHBondContact O-N 2.77Å; G4-C8 PolarHBondContact O-N 2.94Å; G4-C8 PolarHBondContact O-SG 3.39Å
5	I	91.1	Very high	87.1	Confident	98 Å²	98	102.3 Å²	102.3	50%	0.503	57%	0.574	S	S	.	*	H	α-helix	trans	-59	-42.2	176.8	-57.4	170.8	0	0	0	110.5	Y2 I7 C8 V9	Y2-I5 HydrophobicContact CD1-CD1 4.3Å; Y2-I5 PolarHBondContact O-N 2.84Å; I5-I7 PolarHBondContact O-N 3.36Å; I5-C8 PolarHBondContact O-N 3.33Å; I5-V9 HydrophobicContact CG2-CG2 4.39Å; I5-V9 VanDerWaalsContact O-CG2 3.31Å; I5-V9 WeakPolarHBondContact O-CG2 3.35Å; I5-V9 PolarHBondContact O-N 3.21Å
6	C	87.6	Confident	86.8	Confident	63 Å²	63	100.1 Å²	100.1	43%	0.426	57%	0.573	S	S	.	*	H	α-helix	trans	-58	-49.2	176.2	-172	0	0	0	0	112	Y2 G4 C8 V9 F10	Y2-C6 WeakPolarHBondContact O-CB 3.21Å; Y2-C6 PolarHBondContact O-N 3.3Å; G4-C6 VanDerWaalsContact C-N 3.27Å; G4-C6 PolarHBondContact O-N 2.71Å; C6-C8 VanDerWaalsContact C-N 3.35Å; C6-C8 PolarHBondContact O-N 3.19Å; C6-V9 PolarHBondContact O-N 3.07Å; C6-F10 WeakPolarHBondContact O-CD2 3.31Å; C6-F10 PolarHBondContact O-N 3.21Å; C6-F10 WeakPolarHBondContact SG-CE2 3.42Å
7	I	92.8	Very high	86.1	Confident	94 Å²	94	98.3 Å²	98.3	48%	0.482	57%	0.568	S	S	.	*	H	α-helix	trans	-63	-42.2	178.2	-63.6	163.6	0	0	0	110.7	S3 G4 I5 F10 L11	S3-I7 WeakPolarHBondContact O-CD1 3.5Å; S3-I7 WeakPolarHBondContact O-CG1 3.39Å; S3-I7 PolarHBondContact O-N 3.45Å; G4-I7 PolarHBondContact O-N 2.77Å; I5-I7 PolarHBondContact O-N 3.36Å; I7-F10 PolarHBondContact O-N 3.26Å; I7-L11 HydrophobicContact CG2-CD1 3.85Å; I7-L11 HydrophobicContact CG2-CG 4.3Å; I7-L11 WeakPolarHBondContact O-CB 3.35Å; I7-L11 VanDerWaalsContact O-CG 3.3Å; I7-L11 WeakPolarHBondContact O-CG 3.44Å; I7-L11 PolarHBondContact O-N 3.46Å
8	C	89.8	Confident	85.3	Confident	84 Å²	84	96.5 Å²	96.5	57%	0.568	56%	0.562	S	S	*	*	H	α-helix	trans	-61.3	-44.2	177.1	-67.9	0	0	0	0	112.4	G4 I5 C6 L11 A12	G4-C8 PolarHBondContact O-N 2.94Å; G4-C8 PolarHBondContact O-SG 3.39Å; I5-C8 PolarHBondContact O-N 3.33Å; C6-C8 VanDerWaalsContact C-N 3.35Å; C6-C8 PolarHBondContact O-N 3.19Å; C8-L11 PolarHBondContact O-N 3.41Å; C8-A12 WeakPolarHBondContact O-CB 3.33Å; C8-A12 PolarHBondContact O-N 2.85Å
9	V	93.8	Very high	84.1	Confident	88 Å²	88	99.8 Å²	99.8	53%	0.533	57%	0.569	S	S	.	*	H	α-helix	trans	-65.3	-43.3	176.9	173.4	0	0	0	0	110.9	I5 C6 A12 V13	I5-V9 HydrophobicContact CG2-CG2 4.39Å; I5-V9 VanDerWaalsContact O-CG2 3.31Å; I5-V9 WeakPolarHBondContact O-CG2 3.35Å; I5-V9 PolarHBondContact O-N 3.21Å; C6-V9 PolarHBondContact O-N 3.07Å; V9-A12 PolarHBondContact O-N 2.88Å; V9-V13 WeakPolarHBondContact O-CG2 3.48Å; V9-V13 PolarHBondContact O-N 2.87Å
10	F	92.2	Very high	82.8	Confident	134 Å²	134	97.1 Å²	97.1	59%	0.588	56%	0.564	S	S	*	*	H	α-helix	trans	-59.4	-48.2	175.7	-88	-64	0	0	0	112.2	C6 I7 A12 V13 L14	C6-F10 WeakPolarHBondContact O-CD2 3.31Å; C6-F10 PolarHBondContact O-N 3.21Å; C6-F10 WeakPolarHBondContact SG-CE2 3.42Å; I7-F10 PolarHBondContact O-N 3.26Å; F10-A12 VanDerWaalsContact C-N 3.33Å; F10-A12 PolarHBondContact O-N 2.97Å; F10-V13 PolarHBondContact O-N 3.49Å; F10-L14 WeakPolarHBondContact O-CB 3.46Å; F10-L14 WeakPolarHBondContact O-CD1 3.45Å; F10-L14 PolarHBondContact O-N 2.88Å
11	L	92.9	Very high	81.3	Confident	107 Å²	107	100.5 Å²	100.5	56%	0.56	58%	0.575	S	S	*	*	H	α-helix	trans	-62.5	-39.6	178.7	-72	171.9	0	0	0	112	I7 C8 L14 S15	I7-L11 HydrophobicContact CG2-CD1 3.85Å; I7-L11 HydrophobicContact CG2-CG 4.3Å; I7-L11 WeakPolarHBondContact O-CB 3.35Å; I7-L11 VanDerWaalsContact O-CG 3.3Å; I7-L11 WeakPolarHBondContact O-CG 3.44Å; I7-L11 PolarHBondContact O-N 3.46Å; C8-L11 PolarHBondContact O-N 3.41Å; L11-L14 PolarHBondContact O-N 3.47Å; L11-S15 WeakPolarHBondContact O-CB 3.31Å; L11-S15 PolarHBondContact O-N 2.78Å
12	A	91.9	Very high	80.6	Confident	60 Å²	60	98 Å²	98	50%	0.496	56%	0.56	S	S	.	*	H	α-helix	trans	-62.8	-45.4	176.9	0	0	0	0	0	112	C8 V9 F10 S15 A16	C8-A12 WeakPolarHBondContact O-CB 3.33Å; C8-A12 PolarHBondContact O-N 2.85Å; V9-A12 PolarHBondContact O-N 2.88Å; F10-A12 VanDerWaalsContact C-N 3.33Å; F10-A12 PolarHBondContact O-N 2.97Å; A12-S15 PolarHBondContact O-N 3.21Å; A12-A16 WeakPolarHBondContact O-CB 3.27Å; A12-A16 PolarHBondContact O-N 3.33Å
13	V	92	Very high	79.1	Confident	94 Å²	94	93.8 Å²	93.8	57%	0.57	56%	0.556	S	S	*	*	H	α-helix	trans	-64.6	-44.5	177.1	171.7	0	0	0	0	111.2	V9 F10 S15 A16 S17	V9-V13 WeakPolarHBondContact O-CG2 3.48Å; V9-V13 PolarHBondContact O-N 2.87Å; F10-V13 PolarHBondContact O-N 3.49Å; V13-S15 PolarHBondContact O-N 3.49Å; V13-A16 PolarHBondContact O-N 3.46Å; V13-S17 WeakPolarHBondContact O-CB 3.46Å; V13-S17 PolarHBondContact O-N 2.91Å; V13-S17 PolarHBondContact O-OG 3.44Å
14	L	88.2	Confident	77.5	Confident	107 Å²	107	94.2 Å²	94.2	56%	0.56	57%	0.565	S	S	*	*	H	α-helix	trans	-58	-47.5	176	-88.8	149.7	0	0	0	111.6	F10 L11 S17 S18	F10-L14 WeakPolarHBondContact O-CB 3.46Å; F10-L14 WeakPolarHBondContact O-CD1 3.45Å; F10-L14 PolarHBondContact O-N 2.88Å; L11-L14 PolarHBondContact O-N 3.47Å; L14-S17 WeakPolarHBondContact CA-OG 3.4Å; L14-S17 PolarHBondContact O-N 3.49Å; L14-S17 PolarHBondContact O-OG 3.5Å; L14-S18 PolarHBondContact O-N 3.33Å; L14-S18 VanDerWaalsContact O-N 3.1Å
15	S	83.8	Confident	75.6	Confident	69 Å²	69	95.9 Å²	95.9	48%	0.483	58%	0.582	S	S	.	*	H	α-helix	trans	-66.7	-35.7	179	-169.6	0	0	0	0	113.2	L11 A12 V13 S18	L11-S15 WeakPolarHBondContact O-CB 3.31Å; L11-S15 PolarHBondContact O-N 2.78Å; A12-S15 PolarHBondContact O-N 3.21Å; V13-S15 PolarHBondContact O-N 3.49Å; S15-S18 PolarHBondContact O-OG 3.4Å
16	A	81.9	Confident	73.1	Confident	68 Å²	68	95.8 Å²	95.8	56%	0.562	59%	0.59	S	S	*	*	H	α-helix	trans	-72	-36	175.7	0	0	0	0	0	111.6	A12 V13 F19 G20	A12-A16 WeakPolarHBondContact O-CB 3.27Å; A12-A16 PolarHBondContact O-N 3.33Å; V13-A16 PolarHBondContact O-N 3.46Å; A16-F19 PolarHBondContact O-N 3.48Å; A16-G20 PolarHBondContact O-N 2.91Å
17	S	75.1	Confident	71.2	Confident	69 Å²	69	101 Å²	101	48%	0.483	61%	0.608	S	S	.	*	H	α-helix	trans	-71.3	-30.3	180	69.7	0	0	0	0	113.8	V13 L14 F19 G20	V13-S17 WeakPolarHBondContact O-CB 3.46Å; V13-S17 PolarHBondContact O-N 2.91Å; V13-S17 PolarHBondContact O-OG 3.44Å; L14-S17 WeakPolarHBondContact CA-OG 3.4Å; L14-S17 PolarHBondContact O-N 3.49Å; L14-S17 PolarHBondContact O-OG 3.5Å; S17-F19 VanDerWaalsContact C-N 3.32Å; S17-F19 PolarHBondContact O-N 3.28Å; S17-G20 PolarHBondContact O-N 3.31Å
18	S	71.4	Confident	68.6	Low	66 Å²	66	102.8 Å²	102.8	46%	0.462	62%	0.618	S	S	.	*	H	α-helix	trans	-68.9	-30.3	176	61.4	0	0	0	0	112.7	L14 S15	L14-S18 PolarHBondContact O-N 3.33Å; L14-S18 VanDerWaalsContact O-N 3.1Å; S15-S18 PolarHBondContact O-OG 3.4Å
19	F	62.1	Low	66.5	Low	159 Å²	159	101.7 Å²	101.7	70%	0.697	62%	0.621	S	S	*	*	H	α-helix	trans	-70.3	-31.8	173.2	-94.9	-94.9	0	0	0	112.7	A16 S17 Q21 Q22	A16-F19 PolarHBondContact O-N 3.48Å; S17-F19 VanDerWaalsContact C-N 3.32Å; S17-F19 PolarHBondContact O-N 3.28Å; F19-Q21 VanDerWaalsContact C-N 3.3Å; F19-Q21 PolarHBondContact O-N 3.01Å; F19-Q22 PolarHBondContact O-N 3.2Å
20	G	58.2	Low	64.1	Low	46 Å²	46	104.6 Å²	104.6	47%	0.474	63%	0.634	S	S	.	*	H	α-helix	trans	-72.2	-16.6	178.9	0	0	0	0	0	115	A16 S17 T23	A16-G20 PolarHBondContact O-N 2.91Å; S17-G20 PolarHBondContact O-N 3.31Å; G20-T23 PolarHBondContact O-OG1 3.23Å
21	Q	51.3	Low	61.8	Low	169 Å²	169	102.8 Å²	102.8	79%	0.79	64%	0.636	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.9	-14.6	173.9	-74.1	-155.7	-87.6	0	0	113.6	F19 T23	F19-Q21 VanDerWaalsContact C-N 3.3Å; F19-Q21 PolarHBondContact O-N 3.01Å; Q21-T23 VanDerWaalsContact C-N 3.3Å
22	Q	52.9	Low	59.6	Low	155 Å²	155	103.1 Å²	103.1	72%	0.724	64%	0.637	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.5	-13	178.7	-64.8	-84.8	41.8	0	0	112.8	F19	F19-Q22 PolarHBondContact O-N 3.2Å
23	T	46.5	Very low	57.5	Low	109 Å²	109	103.9 Å²	103.9	67%	0.669	64%	0.644	S	S	*	*	T	Hydrogen-bonded Turn	trans	-104.1	2.2	-170.4	52.2	0	0	0	0	115.4	G20 Q21 G25	G20-T23 PolarHBondContact O-OG1 3.23Å; Q21-T23 VanDerWaalsContact C-N 3.3Å; T23-G25 PolarHBondContact O-N 3.29Å
24	A	44.5	Very low	55.3	Low	102 Å²	102	102.8 Å²	102.8	84%	0.843	65%	0.645	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.4	24	175.5	0	0	0	0	0	113.8
25	G	47.1	Very low	53.3	Low	73 Å²	73	103.4 Å²	103.4	75%	0.753	64%	0.644	S	S	*	*	T	Hydrogen-bonded Turn	trans	-167.7	21.3	-176.4	0	0	0	0	0	117.4	T23	T23-G25 PolarHBondContact O-N 3.29Å
26	S	40.3	Very low	51.9	Low	96 Å²	96	105.9 Å²	105.9	67%	0.671	65%	0.652	S	S	*	*			trans	-131.4	83	174.7	-165.9	0	0	0	0	110.6
27	H	45.8	Very low	50.5	Low	172 Å²	172	108.8 Å²	108.8	80%	0.796	65%	0.654	S	S	*	*			trans	-69.8	126.4	155.7	175.3	-90.4	0	0	0	107.6
28	N	39.6	Very low	49.3	Very low	131 Å²	131	112 Å²	112	70%	0.701	66%	0.661	S	S	*	*	S	Bend	trans	84.2	116.8	166.5	-111.1	-20	0	0	0	119
29	G	44.7	Very low	48.1	Very low	61 Å²	61	111.3 Å²	111.3	63%	0.629	66%	0.656	S	S	*	*			trans	85	106.6	138.1	0	0	0	0	0	117.8
30	N	44.4	Very low	47.5	Very low	150 Å²	150	109.7 Å²	109.7	80%	0.802	65%	0.654	S	S	*	*			trans	-51.1	124.7	157.8	-175.1	21.2	0	0	0	111.1
31	P	42.8	Very low	47	Very low	96 Å²	96	112.4 Å²	112.4	62%	0.623	66%	0.662	S	S	*	*				-146.7	19.1	99.2	37.1	-18.7	0	0	0	114.9
32	L	47	Very low	46.4	Very low	113 Å²	113	110.9 Å²	110.9	59%	0.592	66%	0.655	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.1	-5.3	-168.8	-68.4	178.9	0	0	0	116	A34 E35 L36	L32-A34 VanDerWaalsContact C-N 3.25Å; L32-A34 PolarHBondContact O-N 3.47Å; L32-E35 WeakPolarHBondContact CD2-OE2 3.33Å; L32-E35 PolarHBondContact O-N 2.84Å; L32-L36 PolarHBondContact O-N 2.87Å
33	A	47.2	Very low	46	Very low	77 Å²	77	110.8 Å²	110.8	64%	0.636	65%	0.654	S	S	*	*	H	α-helix	trans	-69.8	-25.2	176.2	0	0	0	0	0	112.3
34	A	46.5	Very low	45.7	Very low	71 Å²	71	113.6 Å²	113.6	59%	0.587	66%	0.659	S	S	*	*	H	α-helix	trans	-80.7	-28	177	0	0	0	0	0	113.1	L32	L32-A34 VanDerWaalsContact C-N 3.25Å; L32-A34 PolarHBondContact O-N 3.47Å
35	E	46.4	Very low	45.8	Very low	119 Å²	119	118.9 Å²	118.9	56%	0.556	66%	0.657	S	S	*	*	H	α-helix	trans	-77.9	-32	-179	-165.7	-178.6	168	0	0	112.1	L32 E37 Q38 S39	L32-E35 WeakPolarHBondContact CD2-OE2 3.33Å; L32-E35 PolarHBondContact O-N 2.84Å; E35-E37 PolarHBondContact O-N 2.89Å; E35-Q38 PolarHBondContact O-N 3.47Å; E35-S39 WeakPolarHBondContact O-CB 3.42Å; E35-S39 PolarHBondContact O-N 2.93Å
36	L	54.6	Low	45.3	Very low	121 Å²	121	123.3 Å²	123.3	63%	0.634	66%	0.658	S	S	*	*	H	α-helix	trans	-66.4	-37.6	179.1	-166.6	78.3	0	0	0	112.6	L32 S39 L40	L32-L36 PolarHBondContact O-N 2.87Å; L36-S39 PolarHBondContact O-N 2.84Å; L36-L40 PolarHBondContact O-N 3.39Å
37	E	53.1	Low	45.5	Very low	130 Å²	130	124.8 Å²	124.8	61%	0.607	66%	0.663	S	S	*	*	H	α-helix	trans	-68.2	-38.1	175	-71	-70.1	106.1	0	0	111.3	E35 L40 T41	E35-E37 PolarHBondContact O-N 2.89Å; E37-L40 PolarHBondContact O-N 3.25Å; E37-T41 PolarHBondContact O-N 3.33Å
38	Q	47.9	Very low	45.2	Very low	136 Å²	136	127.9 Å²	127.9	64%	0.636	67%	0.667	S	S	*	*	H	α-helix	trans	-65.1	-43.7	173.8	-79.9	179.1	-23.2	0	0	111.6	E35 L40 T41 E42	E35-Q38 PolarHBondContact O-N 3.47Å; Q38-L40 VanDerWaalsContact C-N 3.33Å; Q38-L40 PolarHBondContact O-N 3.33Å; Q38-T41 PolarHBondContact O-N 3.39Å; Q38-T41 PolarHBondContact O-OG1 3.31Å; Q38-E42 PolarHBondContact O-N 3.46Å; Q38-E42 VanDerWaalsContact O-N 3.08Å
39	S	46.7	Very low	45	Very low	52 Å²	52	126 Å²	126	36%	0.364	67%	0.67	S	S	.	*	H	α-helix	trans	-58.5	-40.5	175.6	169.7	0	0	0	0	112.9	E35 L36 T41 E42 H43	E35-S39 WeakPolarHBondContact O-CB 3.42Å; E35-S39 PolarHBondContact O-N 2.93Å; L36-S39 PolarHBondContact O-N 2.84Å; S39-T41 PolarHBondContact O-N 2.95Å; S39-E42 PolarHBondContact O-N 2.95Å; S39-H43 PolarHBondContact O-N 3.29Å
40	L	51.1	Low	45.3	Very low	124 Å²	124	129.4 Å²	129.4	65%	0.649	68%	0.681	S	S	*	*	H	α-helix	trans	-67.1	-35.4	178.5	-169.4	143.5	0	0	0	112.2	L36 E37 Q38	L36-L40 PolarHBondContact O-N 3.39Å; E37-L40 PolarHBondContact O-N 3.25Å; Q38-L40 VanDerWaalsContact C-N 3.33Å; Q38-L40 PolarHBondContact O-N 3.33Å
41	T	46.4	Very low	45.1	Very low	103 Å²	103	128.2 Å²	128.2	63%	0.632	69%	0.685	S	S	*	*	H	α-helix	trans	-73	-28.4	174.5	60.5	0	0	0	0	113.5	E37 Q38 S39	E37-T41 PolarHBondContact O-N 3.33Å; Q38-T41 PolarHBondContact O-N 3.39Å; Q38-T41 PolarHBondContact O-OG1 3.31Å; S39-T41 PolarHBondContact O-N 2.95Å
42	E	40	Very low	45.4	Very low	138 Å²	138	129.4 Å²	129.4	65%	0.645	70%	0.695	S	S	*	*	H	α-helix	trans	-83.1	-32.8	-178.6	-159.2	172.4	-162.8	0	0	112.6	Q38 S39 H44 R45	Q38-E42 PolarHBondContact O-N 3.46Å; Q38-E42 VanDerWaalsContact O-N 3.08Å; S39-E42 PolarHBondContact O-N 2.95Å; E42-H44 PolarHBondContact O-N 3.19Å; E42-R45 PolarHBondContact O-N 3.5Å
43	H	43.3	Very low	44.9	Very low	153 Å²	153	128.6 Å²	128.6	71%	0.708	71%	0.705	S	S	*	*	G	3₁₀ helix	trans	-68	-14.4	177.1	-94.3	47.5	0	0	0	114.9	S39 R45	S39-H43 PolarHBondContact O-N 3.29Å; H43-R45 PolarHBondContact O-N 3.32Å
44	H	40.8	Very low	44.6	Very low	168 Å²	168	128.1 Å²	128.1	78%	0.778	71%	0.708	S	S	*	*	G	3₁₀ helix	trans	-74.5	-6.2	178.2	-171.7	-106.8	0	0	0	113.6	E42	E42-H44 PolarHBondContact O-N 3.19Å
45	R	46.5	Very low	44.7	Very low	213 Å²	213	131.1 Å²	131.1	80%	0.804	72%	0.721	S	S	*	*	G	3₁₀ helix	trans	-112	0.8	-178.1	-72.1	-164	-173.8	177.5	4.4	117.1	E42 H43 V47	E42-R45 PolarHBondContact O-N 3.5Å; H43-R45 PolarHBondContact O-N 3.32Å; R45-V47 PolarHBondContact O-N 3.33Å
46	H	37.3	Very low	44.6	Very low	165 Å²	165	133.8 Å²	133.8	76%	0.764	74%	0.738	S	S	*	*			trans	-100.7	76.6	179.3	-78.4	-78.7	0	0	0	112.9
47	V	42.9	Very low	44.1	Very low	128 Å²	128	137.3 Å²	137.3	78%	0.776	75%	0.748	S	S	*	*			trans	-59.8	127.1	153.9	167.6	0	0	0	0	108.9	R45	R45-V47 PolarHBondContact O-N 3.33Å
48	R	40.2	Very low	43.9	Very low	236 Å²	236	137 Å²	137	89%	0.891	76%	0.758	S	S	*	*			trans	85.3	106.7	154.1	-157.9	174.4	-155.2	114.1	-0.2	119.3
49	A	34.9	Very low	43.8	Very low	93 Å²	93	136.3 Å²	136.3	77%	0.769	76%	0.762	S	S	*	*				-179.4	146.1	127.5	0	0	0	0	0	112
50	P	50.8	Low	43.9	Very low	132 Å²	132	139.9 Å²	139.9	86%	0.857	78%	0.784	S	S	*	*			trans	-86.3	127.1	172.6	33.8	-27.2	0	0	0	109.6
51	S	41.8	Very low	43.6	Very low	125 Å²	125	143.6 Å²	143.6	87%	0.874	79%	0.79	S	S	*	*			trans	-115	114	173.5	-166.5	0	0	0	0	110.8
52	S	47.8	Very low	43.7	Very low	121 Å²	121	145.7 Å²	145.7	85%	0.846	80%	0.796	S	S	*	*			trans	-85.9	125.4	172	143	0	0	0	0	109.2
53	A	37.6	Very low	44.2	Very low	96 Å²	96	144.9 Å²	144.9	79%	0.793	80%	0.796	S	S	*	*			trans	-169.4	110.3	154.5	0	0	0	0	0	113.2
54	G	40.7	Very low	44.8	Very low	67 Å²	67	140.3 Å²	140.3	69%	0.691	79%	0.79	S	S	*	*			trans	62.9	135.9	130.4	0	0	0	0	0	122.3
55	P	47.6	Very low	45.3	Very low	133 Å²	133	135.2 Å²	135.2	86%	0.864	77%	0.774	S	S	*	*	P	Polyproline II helix	trans	-81.9	124.2	-176.6	33.6	-31.9	0	0	0	112.4
56	L	45.1	Very low	45.8	Very low	175 Å²	175	128.5 Å²	128.5	92%	0.916	75%	0.753	S	S	*	*	P	Polyproline II helix	trans	-102.9	128.4	171.8	-64.3	177.5	0	0	0	111.1
57	K	44.7	Very low	46.8	Very low	196 Å²	196	125.1 Å²	125.1	85%	0.852	74%	0.74	S	S	*	*	P	Polyproline II helix	trans	-54.3	153.2	-174.6	-83.4	170.1	169.1	170.7	0	114.7
58	P	47.2	Very low	47.7	Very low	124 Å²	124	125.3 Å²	125.3	81%	0.805	73%	0.733	S	S	*	*	P	Polyproline II helix	trans	-79.5	128.3	178.6	31.3	-32.2	0	0	0	112.8
59	V	46.2	Very low	48.6	Very low	120 Å²	120	123.5 Å²	123.5	73%	0.727	73%	0.726	S	S	*	*	P	Polyproline II helix	trans	-83	139.9	168.8	174	0	0	0	0	108.7	R61	V59-R61 PolarHBondContact O-N 2.95Å
60	P	48.4	Very low	50	Low	128 Å²	128	121.7 Å²	121.7	83%	0.831	71%	0.711	S	S	*	*	P	Polyproline II helix	trans	-68	127.1	-172.4	16.6	-13.8	0	0	0	110.8
61	R	45.1	Very low	51.1	Low	202 Å²	202	120.9 Å²	120.9	76%	0.762	70%	0.7	S	S	*	*	P	Polyproline II helix	trans	-86.5	143.9	-171.2	-69.7	-165.2	174.3	125.9	2.3	111.5	V59 D63 I66	V59-R61 PolarHBondContact O-N 2.95Å; R61-D63 PolarHBondContact O-N 3.36Å; R61-D63 VanDerWaalsContact O-N 3.12Å; R61-I66 HydrophobicContact CB-CD1 3.52Å; R61-I66 HydrophobicContact CB-CG1 4.12Å; R61-I66 HydrophobicContact CG-CD1 4.44Å
62	L	48.4	Very low	52.9	Low	147 Å²	147	119.4 Å²	119.4	77%	0.77	68%	0.681	S	S	*	*			trans	-53.2	108.1	164.4	-176.5	68.5	0	0	0	110	G64 S65	L62-G64 VanDerWaalsContact C-N 3.28Å; L62-G64 PolarHBondContact O-N 3.45Å; L62-S65 PolarHBondContact O-N 2.95Å
63	D	50.8	Low	54.7	Low	121 Å²	121	115.4 Å²	115.4	65%	0.647	66%	0.659	S	S	*	*	H	α-helix	trans	-55.2	-34.7	-169.4	-158.4	20.4	0	0	0	113.6	R61 S65 I66	R61-D63 PolarHBondContact O-N 3.36Å; R61-D63 VanDerWaalsContact O-N 3.12Å; D63-S65 VanDerWaalsContact C-N 3.35Å; D63-S65 PolarHBondContact O-N 2.92Å; D63-I66 PolarHBondContact O-N 3.47Å
64	G	55.2	Low	56.9	Low	56 Å²	56	113.1 Å²	113.1	58%	0.577	64%	0.64	S	S	*	*	H	α-helix	trans	-70.2	-21.7	-179.3	0	0	0	0	0	115.9	L62	L62-G64 VanDerWaalsContact C-N 3.28Å; L62-G64 PolarHBondContact O-N 3.45Å
65	S	52.3	Low	59	Low	62 Å²	62	115.8 Å²	115.8	43%	0.434	64%	0.638	S	S	.	*	H	α-helix	trans	-84.4	-28.3	179.4	-175.8	0	0	0	0	112.3	L62 D63 R69	L62-S65 PolarHBondContact O-N 2.95Å; D63-S65 VanDerWaalsContact C-N 3.35Å; D63-S65 PolarHBondContact O-N 2.92Å; S65-R69 WeakPolarHBondContact O-CB 3.17Å; S65-R69 PolarHBondContact O-N 3.34Å
66	I	57.8	Low	60.8	Low	72 Å²	72	114.2 Å²	114.2	37%	0.369	62%	0.622	S	S	.	*	H	α-helix	trans	-68.4	-44.3	-179.9	-64.6	162.5	0	0	0	109.7	R61 D63 R69 A70	R61-I66 HydrophobicContact CB-CD1 3.52Å; R61-I66 HydrophobicContact CB-CG1 4.12Å; R61-I66 HydrophobicContact CG-CD1 4.44Å; D63-I66 PolarHBondContact O-N 3.47Å; I66-R69 PolarHBondContact O-N 2.98Å; I66-A70 WeakPolarHBondContact O-CB 3.27Å; I66-A70 PolarHBondContact O-N 3.04Å
67	D	58.2	Low	62.7	Low	93 Å²	93	107.9 Å²	107.9	50%	0.497	59%	0.594	S	S	.	*	H	α-helix	trans	-64.6	-43.9	177	-72.1	-30.1	0	0	0	111.5	R69 A70 N71	D67-R69 PolarHBondContact O-N 3.34Å; D67-A70 PolarHBondContact O-N 3.35Å; D67-N71 WeakPolarHBondContact O-CB 3.29Å; D67-N71 PolarHBondContact O-N 2.99Å; D67-N71 PolarHBondContact O-ND2 3.44Å
68	Q	60.7	Low	64.4	Low	133 Å²	133	105.1 Å²	105.1	62%	0.621	58%	0.583	S	S	*	*	H	α-helix	trans	-63.7	-41.5	176.9	-165.8	171.1	33.8	0	0	112.1	N71 I72	Q68-N71 PolarHBondContact O-N 3.43Å; Q68-I72 HydrophobicContact CG-CD1 4.41Å; Q68-I72 WeakPolarHBondContact O-CD1 3.43Å; Q68-I72 VanDerWaalsContact O-CG1 3.31Å; Q68-I72 WeakPolarHBondContact O-CG1 3.24Å; Q68-I72 PolarHBondContact O-N 2.92Å; Q68-I72 VanDerWaalsContact O-N 3.07Å
69	R	58.5	Low	65.9	Low	197 Å²	197	107 Å²	107	74%	0.743	57%	0.574	S	S	*	*	H	α-helix	trans	-63.3	-40.3	172.3	-102.4	-179.5	166.5	-122.2	0.5	112.4	S65 I66 D67 N71 I72 G73	S65-R69 WeakPolarHBondContact O-CB 3.17Å; S65-R69 PolarHBondContact O-N 3.34Å; I66-R69 PolarHBondContact O-N 2.98Å; D67-R69 PolarHBondContact O-N 3.34Å; R69-N71 VanDerWaalsContact C-N 3.34Å; R69-I72 PolarHBondContact O-N 2.94Å; R69-G73 PolarHBondContact O-N 3.33Å
70	A	66.2	Low	67.6	Low	56 Å²	56	106.1 Å²	106.1	46%	0.463	57%	0.566	S	S	.	*	H	α-helix	trans	-67.1	-36.8	178.2	0	0	0	0	0	111.4	I66 D67 G73 A74	I66-A70 WeakPolarHBondContact O-CB 3.27Å; I66-A70 PolarHBondContact O-N 3.04Å; D67-A70 PolarHBondContact O-N 3.35Å; A70-G73 PolarHBondContact O-N 3.12Å; A70-A74 VanDerWaalsContact O-CB 3.27Å; A70-A74 WeakPolarHBondContact O-CB 3.2Å; A70-A74 PolarHBondContact O-N 3.26Å
71	N	72.1	Confident	69.1	Low	114 Å²	114	105.6 Å²	105.6	61%	0.61	55%	0.552	S	S	*	*	H	α-helix	trans	-66.4	-43.6	174.9	-80.7	-69.1	0	0	0	112.3	D67 Q68 R69 A74 L75	D67-N71 WeakPolarHBondContact O-CB 3.29Å; D67-N71 PolarHBondContact O-N 2.99Å; D67-N71 PolarHBondContact O-ND2 3.44Å; Q68-N71 PolarHBondContact O-N 3.43Å; R69-N71 VanDerWaalsContact C-N 3.34Å; N71-A74 PolarHBondContact O-N 2.92Å; N71-L75 WeakPolarHBondContact O-CB 3.42Å; N71-L75 PolarHBondContact O-N 3.44Å
72	I	81.3	Confident	70.3	Confident	95 Å²	95	102.8 Å²	102.8	49%	0.487	55%	0.547	S	S	.	.	H	α-helix	trans	-65.9	-43.1	175	-61.8	161.1	0	0	0	110.3	Q68 R69 A74 L75 L76	Q68-I72 HydrophobicContact CG-CD1 4.41Å; Q68-I72 WeakPolarHBondContact O-CD1 3.43Å; Q68-I72 VanDerWaalsContact O-CG1 3.31Å; Q68-I72 WeakPolarHBondContact O-CG1 3.24Å; Q68-I72 PolarHBondContact O-N 2.92Å; Q68-I72 VanDerWaalsContact O-N 3.07Å; R69-I72 PolarHBondContact O-N 2.94Å; I72-A74 VanDerWaalsContact C-N 3.34Å; I72-A74 PolarHBondContact O-N 3.1Å; I72-L75 PolarHBondContact O-N 3.45Å; I72-L76 HydrophobicContact CG2-CD1 3.91Å; I72-L76 HydrophobicContact CG2-CG 4.37Å; I72-L76 WeakPolarHBondContact O-CB 3.3Å; I72-L76 WeakPolarHBondContact O-CG 3.38Å; I72-L76 PolarHBondContact O-N 3.33Å
73	G	84.3	Confident	71	Confident	37 Å²	37	99 Å²	99	38%	0.381	54%	0.537	S	S	.	.	H	α-helix	trans	-60.1	-41.8	175.5	0	0	0	0	0	112.7	R69 A70 L76 A77	R69-G73 PolarHBondContact O-N 3.33Å; A70-G73 PolarHBondContact O-N 3.12Å; G73-L76 PolarHBondContact O-N 3.44Å; G73-A77 VanDerWaalsContact O-CB 3.29Å; G73-A77 WeakPolarHBondContact O-CB 3.45Å; G73-A77 PolarHBondContact O-N 3.46Å
74	A	83.9	Confident	71.5	Confident	48 Å²	48	104.1 Å²	104.1	40%	0.397	55%	0.547	S	S	.	.	H	α-helix	trans	-66.9	-38.3	176.1	0	0	0	0	0	112.3	A70 N71 I72 A77 K78	A70-A74 VanDerWaalsContact O-CB 3.27Å; A70-A74 WeakPolarHBondContact O-CB 3.2Å; A70-A74 PolarHBondContact O-N 3.26Å; N71-A74 PolarHBondContact O-N 2.92Å; I72-A74 VanDerWaalsContact C-N 3.34Å; I72-A74 PolarHBondContact O-N 3.1Å; A74-A77 PolarHBondContact O-N 3.43Å; A74-K78 WeakPolarHBondContact O-CB 3.39Å; A74-K78 WeakPolarHBondContact O-CG 3.38Å; A74-K78 PolarHBondContact O-N 3.47Å
75	L	85.9	Confident	71.7	Confident	123 Å²	123	110.1 Å²	110.1	64%	0.644	56%	0.558	S	S	*	*	H	α-helix	trans	-68.2	-43	176.2	-171.3	65.1	0	0	0	111.8	N71 I72 K78 Y79	N71-L75 WeakPolarHBondContact O-CB 3.42Å; N71-L75 PolarHBondContact O-N 3.44Å; I72-L75 PolarHBondContact O-N 3.45Å; L75-K78 PolarHBondContact O-N 3.06Å; L75-Y79 WeakPolarHBondContact O-CB 3.41Å; L75-Y79 PolarHBondContact O-N 3.47Å
76	L	83.9	Confident	71.8	Confident	100 Å²	100	109.7 Å²	109.7	52%	0.524	56%	0.563	S	S	.	*	H	α-helix	trans	-61.5	-44.5	173.5	-75.3	167.6	0	0	0	111.3	I72 G73 K78 Y79 L80	I72-L76 HydrophobicContact CG2-CD1 3.91Å; I72-L76 HydrophobicContact CG2-CG 4.37Å; I72-L76 WeakPolarHBondContact O-CB 3.3Å; I72-L76 WeakPolarHBondContact O-CG 3.38Å; I72-L76 PolarHBondContact O-N 3.33Å; G73-L76 PolarHBondContact O-N 3.44Å; L76-K78 VanDerWaalsContact C-N 3.34Å; L76-K78 PolarHBondContact O-N 3.45Å; L76-Y79 PolarHBondContact O-N 3.49Å; L76-L80 WeakPolarHBondContact O-CB 3.42Å; L76-L80 VanDerWaalsContact O-CG 3.3Å; L76-L80 WeakPolarHBondContact O-CG 3.3Å; L76-L80 PolarHBondContact O-N 3Å
77	A	85.1	Confident	71.4	Confident	41 Å²	41	112.4 Å²	112.4	34%	0.339	59%	0.585	S	S	.	*	H	α-helix	trans	-61.1	-43.5	175.9	0	0	0	0	0	111.4	G73 A74 L80 Q81	G73-A77 VanDerWaalsContact O-CB 3.29Å; G73-A77 WeakPolarHBondContact O-CB 3.45Å; G73-A77 PolarHBondContact O-N 3.46Å; A74-A77 PolarHBondContact O-N 3.43Å; A77-L80 PolarHBondContact O-N 3.27Å; A77-Q81 VanDerWaalsContact O-CB 3.27Å; A77-Q81 WeakPolarHBondContact O-CB 3.43Å; A77-Q81 WeakPolarHBondContact O-CG 3.45Å; A77-Q81 PolarHBondContact O-N 3.49Å
78	K	81.6	Confident	71.5	Confident	139 Å²	139	115 Å²	115	60%	0.604	61%	0.605	S	S	*	*	H	α-helix	trans	-61.1	-44.6	173.8	-78.8	173.7	-178	-82.8	0	111.9	A74 L75 L76 Q81 Q82	A74-K78 WeakPolarHBondContact O-CB 3.39Å; A74-K78 WeakPolarHBondContact O-CG 3.38Å; A74-K78 PolarHBondContact O-N 3.47Å; L75-K78 PolarHBondContact O-N 3.06Å; L76-K78 VanDerWaalsContact C-N 3.34Å; L76-K78 PolarHBondContact O-N 3.45Å; K78-Q81 PolarHBondContact O-N 3.29Å; K78-Q82 VanDerWaalsContact O-CB 3.24Å; K78-Q82 WeakPolarHBondContact O-CB 3.33Å; K78-Q82 PolarHBondContact O-N 3.39Å
79	Y	78.5	Confident	71.2	Confident	162 Å²	162	111.6 Å²	111.6	64%	0.635	61%	0.606	S	S	*	*	H	α-helix	trans	-63.5	-44.9	178.2	-179	-101.2	0	0	0	112.3	L75 L76 Q82 A83	L75-Y79 WeakPolarHBondContact O-CB 3.41Å; L75-Y79 PolarHBondContact O-N 3.47Å; L76-Y79 PolarHBondContact O-N 3.49Å; Y79-Q82 PolarHBondContact O-N 3.28Å; Y79-A83 WeakPolarHBondContact O-CB 3.45Å; Y79-A83 PolarHBondContact O-N 3.42Å
80	L	82.5	Confident	70.9	Confident	103 Å²	103	113.2 Å²	113.2	54%	0.539	61%	0.612	S	S	.	*	H	α-helix	trans	-66.9	-38.2	177.1	-69.9	173.2	0	0	0	112.2	L76 A77 A83 R84	L76-L80 WeakPolarHBondContact O-CB 3.42Å; L76-L80 VanDerWaalsContact O-CG 3.3Å; L76-L80 WeakPolarHBondContact O-CG 3.3Å; L76-L80 PolarHBondContact O-N 3Å; A77-L80 PolarHBondContact O-N 3.27Å; L80-A83 PolarHBondContact O-N 2.89Å; L80-R84 WeakPolarHBondContact O-CG 3.03Å; L80-R84 PolarHBondContact O-N 2.76Å; L80-R84 VanDerWaalsContact O-N 3.12Å
81	Q	79.8	Confident	70.3	Confident	116 Å²	116	118.4 Å²	118.4	54%	0.542	63%	0.63	S	S	.	*	H	α-helix	trans	-66.7	-38.6	173.7	-75	179.7	7.9	0	0	111.6	A77 K78 R84 K85	A77-Q81 VanDerWaalsContact O-CB 3.27Å; A77-Q81 WeakPolarHBondContact O-CB 3.43Å; A77-Q81 WeakPolarHBondContact O-CG 3.45Å; A77-Q81 PolarHBondContact O-N 3.49Å; K78-Q81 PolarHBondContact O-N 3.29Å; Q81-R84 PolarHBondContact O-N 3.2Å; Q81-K85 WeakPolarHBondContact O-CB 3.41Å; Q81-K85 PolarHBondContact O-N 3.44Å
82	Q	70.2	Confident	69.3	Low	144 Å²	144	118.2 Å²	118.2	67%	0.673	64%	0.638	S	S	*	*	H	α-helix	trans	-67.5	-38	175.2	-172.6	172.8	-11.1	0	0	111.6	K78 Y79 R84 K85	K78-Q82 VanDerWaalsContact O-CB 3.24Å; K78-Q82 WeakPolarHBondContact O-CB 3.33Å; K78-Q82 PolarHBondContact O-N 3.39Å; Y79-Q82 PolarHBondContact O-N 3.28Å; Q82-R84 PolarHBondContact O-N 3.08Å; Q82-K85 PolarHBondContact O-N 3.22Å
83	A	61.5	Low	68.1	Low	67 Å²	67	119.1 Å²	119.1	55%	0.554	65%	0.647	S	S	*	*	H	α-helix	trans	-63.9	-26.7	172	0	0	0	0	0	113	Y79 L80	Y79-A83 WeakPolarHBondContact O-CB 3.45Å; Y79-A83 PolarHBondContact O-N 3.42Å; L80-A83 PolarHBondContact O-N 2.89Å
84	R	62.6	Low	66.6	Low	228 Å²	228	125.3 Å²	125.3	86%	0.86	67%	0.668	S	S	*	*	H	α-helix	trans	-88.9	-20.6	177.1	-74.2	179.3	176.9	175.8	-0.3	114.3	L80 Q81 Q82	L80-R84 WeakPolarHBondContact O-CG 3.03Å; L80-R84 PolarHBondContact O-N 2.76Å; L80-R84 VanDerWaalsContact O-N 3.12Å; Q81-R84 PolarHBondContact O-N 3.2Å; Q82-R84 PolarHBondContact O-N 3.08Å
85	K	59.4	Low	65.1	Low	182 Å²	182	125.7 Å²	125.7	79%	0.791	68%	0.677	S	S	*	*	S	Bend	trans	-95.4	24.1	-174.5	-94.4	169.7	159.3	-172.9	0	115.4	Q81 Q82	Q81-K85 WeakPolarHBondContact O-CB 3.41Å; Q81-K85 PolarHBondContact O-N 3.44Å; Q82-K85 PolarHBondContact O-N 3.22Å
86	G	54.1	Low	63.5	Low	54 Å²	54	125.3 Å²	125.3	56%	0.557	68%	0.675	S	S	*	*	S	Bend	trans	86.7	163.2	160.2	0	0	0	0	0	117
87	P	49	Very low	62	Low	128 Å²	128	131.5 Å²	131.5	83%	0.831	69%	0.692	S	S	*	*			cis	-92.7	147.6	-6.5	36.2	-28.8	0	0	0	111.7	G89	P87-G89 PolarHBondContact O-N 3.29Å
88	T	59.5	Low	60.5	Low	147 Å²	147	134.3 Å²	134.3	90%	0.902	71%	0.705	S	S	*	*			trans	-45.9	135.8	162.7	-163.2	0	0	0	0	110.4
89	G	54.6	Low	59.3	Low	62 Å²	62	134.7 Å²	134.7	64%	0.639	71%	0.709	S	S	*	*			trans	160.9	-11.3	163.7	0	0	0	0	0	120.3	P87	P87-G89 PolarHBondContact O-N 3.29Å
90	R	54	Low	58.1	Low	232 Å²	232	132.5 Å²	132.5	88%	0.875	72%	0.717	S	S	*	*	S	Bend	trans	-139.8	11.7	-175.1	-59.3	-168.4	76.3	126.9	1.5	117.8	S92	R90-S92 VanDerWaalsContact C-N 3.3Å; R90-S92 PolarHBondContact O-N 3.39Å
91	I	53.1	Low	57.1	Low	164 Å²	164	131.1 Å²	131.1	84%	0.841	71%	0.709	S	S	*	*			trans	-100.8	52.5	167	-30.2	176.7	0	0	0	109.8
92	S	51.3	Low	56.2	Low	111 Å²	111	130.1 Å²	130.1	78%	0.776	71%	0.708	S	S	*	*			trans	-115.4	44.9	161.5	-66.8	0	0	0	0	109.1	R90 M94	R90-S92 VanDerWaalsContact C-N 3.3Å; R90-S92 PolarHBondContact O-N 3.39Å; S92-M94 VanDerWaalsContact C-N 3.32Å; S92-M94 PolarHBondContact O-N 3.28Å
93	V	54.3	Low	55.8	Low	113 Å²	113	129 Å²	129	69%	0.685	71%	0.713	S	S	*	*	S	Bend	trans	-96.4	65.9	168.6	-175.2	0	0	0	0	107.6
94	M	54.1	Low	55.8	Low	168 Å²	168	131.4 Å²	131.4	83%	0.828	72%	0.721	S	S	*	*	S	Bend	trans	177.6	6.7	152	-124.5	73	94.6	0	0	114.8	S92	S92-M94 VanDerWaalsContact C-N 3.32Å; S92-M94 PolarHBondContact O-N 3.28Å
95	G	51.4	Low	55.7	Low	55 Å²	55	126.3 Å²	126.3	57%	0.567	71%	0.707	S	S	*	*	S	Bend	trans	-91.6	-23	-172.9	0	0	0	0	0	116.9
96	N	52.6	Low	56.3	Low	116 Å²	116	128.1 Å²	128.1	62%	0.62	71%	0.708	S	S	*	*	S	Bend	trans	-108	-0.1	-162.2	-142	61.7	0	0	0	116.1	Q99	N96-Q99 PolarHBondContact OD1-NE2 3.06Å; N96-Q99 PolarHBondContact OD1-OE1 3.31Å
97	R	53.3	Low	57.1	Low	229 Å²	229	130.3 Å²	130.3	86%	0.864	71%	0.706	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.6	-1.3	174.2	-81.6	-168.5	-87.5	-138.6	-1.1	113.9
98	V	54	Low	58.2	Low	101 Å²	101	128.9 Å²	128.9	61%	0.612	69%	0.691	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.7	9.5	173	-174.6	0	0	0	0	111.2	S100 I101	V98-S100 VanDerWaalsContact C-N 3.28Å; V98-I101 HydrophobicContact CG1-CD1 3.81Å
99	Q	55.3	Low	58.7	Low	147 Å²	147	128.1 Å²	128.1	69%	0.687	68%	0.682	S	S	*	*			trans	-91.1	12.8	171.2	-66.9	-172.7	3.8	0	0	112.9	N96	N96-Q99 PolarHBondContact OD1-NE2 3.06Å; N96-Q99 PolarHBondContact OD1-OE1 3.31Å
100	S	53.3	Low	59.2	Low	116 Å²	116	135 Å²	135	81%	0.811	69%	0.689	S	S	*	*			trans	-105.4	36.4	168.2	-175.5	0	0	0	0	110.6	V98	V98-S100 VanDerWaalsContact C-N 3.28Å
101	I	61.1	Low	60	Low	74 Å²	74	128.9 Å²	128.9	38%	0.379	67%	0.673	S	S	.	*	S	Bend	trans	-94.8	127.6	159.7	-73.5	172	0	0	0	104	V98 H105	V98-I101 HydrophobicContact CG1-CD1 3.81Å; I101-H105 HydrophobicContact CG2-CB 3.5Å; I101-H105 VanDerWaalsContact CG2-ND1 3.32Å; I101-H105 WeakPolarHBondContact CG2-ND1 3.39Å; I101-H105 VanDerWaalsContact CG2-O 3.28Å; I101-H105 WeakPolarHBondContact CG2-O 3.47Å
102	D	61.9	Low	60.7	Low	95 Å²	95	127.6 Å²	127.6	51%	0.508	66%	0.659	S	S	.	*			trans	-33.7	130.6	177.6	-177.2	-9.7	0	0	0	110.9	T104 H105	D102-T104 PolarHBondContact O-N 2.81Å; D102-T104 WeakPolarHBondContact OD1-CG2 3.35Å; D102-T104 PolarHBondContact OD1-N 3.1Å; D102-T104 VanDerWaalsContact OD1-N 3.08Å; D102-T104 PolarHBondContact OD1-OG1 3.09Å; D102-T104 VanDerWaalsContact OD1-OG1 3.13Å; D102-T104 PolarHBondContact OD2-OG1 2.87Å; D102-H105 HydrophobicContact CB-CB 4.49Å; D102-H105 CarbonylContact O-C 3.59Å; D102-H105 WeakPolarHBondContact O-CA 3.46Å; D102-H105 PolarHBondContact O-N 3.45Å
103	P	61	Low	61.3	Low	120 Å²	120	129 Å²	129	78%	0.779	66%	0.655	S	S	*	*	T	Hydrogen-bonded Turn	trans	-52	-19.6	176.1	-26.1	33	0	0	0	114.3
104	T	61.3	Low	62.2	Low	118 Å²	118	125.5 Å²	125.5	72%	0.724	64%	0.642	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.1	-20.8	172.5	70.4	0	0	0	0	113.8	D102 R106	D102-T104 PolarHBondContact O-N 2.81Å; D102-T104 WeakPolarHBondContact OD1-CG2 3.35Å; D102-T104 PolarHBondContact OD1-N 3.1Å; D102-T104 VanDerWaalsContact OD1-N 3.08Å; D102-T104 PolarHBondContact OD1-OG1 3.09Å; D102-T104 VanDerWaalsContact OD1-OG1 3.13Å; D102-T104 PolarHBondContact OD2-OG1 2.87Å; T104-R106 VanDerWaalsContact C-N 3.34Å; T104-R106 PolarHBondContact O-N 3.34Å
105	H	62.1	Low	63.2	Low	121 Å²	121	124.1 Å²	124.1	56%	0.56	63%	0.628	S	S	*	*			trans	-102.3	44.1	177.2	-168.1	-70	0	0	0	110.6	I101 D102 I107	I101-H105 HydrophobicContact CG2-CB 3.5Å; I101-H105 VanDerWaalsContact CG2-ND1 3.32Å; I101-H105 WeakPolarHBondContact CG2-ND1 3.39Å; I101-H105 VanDerWaalsContact CG2-O 3.28Å; I101-H105 WeakPolarHBondContact CG2-O 3.47Å; D102-H105 HydrophobicContact CB-CB 4.49Å; D102-H105 CarbonylContact O-C 3.59Å; D102-H105 WeakPolarHBondContact O-CA 3.46Å; D102-H105 PolarHBondContact O-N 3.45Å; H105-I107 PolarHBondContact O-N 3.13Å; H105-I107 VanDerWaalsContact O-N 3.13Å
106	R	72	Confident	64.2	Low	220 Å²	220	127.1 Å²	127.1	83%	0.83	63%	0.628	S	S	*	*			trans	-77.5	97.4	169.4	-170	179.3	145.2	105.6	4.2	107.3	T104 N108	T104-R106 VanDerWaalsContact C-N 3.34Å; T104-R106 PolarHBondContact O-N 3.34Å; R106-N108 PolarHBondContact O-N 3.47Å; R106-N108 VanDerWaalsContact O-N 3.1Å
107	I	70.4	Confident	64.9	Low	100 Å²	100	123.5 Å²	123.5	51%	0.513	61%	0.609	S	S	.	*			trans	-43.6	119	176.7	-61.4	167.1	0	0	0	108.5	H105 D111 Y112	H105-I107 PolarHBondContact O-N 3.13Å; H105-I107 VanDerWaalsContact O-N 3.13Å; I107-D111 HydrophobicContact CG2-CB 4.21Å; I107-Y112 HydrophobicContact CG2-CD2 3.94Å; I107-Y112 HydrophobicContact CG2-CE2 4.24Å
108	N	71.3	Confident	65.4	Low	97 Å²	97	120 Å²	120	52%	0.519	60%	0.6	S	S	.	*			trans	-91.8	153.7	-176.5	-165	-29.6	0	0	0	109.2	R106 R110 D111 Y112	R106-N108 PolarHBondContact O-N 3.47Å; R106-N108 VanDerWaalsContact O-N 3.1Å; N108-R110 PolarHBondContact O-N 3.01Å; N108-D111 WeakPolarHBondContact CB-OD2 3.33Å; N108-D111 PolarHBondContact N-OD2 2.86Å; N108-D111 WeakPolarHBondContact O-CA 3.49Å; N108-D111 WeakPolarHBondContact O-CB 3.44Å; N108-D111 PolarHBondContact O-N 3.38Å; N108-Y112 PolarHBondContact O-N 2.92Å
109	D	69.8	Low	66.1	Low	131 Å²	131	118.6 Å²	118.6	70%	0.701	61%	0.606	S	S	*	*	H	α-helix	trans	-56.2	-27.8	177.1	-63.7	-35.5	0	0	0	111.6	D111 Y112 M113	D109-D111 VanDerWaalsContact C-N 3.34Å; D109-D111 PolarHBondContact O-N 3.47Å; D109-Y112 CarbonylContact O-C 3.57Å; D109-Y112 WeakPolarHBondContact O-CA 3.36Å; D109-Y112 WeakPolarHBondContact O-CB 3.28Å; D109-Y112 PolarHBondContact O-N 3.49Å; D109-Y112 VanDerWaalsContact O-N 3.13Å; D109-M113 WeakPolarHBondContact O-CG 3.42Å; D109-M113 PolarHBondContact O-N 3.05Å
110	R	66.1	Low	66.5	Low	208 Å²	208	119.6 Å²	119.6	79%	0.785	60%	0.604	S	S	*	*	H	α-helix	trans	-64.1	-34.5	173.6	-160.7	175.2	-177.1	-179.5	0.1	113.4	N108 Y112 M113	N108-R110 PolarHBondContact O-N 3.01Å; R110-Y112 VanDerWaalsContact C-N 3.26Å; R110-M113 PolarHBondContact O-N 3.13Å
111	D	69.8	Low	66.9	Low	103 Å²	103	121.5 Å²	121.5	55%	0.551	59%	0.593	S	S	*	*	H	α-helix	trans	-72.4	-27.4	175.1	-52.3	-41.2	0	0	0	110.7	I107 N108 D109	I107-D111 HydrophobicContact CG2-CB 4.21Å; N108-D111 WeakPolarHBondContact CB-OD2 3.33Å; N108-D111 PolarHBondContact N-OD2 2.86Å; N108-D111 WeakPolarHBondContact O-CA 3.49Å; N108-D111 WeakPolarHBondContact O-CB 3.44Å; N108-D111 PolarHBondContact O-N 3.38Å; D109-D111 VanDerWaalsContact C-N 3.34Å; D109-D111 PolarHBondContact O-N 3.47Å
112	Y	67.8	Low	66.8	Low	137 Å²	137	123 Å²	123	54%	0.537	61%	0.61	S	S	.	*	H	α-helix	trans	-77.9	-25.9	174.3	-113.6	-96.9	0	0	0	113.5	I107 N108 D109 R110 W115	I107-Y112 HydrophobicContact CG2-CD2 3.94Å; I107-Y112 HydrophobicContact CG2-CE2 4.24Å; N108-Y112 PolarHBondContact O-N 2.92Å; D109-Y112 CarbonylContact O-C 3.57Å; D109-Y112 WeakPolarHBondContact O-CA 3.36Å; D109-Y112 WeakPolarHBondContact O-CB 3.28Å; D109-Y112 PolarHBondContact O-N 3.49Å; D109-Y112 VanDerWaalsContact O-N 3.13Å; R110-Y112 VanDerWaalsContact C-N 3.26Å; Y112-W115 VanDerWaalsContact C-CD1 3.46Å; Y112-W115 VanDerWaalsContact CA-CD1 3.47Å; Y112-W115 AromaticContact CD1-CE2 3.82Å; Y112-W115 HydrophobicContact CD1-CZ2 4.01Å; Y112-W115 AromaticContact CD1-NE1 3.04Å; Y112-W115 AromaticContact CE1-CE2 3.96Å; Y112-W115 AromaticContact CE1-CZ2 3.92Å; Y112-W115 HydrophobicContact CE1-CZ2 3.92Å; Y112-W115 AromaticContact CE1-NE1 3.47Å; Y112-W115 AromaticContact CG-NE1 3.52Å; Y112-W115 PolarHBondContact O-NE1 3.28Å
113	M	64.5	Low	66.5	Low	139 Å²	139	123 Å²	123	69%	0.685	62%	0.623	S	S	*	*	H	α-helix	trans	-75.9	-31.1	178	-71.2	-168	74.8	0	0	112.9	D109 R110 W115	D109-M113 WeakPolarHBondContact O-CG 3.42Å; D109-M113 PolarHBondContact O-N 3.05Å; R110-M113 PolarHBondContact O-N 3.13Å; M113-W115 PolarHBondContact O-N 2.74Å
114	G	72.5	Confident	66.4	Low	41 Å²	41	122.7 Å²	122.7	42%	0.423	61%	0.611	S	S	.	*	H	α-helix	trans	-69.2	-29.8	-176.9	0	0	0	0	0	114.8
115	W	74.8	Confident	66.3	Low	138 Å²	138	125 Å²	125	52%	0.523	61%	0.614	S	S	.	*	H	α-helix	trans	-80	-21.7	-176.5	73.2	-96.8	0	0	0	114.3	Y112 M113 D117 F118	Y112-W115 VanDerWaalsContact C-CD1 3.46Å; Y112-W115 VanDerWaalsContact CA-CD1 3.47Å; Y112-W115 AromaticContact CD1-CE2 3.82Å; Y112-W115 HydrophobicContact CD1-CZ2 4.01Å; Y112-W115 AromaticContact CD1-NE1 3.04Å; Y112-W115 AromaticContact CE1-CE2 3.96Å; Y112-W115 AromaticContact CE1-CZ2 3.92Å; Y112-W115 HydrophobicContact CE1-CZ2 3.92Å; Y112-W115 AromaticContact CE1-NE1 3.47Å; Y112-W115 AromaticContact CG-NE1 3.52Å; Y112-W115 PolarHBondContact O-NE1 3.28Å; M113-W115 PolarHBondContact O-N 2.74Å; W115-D117 PolarHBondContact O-N 2.93Å; W115-F118 HydrophobicContact CB-CD2 4.41Å; W115-F118 HydrophobicContact CB-CE2 4.26Å; W115-F118 WeakPolarHBondContact O-CD2 3.49Å
116	M	72.9	Confident	66	Low	119 Å²	119	130.5 Å²	130.5	59%	0.586	63%	0.631	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.2	-15.4	176.9	-69.8	-171.4	-80.5	0	0	112.7
117	D	68.6	Low	65.4	Low	39 Å²	39	128.6 Å²	128.6	21%	0.209	63%	0.632	C	S	.	*	T	Hydrogen-bonded Turn	trans	-98.1	-1.2	-170.9	-146.5	27.9	0	0	0	113.7	W115 G119 R120 R121	W115-D117 PolarHBondContact O-N 2.93Å; D117-G119 PolarHBondContact O-N 3.23Å; D117-G119 VanDerWaalsContact O-N 3.09Å; D117-R120 PolarHBondContact O-N 3.32Å; D117-R120 VanDerWaalsContact O-N 3.1Å; D117-R120 WeakPolarHBondContact OD1-CB 3.46Å; D117-R120 IonicContact OD1-CZ 3.83Å; D117-R120 IonicContact OD1-NH1 2.92Å; D117-R120 PolarHBondContact OD1-NH1 3.48Å; D117-R121 WeakPolarHBondContact O-CG 3.32Å; D117-R121 PolarHBondContact O-N 3.08Å; D117-R121 WeakPolarHBondContact OD2-CD 3.49Å; D117-R121 IonicContact OD2-NE 3.83Å
118	F	63.6	Low	64.5	Low	156 Å²	156	134.4 Å²	134.4	68%	0.684	65%	0.649	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.3	-20.9	175.7	-78.2	-71.2	0	0	0	113.4	W115 S122	W115-F118 HydrophobicContact CB-CD2 4.41Å; W115-F118 HydrophobicContact CB-CE2 4.26Å; W115-F118 WeakPolarHBondContact O-CD2 3.49Å; F118-S122 PolarHBondContact O-OG 3.1Å
119	G	68.1	Low	63.4	Low	71 Å²	71	135.6 Å²	135.6	73%	0.732	66%	0.664	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.9	-16.5	177.8	0	0	0	0	0	115.1	D117	D117-G119 PolarHBondContact O-N 3.23Å; D117-G119 VanDerWaalsContact O-N 3.09Å
120	R	63	Low	62.6	Low	169 Å²	169	137.4 Å²	137.4	64%	0.638	69%	0.688	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.9	-34.9	-176.7	-71.7	175.5	65.5	-123.9	2.9	112.4	D117 S122	D117-R120 PolarHBondContact O-N 3.32Å; D117-R120 VanDerWaalsContact O-N 3.1Å; D117-R120 WeakPolarHBondContact OD1-CB 3.46Å; D117-R120 IonicContact OD1-CZ 3.83Å; D117-R120 IonicContact OD1-NH1 2.92Å; D117-R120 PolarHBondContact OD1-NH1 3.48Å; R120-S122 PolarHBondContact O-N 3.13Å
121	R	62.9	Low	62.4	Low	155 Å²	155	133.9 Å²	133.9	59%	0.585	68%	0.683	S	S	*	*	G	3₁₀ helix	trans	-79.7	-15.8	-174.1	-57.1	178.3	102.8	170.7	5.6	114.8	D117 A123	D117-R121 WeakPolarHBondContact O-CG 3.32Å; D117-R121 PolarHBondContact O-N 3.08Å; D117-R121 WeakPolarHBondContact OD2-CD 3.49Å; D117-R121 IonicContact OD2-NE 3.83Å; R121-A123 VanDerWaalsContact C-N 3.25Å; R121-A123 PolarHBondContact O-N 2.76Å
122	S	58.1	Low	62	Low	107 Å²	107	135.5 Å²	135.5	75%	0.748	69%	0.69	S	S	*	*	G	3₁₀ helix	trans	-79.2	-1.6	-178.3	-47.4	0	0	0	0	114.6	F118 R120	F118-S122 PolarHBondContact O-OG 3.1Å; R120-S122 PolarHBondContact O-N 3.13Å
123	A	56.6	Low	61.7	Low	93 Å²	93	135.4 Å²	135.4	77%	0.769	70%	0.698	S	S	*	*	G	3₁₀ helix	trans	-124	0.8	-169.6	0	0	0	0	0	115.1	R121	R121-A123 VanDerWaalsContact C-N 3.25Å; R121-A123 PolarHBondContact O-N 2.76Å
124	E	58.8	Low	61.5	Low	115 Å²	115	135.2 Å²	135.2	54%	0.537	70%	0.699	S	S	.	*	S	Bend	trans	-119	6.1	-171.7	60.7	-166.3	-169.7	0	0	115.7
125	E	58.1	Low	60.8	Low	167 Å²	167	141.1 Å²	141.1	78%	0.78	72%	0.716	S	S	*	*	S	Bend	trans	-104.1	12.9	-179	-65.3	179.4	-169.7	0	0	115.3
126	Y	56.6	Low	59.9	Low	236 Å²	236	141.3 Å²	141.3	93%	0.925	73%	0.729	S	S	*	*			trans	-109.2	53.1	171.1	-96.6	-90.1	0	0	0	111.6	Y128	Y126-Y128 PolarHBondContact O-N 3.13Å
127	E	59.8	Low	58.9	Low	179 Å²	179	142.9 Å²	142.9	84%	0.836	74%	0.74	S	S	*	*			trans	-76.6	106.8	162.9	-80.2	166.7	170.4	0	0	108.9	S129	E127-S129 PolarHBondContact O-N 3.23Å; E127-S129 VanDerWaalsContact O-N 3.13Å
128	Y	50.5	Low	58.2	Low	223 Å²	223	150.9 Å²	150.9	88%	0.875	78%	0.78	S	S	*	*			trans	-36.9	106	168.6	-135.9	-99.9	0	0	0	111.4	Y126 S130	Y126-Y128 PolarHBondContact O-N 3.13Å; Y128-S130 PolarHBondContact O-N 3.2Å
129	S	49.3	Very low	57.7	Low	121 Å²	121	150.5 Å²	150.5	85%	0.846	79%	0.788	S	S	*	*			trans	-76.8	103	160.6	-156.8	0	0	0	0	107	E127	E127-S129 PolarHBondContact O-N 3.23Å; E127-S129 VanDerWaalsContact O-N 3.13Å
130	S	51.1	Low	56.8	Low	170 Å²	170	157.7 Å²	157.7	100%	1.189	79%	0.794	S	S	*	*			trans	-64.1	0	165.1	57	0	0	0	0	111.6	Y128	Y128-S130 PolarHBondContact O-N 3.2Å

Retrieved 130 of 130 residues in 223.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).