A0A093I9U5_STRCA Loading...

Thymosin beta

Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization.

AlphaFold DB , UniProt , Accession A0A093I9U5, Species STRCA (Struthio camelus australis), Gene n/a, Length 45 aa.

						>A0A093I9U5_STRCA|A0A093I9U5
MCDKPDLSEVEKFDKRKLKKTNTEEKNTLPSKETIEQEKECVKSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	58.1	Low	75.6	Confident	218 Å²	218	130.9 Å²	130.9	100%	1.074	69%	0.694	S	S	*	*				0	121.9	0	-62.6	-65.6	-173.9	0	0	105.9	D3	M1-D3 VanDerWaalsContact C-N 3.33Å; M1-D3 PolarHBondContact O-N 3.46Å
2	C	57.7	Low	76.7	Confident	114 Å²	114	133.4 Å²	133.4	77%	0.77	70%	0.695	S	S	*	*			trans	-91	82.5	178.4	-155.1	0	0	0	0	106.1	K4	C2-K4 PolarHBondContact O-N 3.19Å
3	D	70.1	Confident	77.6	Confident	146 Å²	146	131 Å²	131	78%	0.781	68%	0.676	S	S	*	*			trans	-69	85.4	179.2	-63.9	-65.1	0	0	0	108.4	M1	M1-D3 VanDerWaalsContact C-N 3.33Å; M1-D3 PolarHBondContact O-N 3.46Å
4	K	72.8	Confident	78.4	Confident	174 Å²	174	126.5 Å²	126.5	76%	0.757	65%	0.654	S	S	*	*	P	Polyproline II helix	trans	-67.5	131.2	171.7	-77.8	159.8	-177.8	158.3	0	107.6	C2 D6	C2-K4 PolarHBondContact O-N 3.19Å; K4-D6 PolarHBondContact O-N 3.4Å
5	P	76.4	Confident	78.9	Confident	104 Å²	104	129.3 Å²	129.3	68%	0.675	66%	0.659	S	S	*	*	P	Polyproline II helix	trans	-61.6	137.1	-179.6	25.2	-32.8	0	0	0	110	L7	P5-L7 PolarHBondContact O-N 3.22Å
6	D	79.1	Confident	79.5	Confident	120 Å²	120	135.3 Å²	135.3	64%	0.642	67%	0.671	S	S	*	*	P	Polyproline II helix	trans	-66.8	119.7	172.6	-179.2	16.3	0	0	0	109.7	K4 S8	K4-D6 PolarHBondContact O-N 3.4Å; D6-S8 VanDerWaalsContact CG-OG 3.25Å; D6-S8 WeakPolarHBondContact OD1-CB 3.29Å; D6-S8 PolarHBondContact OD1-N 3.45Å; D6-S8 PolarHBondContact OD1-OG 3.41Å; D6-S8 PolarHBondContact OD2-OG 3.22Å
7	L	82.9	Confident	80	Confident	112 Å²	112	136.9 Å²	136.9	59%	0.586	67%	0.673	S	S	*	*			trans	-96	-1.2	-178.8	-61.9	177	0	0	0	112.6	P5 E9 V10	P5-L7 PolarHBondContact O-N 3.22Å; L7-E9 PolarHBondContact O-N 2.89Å; L7-V10 HydrophobicContact CD2-CG2 4.39Å; L7-V10 WeakPolarHBondContact O-CB 3.37Å; L7-V10 PolarHBondContact O-N 3.37Å
8	S	84.3	Confident	80.5	Confident	37 Å²	37	134.9 Å²	134.9	26%	0.259	67%	0.665	S	S	.	*	H	α-helix	trans	-59.8	-30	-178	73.7	0	0	0	0	113	D6 V10 E11 K12	D6-S8 VanDerWaalsContact CG-OG 3.25Å; D6-S8 WeakPolarHBondContact OD1-CB 3.29Å; D6-S8 PolarHBondContact OD1-N 3.45Å; D6-S8 PolarHBondContact OD1-OG 3.41Å; D6-S8 PolarHBondContact OD2-OG 3.22Å; S8-V10 VanDerWaalsContact C-N 3.33Å; S8-E11 PolarHBondContact O-N 3.28Å; S8-K12 PolarHBondContact O-N 3.49Å
9	E	82.4	Confident	80.9	Confident	133 Å²	133	138.2 Å²	138.2	62%	0.621	68%	0.675	S	S	*	*	H	α-helix	trans	-66.3	-33.1	174.3	-73.4	-67.5	162.6	0	0	112.3	L7 E11 K12 F13	L7-E9 PolarHBondContact O-N 2.89Å; E9-E11 VanDerWaalsContact C-N 3.34Å; E9-E11 PolarHBondContact O-N 3.25Å; E9-K12 PolarHBondContact O-N 2.92Å; E9-F13 VanDerWaalsContact O-CB 3.25Å; E9-F13 WeakPolarHBondContact O-CB 3.49Å; E9-F13 PolarHBondContact O-N 3.46Å
10	V	83.8	Confident	81.1	Confident	112 Å²	112	142 Å²	142	68%	0.679	69%	0.688	S	S	*	*	H	α-helix	trans	-68	-36.7	178.7	-176.5	0	0	0	0	111	L7 S8	L7-V10 HydrophobicContact CD2-CG2 4.39Å; L7-V10 WeakPolarHBondContact O-CB 3.37Å; L7-V10 PolarHBondContact O-N 3.37Å; S8-V10 VanDerWaalsContact C-N 3.33Å
11	E	83.9	Confident	81.2	Confident	170 Å²	170	140.7 Å²	140.7	79%	0.794	69%	0.689	S	S	*	*	H	α-helix	trans	-69.5	-35.5	177.9	-65.3	-177.6	174.2	0	0	112.6	S8 E9	S8-E11 PolarHBondContact O-N 3.28Å; E9-E11 VanDerWaalsContact C-N 3.34Å; E9-E11 PolarHBondContact O-N 3.25Å
12	K	89.4	Confident	81.9	Confident	161 Å²	161	136.8 Å²	136.8	70%	0.7	67%	0.672	S	S	*	*	H	α-helix	trans	-97	-5.8	-174	-63.2	174.5	-171.9	170.2	0	113.8	S8 E9 D14	S8-K12 PolarHBondContact O-N 3.49Å; E9-K12 PolarHBondContact O-N 2.92Å; K12-D14 PolarHBondContact O-N 3.37Å
13	F	88.4	Confident	83	Confident	102 Å²	102	137 Å²	137	45%	0.447	67%	0.67	S	S	.	*			trans	-63.4	124.2	-174.9	-177.3	-97.3	0	0	0	112.2	E9 K15 K17 L18	E9-F13 VanDerWaalsContact O-CB 3.25Å; E9-F13 WeakPolarHBondContact O-CB 3.49Å; E9-F13 PolarHBondContact O-N 3.46Å; F13-K15 PolarHBondContact O-N 3.46Å; F13-K17 HydrophobicContact CZ-CB 4.33Å; F13-L18 HydrophobicContact CE1-CD1 4.41Å; F13-L18 HydrophobicContact CE1-CD2 3.61Å; F13-L18 HydrophobicContact CE1-CG 3.79Å; F13-L18 HydrophobicContact CZ-CD2 3.83Å; F13-L18 HydrophobicContact CZ-CG 4.27Å
14	D	88.4	Confident	83.2	Confident	68 Å²	68	136.3 Å²	136.3	36%	0.364	66%	0.662	S	S	.	*			trans	-78.6	111.7	176.4	-178.4	4	0	0	0	111.2	K12 R16 K17	K12-D14 PolarHBondContact O-N 3.37Å; D14-R16 PolarHBondContact O-N 3.4Å; D14-R16 VanDerWaalsContact OD1-CB 3.29Å; D14-R16 WeakPolarHBondContact OD1-CB 3.45Å; D14-R16 VanDerWaalsContact OD1-CG 3.32Å; D14-R16 WeakPolarHBondContact OD1-CG 3.39Å; D14-R16 PolarHBondContact OD1-N 3.11Å; D14-K17 HydrophobicContact CB-CD 4.33Å; D14-K17 HydrophobicContact CB-CG 4.3Å; D14-K17 WeakPolarHBondContact O-CB 3.21Å; D14-K17 PolarHBondContact O-N 3.37Å
15	K	86.6	Confident	83.1	Confident	169 Å²	169	135.1 Å²	135.1	74%	0.735	66%	0.66	S	S	*	*	G	3₁₀ helix	trans	-57.5	-20	177.6	-60.8	-179.5	-177.2	179.6	0	113.6	F13 K17 L18	F13-K15 PolarHBondContact O-N 3.46Å; K15-K17 VanDerWaalsContact C-N 3.26Å; K15-K17 PolarHBondContact O-N 2.95Å; K15-L18 HydrophobicContact CB-CD1 4.36Å; K15-L18 WeakPolarHBondContact O-CB 3.42Å; K15-L18 WeakPolarHBondContact O-CG 3.35Å; K15-L18 PolarHBondContact O-N 3.1Å
16	R	88.6	Confident	82.9	Confident	224 Å²	224	137.4 Å²	137.4	85%	0.845	66%	0.659	S	S	*	*	G	3₁₀ helix	trans	-71	-22	176.6	-61.5	172.9	179.5	-176.6	1	113	D14 L18	D14-R16 PolarHBondContact O-N 3.4Å; D14-R16 VanDerWaalsContact OD1-CB 3.29Å; D14-R16 WeakPolarHBondContact OD1-CB 3.45Å; D14-R16 VanDerWaalsContact OD1-CG 3.32Å; D14-R16 WeakPolarHBondContact OD1-CG 3.39Å; D14-R16 PolarHBondContact OD1-N 3.11Å; R16-L18 PolarHBondContact O-N 2.95Å
17	K	88	Confident	82.6	Confident	163 Å²	163	137.6 Å²	137.6	71%	0.709	66%	0.66	S	S	*	*	G	3₁₀ helix	trans	-75.5	-8.2	174.3	-63.8	179.4	179.7	176.6	0	112.8	F13 D14 K15	F13-K17 HydrophobicContact CZ-CB 4.33Å; D14-K17 HydrophobicContact CB-CD 4.33Å; D14-K17 HydrophobicContact CB-CG 4.3Å; D14-K17 WeakPolarHBondContact O-CB 3.21Å; D14-K17 PolarHBondContact O-N 3.37Å; K15-K17 VanDerWaalsContact C-N 3.26Å; K15-K17 PolarHBondContact O-N 2.95Å
18	L	89.1	Confident	82	Confident	101 Å²	101	138 Å²	138	53%	0.529	67%	0.667	S	S	.	*	S	Bend	trans	-69.5	134.4	173.5	-63.5	172.7	0	0	0	110.3	F13 K15 R16 K20	F13-L18 HydrophobicContact CE1-CD1 4.41Å; F13-L18 HydrophobicContact CE1-CD2 3.61Å; F13-L18 HydrophobicContact CE1-CG 3.79Å; F13-L18 HydrophobicContact CZ-CD2 3.83Å; F13-L18 HydrophobicContact CZ-CG 4.27Å; K15-L18 HydrophobicContact CB-CD1 4.36Å; K15-L18 WeakPolarHBondContact O-CB 3.42Å; K15-L18 WeakPolarHBondContact O-CG 3.35Å; K15-L18 PolarHBondContact O-N 3.1Å; R16-L18 PolarHBondContact O-N 2.95Å; L18-K20 PolarHBondContact O-N 3Å
19	K	87.4	Confident	81.7	Confident	198 Å²	198	143.8 Å²	143.8	86%	0.861	69%	0.694	S	S	*	*	P	Polyproline II helix	trans	-61.5	135.4	172.7	-65.8	-178.4	-179	178.2	0	109.1	T21	K19-T21 PolarHBondContact O-N 3.19Å; K19-T21 VanDerWaalsContact O-N 3.15Å
20	K	85.3	Confident	81.6	Confident	213 Å²	213	140.8 Å²	140.8	93%	0.926	69%	0.686	S	S	*	*	P	Polyproline II helix	trans	-64.6	116.8	170.3	-63.8	-64.2	-178.2	178.4	0	107.7	L18	L18-K20 PolarHBondContact O-N 3Å
21	T	82.1	Confident	81.5	Confident	116 Å²	116	138.4 Å²	138.4	71%	0.712	67%	0.674	S	S	*	*			trans	-115.6	137	173	-166	0	0	0	0	108	K19	K19-T21 PolarHBondContact O-N 3.19Å; K19-T21 VanDerWaalsContact O-N 3.15Å
22	N	74.1	Confident	81.3	Confident	136 Å²	136	138.5 Å²	138.5	73%	0.727	67%	0.672	S	S	*	*			trans	-79.4	121.4	166.8	-172.3	-85.2	0	0	0	106.8
23	T	79	Confident	80.9	Confident	119 Å²	119	136.9 Å²	136.9	73%	0.73	67%	0.667	S	S	*	*			trans	-93.3	111.8	174.5	-57.7	0	0	0	0	107.5	E25	T23-E25 PolarHBondContact O-N 3.06Å
24	E	76.3	Confident	80.6	Confident	131 Å²	131	134.5 Å²	134.5	61%	0.612	66%	0.661	S	S	*	*			trans	-79.6	101.4	172.2	-63.7	-166.6	166.4	0	0	109.4	K26	E24-K26 PolarHBondContact O-N 2.95Å; E24-K26 VanDerWaalsContact O-N 3.12Å; E24-K26 WeakPolarHBondContact OE2-CE 3.19Å; E24-K26 IonicContact OE2-NZ 2.69Å; E24-K26 PolarHBondContact OE2-NZ 3.35Å
25	E	69.8	Low	80.3	Confident	149 Å²	149	134.2 Å²	134.2	70%	0.696	66%	0.659	S	S	*	*			trans	-73.7	99.6	170.7	-169	-176	149.8	0	0	109.2	T23 N27	T23-E25 PolarHBondContact O-N 3.06Å; E25-N27 HydrophobicContact CG-CB 4.08Å; E25-N27 PolarHBondContact O-N 3.19Å; E25-N27 PolarHBondContact OE1-ND2 3.33Å
26	K	71.1	Confident	80.1	Confident	152 Å²	152	132 Å²	132	66%	0.661	65%	0.651	S	S	*	*			trans	-80.7	51.9	175.8	-60.6	-66.2	-176.9	-169.9	0	111.5	E24 T28	E24-K26 PolarHBondContact O-N 2.95Å; E24-K26 VanDerWaalsContact O-N 3.12Å; E24-K26 WeakPolarHBondContact OE2-CE 3.19Å; E24-K26 IonicContact OE2-NZ 2.69Å; E24-K26 PolarHBondContact OE2-NZ 3.35Å; K26-T28 VanDerWaalsContact C-N 3.29Å
27	N	73.1	Confident	79.8	Confident	124 Å²	124	126.5 Å²	126.5	66%	0.663	64%	0.635	S	S	*	*			trans	-96	42.3	169.3	-86.4	-24.9	0	0	0	111	E25 L29	E25-N27 HydrophobicContact CG-CB 4.08Å; E25-N27 PolarHBondContact O-N 3.19Å; E25-N27 PolarHBondContact OE1-ND2 3.33Å; N27-L29 PolarHBondContact O-N 3.13Å
28	T	72.1	Confident	79.5	Confident	120 Å²	120	124.3 Å²	124.3	74%	0.736	63%	0.627	S	S	*	*	P	Polyproline II helix	trans	-68.7	119.9	170.8	50	0	0	0	0	108.1	K26	K26-T28 VanDerWaalsContact C-N 3.29Å
29	L	77.3	Confident	79.1	Confident	159 Å²	159	125.5 Å²	125.5	83%	0.832	63%	0.628	S	S	*	*	P	Polyproline II helix	trans	-53.6	138.1	170.3	-65.5	175.6	0	0	0	108.7	N27 S31	N27-L29 PolarHBondContact O-N 3.13Å; L29-S31 PolarHBondContact O-N 3.22Å
30	P	80.6	Confident	78.5	Confident	70 Å²	70	122.8 Å²	122.8	46%	0.455	62%	0.619	S	S	.	*	P	Polyproline II helix	trans	-56.2	142.7	175.9	23	-31.7	0	0	0	109.7	T34 I35	P30-T34 HydrophobicContact CB-CG2 4.11Å; P30-I35 HydrophobicContact CB-CG1 4.03Å; P30-I35 HydrophobicContact CG-CD1 4.19Å; P30-I35 HydrophobicContact CG-CG1 3.96Å
31	S	80.3	Confident	77.8	Confident	61 Å²	61	116.5 Å²	116.5	43%	0.427	60%	0.601	S	S	.	*	P	Polyproline II helix	trans	-69.3	162.1	176.8	74.8	0	0	0	0	110	L29 E33 T34 I35	L29-S31 PolarHBondContact O-N 3.22Å; S31-E33 PolarHBondContact O-N 3.47Å; S31-T34 PolarHBondContact O-N 2.99Å; S31-T34 VanDerWaalsContact O-N 3.13Å; S31-T34 PolarHBondContact OG-N 3.26Å; S31-T34 PolarHBondContact OG-OG1 2.81Å; S31-I35 WeakPolarHBondContact O-CG1 3.28Å; S31-I35 PolarHBondContact O-N 3.44Å
32	K	80.3	Confident	77	Confident	173 Å²	173	116.2 Å²	116.2	75%	0.752	60%	0.599	S	S	*	*	H	α-helix	trans	-54.7	-38.1	176.1	-67.4	-175.3	-179.4	-177.3	0	112.1	I35 E36	K32-I35 PolarHBondContact O-N 3.15Å; K32-E36 WeakPolarHBondContact O-CG 3.38Å; K32-E36 PolarHBondContact O-N 2.99Å
33	E	81.6	Confident	76.3	Confident	127 Å²	127	117.8 Å²	117.8	59%	0.593	60%	0.599	S	S	*	*	H	α-helix	trans	-62.2	-47.1	177.2	-174.2	-175.7	170.6	0	0	111.8	S31 I35 E36 Q37	S31-E33 PolarHBondContact O-N 3.47Å; E33-I35 VanDerWaalsContact C-N 3.31Å; E33-I35 PolarHBondContact O-N 2.69Å; E33-E36 PolarHBondContact O-N 3.22Å; E33-Q37 WeakPolarHBondContact O-CB 3.41Å; E33-Q37 WeakPolarHBondContact O-CG 3.06Å; E33-Q37 PolarHBondContact O-N 3.12Å
34	T	81.1	Confident	75.2	Confident	52 Å²	52	116.9 Å²	116.9	32%	0.319	60%	0.597	S	S	.	*	H	α-helix	trans	-61.6	-40.8	176.6	-53	0	0	0	0	111.6	P30 S31 Q37 E38	P30-T34 HydrophobicContact CB-CG2 4.11Å; S31-T34 PolarHBondContact O-N 2.99Å; S31-T34 VanDerWaalsContact O-N 3.13Å; S31-T34 PolarHBondContact OG-N 3.26Å; S31-T34 PolarHBondContact OG-OG1 2.81Å; T34-Q37 PolarHBondContact O-N 3.42Å; T34-E38 WeakPolarHBondContact O-CG 3.39Å; T34-E38 PolarHBondContact O-N 3.33Å
35	I	82.6	Confident	74.1	Confident	62 Å²	62	118 Å²	118	32%	0.318	62%	0.619	S	S	.	*	H	α-helix	trans	-66	-39	178.1	-64	166.8	0	0	0	111.4	P30 S31 K32 E33 K39	P30-I35 HydrophobicContact CB-CG1 4.03Å; P30-I35 HydrophobicContact CG-CD1 4.19Å; P30-I35 HydrophobicContact CG-CG1 3.96Å; S31-I35 WeakPolarHBondContact O-CG1 3.28Å; S31-I35 PolarHBondContact O-N 3.44Å; K32-I35 PolarHBondContact O-N 3.15Å; E33-I35 VanDerWaalsContact C-N 3.31Å; E33-I35 PolarHBondContact O-N 2.69Å; I35-K39 HydrophobicContact CG2-CD 4.35Å; I35-K39 WeakPolarHBondContact O-CB 3.41Å; I35-K39 VanDerWaalsContact O-CG 3.28Å; I35-K39 WeakPolarHBondContact O-CG 3.29Å; I35-K39 PolarHBondContact O-N 2.9Å; I35-K39 VanDerWaalsContact O-N 3.1Å
36	E	82.9	Confident	74.3	Confident	123 Å²	123	116.4 Å²	116.4	58%	0.575	62%	0.615	S	S	*	*	H	α-helix	trans	-69.2	-43.7	177.3	-76.6	174.8	-175.9	0	0	111.6	K32 E33 E38 K39 E40	K32-E36 WeakPolarHBondContact O-CG 3.38Å; K32-E36 PolarHBondContact O-N 2.99Å; E33-E36 PolarHBondContact O-N 3.22Å; E36-E38 PolarHBondContact O-N 3.45Å; E36-K39 WeakPolarHBondContact O-CB 3.49Å; E36-K39 PolarHBondContact O-N 3.04Å; E36-E40 PolarHBondContact O-N 3.28Å
37	Q	82.3	Confident	74.4	Confident	107 Å²	107	114.5 Å²	114.5	50%	0.5	61%	0.613	S	S	.	*	H	α-helix	trans	-59.1	-44.7	174.6	-75.7	174.4	-23.3	0	0	112.3	E33 T34 K39 E40 C41	E33-Q37 WeakPolarHBondContact O-CB 3.41Å; E33-Q37 WeakPolarHBondContact O-CG 3.06Å; E33-Q37 PolarHBondContact O-N 3.12Å; T34-Q37 PolarHBondContact O-N 3.42Å; Q37-K39 PolarHBondContact O-N 3.27Å; Q37-E40 PolarHBondContact O-N 3.29Å; Q37-C41 VanDerWaalsContact O-CB 3.29Å; Q37-C41 WeakPolarHBondContact O-CB 3.19Å; Q37-C41 PolarHBondContact O-N 3.32Å
38	E	81.6	Confident	74.5	Confident	117 Å²	117	114 Å²	114	55%	0.547	61%	0.61	S	S	.	*	H	α-helix	trans	-61.8	-43.3	175.1	-75.3	-179.4	172.5	0	0	111.6	T34 E36 E40 C41 V42	T34-E38 WeakPolarHBondContact O-CG 3.39Å; T34-E38 PolarHBondContact O-N 3.33Å; E36-E38 PolarHBondContact O-N 3.45Å; E38-E40 VanDerWaalsContact C-N 3.29Å; E38-E40 PolarHBondContact O-N 2.86Å; E38-C41 PolarHBondContact O-N 2.83Å; E38-V42 WeakPolarHBondContact O-CB 3.36Å; E38-V42 WeakPolarHBondContact O-CG2 3.25Å; E38-V42 PolarHBondContact O-N 2.97Å
39	K	80.1	Confident	74.7	Confident	127 Å²	127	113.6 Å²	113.6	55%	0.552	60%	0.603	S	S	*	*	H	α-helix	trans	-62	-34.6	176.4	-78.2	174.4	-178.9	177.6	0	113	I35 E36 Q37 K43	I35-K39 HydrophobicContact CG2-CD 4.35Å; I35-K39 WeakPolarHBondContact O-CB 3.41Å; I35-K39 VanDerWaalsContact O-CG 3.28Å; I35-K39 WeakPolarHBondContact O-CG 3.29Å; I35-K39 PolarHBondContact O-N 2.9Å; I35-K39 VanDerWaalsContact O-N 3.1Å; E36-K39 WeakPolarHBondContact O-CB 3.49Å; E36-K39 PolarHBondContact O-N 3.04Å; Q37-K39 PolarHBondContact O-N 3.27Å; K39-K43 WeakPolarHBondContact O-CD 3.32Å; K39-K43 WeakPolarHBondContact O-CG 3.32Å
40	E	74.1	Confident	74.5	Confident	141 Å²	141	110.8 Å²	110.8	66%	0.659	59%	0.588	S	S	*	*	H	α-helix	trans	-76.8	-41.5	176.5	-72.8	-172.1	166.5	0	0	112.1	E36 Q37 E38 V42 K43 S44	E36-E40 PolarHBondContact O-N 3.28Å; Q37-E40 PolarHBondContact O-N 3.29Å; E38-E40 VanDerWaalsContact C-N 3.29Å; E38-E40 PolarHBondContact O-N 2.86Å; E40-V42 VanDerWaalsContact C-N 3.34Å; E40-V42 PolarHBondContact O-N 3.45Å; E40-K43 PolarHBondContact O-N 2.94Å; E40-K43 VanDerWaalsContact O-N 3.11Å; E40-S44 PolarHBondContact O-N 3.19Å; E40-S44 PolarHBondContact O-OG 3.4Å
41	C	70.8	Confident	74.1	Confident	81 Å²	81	113.5 Å²	113.5	55%	0.547	60%	0.597	S	S	.	*	H	α-helix	trans	-62.7	-38.6	177.4	-169.2	0	0	0	0	112.3	Q37 E38 K43 S44 S45	Q37-C41 VanDerWaalsContact O-CB 3.29Å; Q37-C41 WeakPolarHBondContact O-CB 3.19Å; Q37-C41 PolarHBondContact O-N 3.32Å; E38-C41 PolarHBondContact O-N 2.83Å; C41-K43 VanDerWaalsContact C-N 3.27Å; C41-K43 PolarHBondContact O-N 3.01Å; C41-S44 PolarHBondContact O-N 2.97Å; C41-S44 PolarHBondContact O-OG 3.49Å; C41-S45 PolarHBondContact O-N 3.36Å; C41-S45 PolarHBondContact O-OG 3.43Å
42	V	65.8	Low	73.6	Confident	110 Å²	110	117.3 Å²	117.3	67%	0.667	61%	0.61	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.8	-23.3	175.5	173.3	0	0	0	0	112.4	E38 E40	E38-V42 WeakPolarHBondContact O-CB 3.36Å; E38-V42 WeakPolarHBondContact O-CG2 3.25Å; E38-V42 PolarHBondContact O-N 2.97Å; E40-V42 VanDerWaalsContact C-N 3.34Å; E40-V42 PolarHBondContact O-N 3.45Å
43	K	59.3	Low	73.1	Confident	169 Å²	169	113 Å²	113	74%	0.735	60%	0.599	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.1	-16.6	178.3	-72.6	173.9	-168.8	-179.1	0	113.6	K39 E40 C41	K39-K43 WeakPolarHBondContact O-CD 3.32Å; K39-K43 WeakPolarHBondContact O-CG 3.32Å; E40-K43 PolarHBondContact O-N 2.94Å; E40-K43 VanDerWaalsContact O-N 3.11Å; C41-K43 VanDerWaalsContact C-N 3.27Å; C41-K43 PolarHBondContact O-N 3.01Å
44	S	57.2	Low	72.4	Confident	100 Å²	100	111.8 Å²	111.8	70%	0.699	60%	0.599	S	S	*	*			trans	-101.6	-1	-179.1	57.2	0	0	0	0	113.9	E40 C41	E40-S44 PolarHBondContact O-N 3.19Å; E40-S44 PolarHBondContact O-OG 3.4Å; C41-S44 PolarHBondContact O-N 2.97Å; C41-S44 PolarHBondContact O-OG 3.49Å
45	S	51.4	Low	71.6	Confident	153 Å²	153	117.3 Å²	117.3	100%	1.07	62%	0.624	S	S	*	*			trans	-98	0	166.1	-57.7	0	0	0	0	110.8	C41	C41-S45 PolarHBondContact O-N 3.36Å; C41-S45 PolarHBondContact O-OG 3.43Å

Retrieved 45 of 45 residues in 58.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).