A0A093J628_STRCA Loading...

Guanine nucleotide-binding protein subunit gamma

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

AlphaFold DB , UniProt , Accession A0A093J628, Species STRCA (Struthio camelus australis), Gene n/a, Length 73 aa.

						>A0A093J628_STRCA|A0A093J628
MSGKTANTTNNIAQARRTVQQLRIEASIERIKVSKASADLMLYCEEHAKKDPLLMGIPASENPFKDKKTCIIL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.4	Very low	61.5	Low	234 Å²	234	111 Å²	111	100%	1.153	65%	0.649	S	S	*	*				0	23	0	-71.5	-67.8	-158.8	0	0	113.7
2	S	54.3	Low	64	Low	108 Å²	108	108.3 Å²	108.3	76%	0.755	63%	0.628	S	S	*	*			trans	-95.3	-4.6	-174.2	-64.2	0	0	0	0	116.8
3	G	55.6	Low	66.1	Low	67 Å²	67	103.2 Å²	103.2	69%	0.691	61%	0.607	S	S	*	*	H	α-helix	trans	-83.1	-19.2	-174.4	0	0	0	0	0	115.9
4	K	53.7	Low	68.1	Low	183 Å²	183	103.7 Å²	103.7	80%	0.796	60%	0.6	S	S	*	*	H	α-helix	trans	-82.7	-30.8	-174.8	-112.7	174.9	177.6	177.1	0	113.3	T8	K4-T8 PolarHBondContact O-N 3.29Å; K4-T8 PolarHBondContact O-OG1 3.07Å; K4-T8 VanDerWaalsContact O-OG1 3.11Å
5	T	55.7	Low	69.8	Low	99 Å²	99	100.4 Å²	100.4	61%	0.607	59%	0.59	S	S	*	*	H	α-helix	trans	-73	-37.2	-174.9	3.2	0	0	0	0	112.8	T8 T9	T5-T8 PolarHBondContact O-N 3.48Å; T5-T9 WeakPolarHBondContact O-CG2 3.18Å; T5-T9 PolarHBondContact O-N 3.19Å; T5-T9 PolarHBondContact O-OG1 3.44Å
6	A	57.1	Low	71.5	Confident	59 Å²	59	104.9 Å²	104.9	49%	0.488	59%	0.594	S	S	.	*	H	α-helix	trans	-69.9	-30.3	179.6	0	0	0	0	0	113.6	T9 N10	A6-T9 PolarHBondContact O-OG1 2.65Å; A6-N10 PolarHBondContact O-N 3.27Å
7	N	59	Low	72.9	Confident	108 Å²	108	108.5 Å²	108.5	58%	0.578	60%	0.596	S	S	*	*	H	α-helix	trans	-76.1	-36	178.3	-129.7	23.7	0	0	0	111.7	N11	N7-N11 PolarHBondContact O-N 3.02Å; N7-N11 PolarHBondContact O-ND2 3.37Å
8	T	62.5	Low	74.2	Confident	79 Å²	79	106.3 Å²	106.3	49%	0.485	59%	0.586	S	S	.	*	H	α-helix	trans	-67.2	-38.9	176.5	-55.4	0	0	0	0	112.1	K4 T5 N11 I12	K4-T8 PolarHBondContact O-N 3.29Å; K4-T8 PolarHBondContact O-OG1 3.07Å; K4-T8 VanDerWaalsContact O-OG1 3.11Å; T5-T8 PolarHBondContact O-N 3.48Å; T8-N11 PolarHBondContact O-N 3.1Å; T8-I12 HydrophobicContact CG2-CD1 4.02Å; T8-I12 WeakPolarHBondContact O-CD1 3.46Å; T8-I12 VanDerWaalsContact O-CG1 3.25Å; T8-I12 WeakPolarHBondContact O-CG1 3.27Å; T8-I12 PolarHBondContact O-N 3.36Å
9	T	66.5	Low	75.4	Confident	82 Å²	82	104.4 Å²	104.4	50%	0.503	58%	0.578	S	S	.	*	H	α-helix	trans	-67.7	-38	177.8	51.6	0	0	0	0	112.8	T5 A6 I12 A13	T5-T9 WeakPolarHBondContact O-CG2 3.18Å; T5-T9 PolarHBondContact O-N 3.19Å; T5-T9 PolarHBondContact O-OG1 3.44Å; A6-T9 PolarHBondContact O-OG1 2.65Å; T9-I12 PolarHBondContact O-N 2.86Å; T9-A13 PolarHBondContact O-N 2.98Å
10	N	75.9	Confident	76.5	Confident	107 Å²	107	105.3 Å²	105.3	57%	0.572	58%	0.577	S	S	*	*	H	α-helix	trans	-63.8	-42	173.6	-81	-22.1	0	0	0	112.2	A6 I12 A13 Q14	A6-N10 PolarHBondContact O-N 3.27Å; N10-I12 VanDerWaalsContact C-N 3.34Å; N10-I12 PolarHBondContact O-N 3.45Å; N10-A13 PolarHBondContact O-N 3.07Å; N10-Q14 PolarHBondContact O-N 3.27Å
11	N	87.1	Confident	77.5	Confident	95 Å²	95	104.9 Å²	104.9	51%	0.508	57%	0.571	S	S	.	*	H	α-helix	trans	-62.9	-39.5	174.6	-78.2	-32.3	0	0	0	112.3	N7 T8 Q14 A15	N7-N11 PolarHBondContact O-N 3.02Å; N7-N11 PolarHBondContact O-ND2 3.37Å; T8-N11 PolarHBondContact O-N 3.1Å; N11-Q14 PolarHBondContact O-N 3.38Å; N11-A15 WeakPolarHBondContact O-CB 3.3Å; N11-A15 PolarHBondContact O-N 3.37Å
12	I	90.9	Very high	79.9	Confident	78 Å²	78	98.3 Å²	98.3	40%	0.4	54%	0.54	S	S	.	.	H	α-helix	trans	-66.1	-42.3	176	-67.8	163.2	0	0	0	111	T8 T9 N10 A15 R16	T8-I12 HydrophobicContact CG2-CD1 4.02Å; T8-I12 WeakPolarHBondContact O-CD1 3.46Å; T8-I12 VanDerWaalsContact O-CG1 3.25Å; T8-I12 WeakPolarHBondContact O-CG1 3.27Å; T8-I12 PolarHBondContact O-N 3.36Å; T9-I12 PolarHBondContact O-N 2.86Å; N10-I12 VanDerWaalsContact C-N 3.34Å; N10-I12 PolarHBondContact O-N 3.45Å; I12-A15 PolarHBondContact O-N 3.01Å; I12-R16 VanDerWaalsContact O-CG 3.29Å; I12-R16 WeakPolarHBondContact O-CG 3.44Å; I12-R16 PolarHBondContact O-N 2.88Å
13	A	91.9	Very high	81.9	Confident	43 Å²	43	101.8 Å²	101.8	36%	0.355	54%	0.537	S	S	.	.	H	α-helix	trans	-64.1	-40	177.3	0	0	0	0	0	112	T9 N10 R17	T9-A13 PolarHBondContact O-N 2.98Å; N10-A13 PolarHBondContact O-N 3.07Å; A13-R17 PolarHBondContact O-N 3.21Å
14	Q	93.4	Very high	84	Confident	110 Å²	110	103.5 Å²	103.5	51%	0.514	53%	0.529	S	S	.	.	H	α-helix	trans	-63.4	-49.1	173	-176.8	177.1	-13.1	0	0	111.7	N10 N11 R16 R17 T18	N10-Q14 PolarHBondContact O-N 3.27Å; N11-Q14 PolarHBondContact O-N 3.38Å; Q14-R16 VanDerWaalsContact C-N 3.28Å; Q14-R16 PolarHBondContact O-N 2.96Å; Q14-R17 WeakPolarHBondContact O-CB 3.49Å; Q14-R17 PolarHBondContact O-N 3.29Å; Q14-R17 VanDerWaalsContact O-N 3.09Å; Q14-T18 PolarHBondContact O-N 3.43Å; Q14-T18 PolarHBondContact O-OG1 3.26Å
15	A	94.3	Very high	86	Confident	54 Å²	54	98.9 Å²	98.9	45%	0.446	51%	0.51	S	S	.	.	H	α-helix	trans	-58.5	-39.8	178.6	0	0	0	0	0	112.1	N11 I12 T18 V19	N11-A15 WeakPolarHBondContact O-CB 3.3Å; N11-A15 PolarHBondContact O-N 3.37Å; I12-A15 PolarHBondContact O-N 3.01Å; A15-T18 PolarHBondContact O-N 3.45Å; A15-V19 WeakPolarHBondContact O-CG2 3.35Å; A15-V19 PolarHBondContact O-N 2.95Å
16	R	95.9	Very high	88	Confident	172 Å²	172	97.6 Å²	97.6	65%	0.649	51%	0.51	S	S	*	.	H	α-helix	trans	-61.1	-45	174.8	-75	174.9	-178.1	-171.5	1	112.3	I12 Q14 V19 Q20	I12-R16 VanDerWaalsContact O-CG 3.29Å; I12-R16 WeakPolarHBondContact O-CG 3.44Å; I12-R16 PolarHBondContact O-N 2.88Å; Q14-R16 VanDerWaalsContact C-N 3.28Å; Q14-R16 PolarHBondContact O-N 2.96Å; R16-V19 PolarHBondContact O-N 3.48Å; R16-Q20 WeakPolarHBondContact O-CG 3.25Å; R16-Q20 PolarHBondContact O-N 2.91Å
17	R	95.8	Very high	89.9	Confident	166 Å²	166	99 Å²	99	63%	0.626	52%	0.517	S	S	*	.	H	α-helix	trans	-61.9	-43.8	176.1	-73.5	-174.4	-71.3	-161.1	0.4	111.6	A13 Q14 V19 Q20 Q21	A13-R17 PolarHBondContact O-N 3.21Å; Q14-R17 WeakPolarHBondContact O-CB 3.49Å; Q14-R17 PolarHBondContact O-N 3.29Å; Q14-R17 VanDerWaalsContact O-N 3.09Å; R17-V19 PolarHBondContact O-N 3.33Å; R17-Q20 WeakPolarHBondContact O-CB 3.49Å; R17-Q20 PolarHBondContact O-N 3.31Å; R17-Q21 PolarHBondContact O-N 3.34Å
18	T	96.4	Very high	91.8	Very high	70 Å²	70	98.6 Å²	98.6	43%	0.429	51%	0.513	S	S	.	.	H	α-helix	trans	-61	-44.8	175.9	-57.7	0	0	0	0	111.7	Q14 A15 Q20 Q21 L22	Q14-T18 PolarHBondContact O-N 3.43Å; Q14-T18 PolarHBondContact O-OG1 3.26Å; A15-T18 PolarHBondContact O-N 3.45Å; T18-Q20 VanDerWaalsContact C-N 3.32Å; T18-Q20 PolarHBondContact O-N 2.94Å; T18-Q21 WeakPolarHBondContact O-CB 3.45Å; T18-Q21 PolarHBondContact O-N 3.17Å; T18-L22 HydrophobicContact CG2-CD1 3.98Å; T18-L22 HydrophobicContact CG2-CG 4.32Å; T18-L22 VanDerWaalsContact O-CG 3.3Å; T18-L22 WeakPolarHBondContact O-CG 3.46Å; T18-L22 PolarHBondContact O-N 3.3Å
19	V	97.6	Very high	93.4	Very high	69 Å²	69	103.9 Å²	103.9	42%	0.418	53%	0.532	S	S	.	.	H	α-helix	trans	-63.3	-39.6	177.1	170.1	0	0	0	0	111.5	A15 R16 R17 Q21 L22 R23	A15-V19 WeakPolarHBondContact O-CG2 3.35Å; A15-V19 PolarHBondContact O-N 2.95Å; R16-V19 PolarHBondContact O-N 3.48Å; R17-V19 PolarHBondContact O-N 3.33Å; V19-Q21 VanDerWaalsContact C-N 3.35Å; V19-L22 PolarHBondContact O-N 2.96Å; V19-R23 VanDerWaalsContact O-CG 3.27Å; V19-R23 WeakPolarHBondContact O-CG 3.37Å; V19-R23 PolarHBondContact O-N 3.1Å
20	Q	97.5	Very high	94.9	Very high	123 Å²	123	109.2 Å²	109.2	58%	0.575	54%	0.543	S	S	*	.	H	α-helix	trans	-60.9	-44.8	174.4	-74.8	175	-35.7	0	0	111.4	R16 R17 T18 R23 I24	R16-Q20 WeakPolarHBondContact O-CG 3.25Å; R16-Q20 PolarHBondContact O-N 2.91Å; R17-Q20 WeakPolarHBondContact O-CB 3.49Å; R17-Q20 PolarHBondContact O-N 3.31Å; T18-Q20 VanDerWaalsContact C-N 3.32Å; T18-Q20 PolarHBondContact O-N 2.94Å; Q20-R23 PolarHBondContact O-N 3.07Å; Q20-I24 WeakPolarHBondContact O-CG1 3.36Å; Q20-I24 PolarHBondContact O-N 3.3Å
21	Q	97.6	Very high	96	Very high	96 Å²	96	109.2 Å²	109.2	45%	0.449	54%	0.542	S	S	.	.	H	α-helix	trans	-61.6	-48.3	176.3	-177.4	60.7	24.5	0	0	112	R17 T18 V19 R23 I24 E25	R17-Q21 PolarHBondContact O-N 3.34Å; T18-Q21 WeakPolarHBondContact O-CB 3.45Å; T18-Q21 PolarHBondContact O-N 3.17Å; V19-Q21 VanDerWaalsContact C-N 3.35Å; Q21-R23 VanDerWaalsContact C-N 3.26Å; Q21-R23 PolarHBondContact O-N 2.85Å; Q21-I24 WeakPolarHBondContact O-CB 3.5Å; Q21-I24 PolarHBondContact O-N 3.28Å; Q21-E25 WeakPolarHBondContact CG-OE1 3.29Å; Q21-E25 PolarHBondContact NE2-OE1 2.91Å; Q21-E25 PolarHBondContact O-N 3.18Å
22	L	98.1	Very high	96.5	Very high	96 Å²	96	112.3 Å²	112.3	50%	0.503	55%	0.551	S	S	.	*	H	α-helix	trans	-61.7	-34.4	179.7	-70.5	172.9	0	0	0	112.4	T18 V19 I24 E25 A26	T18-L22 HydrophobicContact CG2-CD1 3.98Å; T18-L22 HydrophobicContact CG2-CG 4.32Å; T18-L22 VanDerWaalsContact O-CG 3.3Å; T18-L22 WeakPolarHBondContact O-CG 3.46Å; T18-L22 PolarHBondContact O-N 3.3Å; V19-L22 PolarHBondContact O-N 2.96Å; L22-I24 VanDerWaalsContact C-N 3.35Å; L22-E25 PolarHBondContact O-N 3.1Å; L22-A26 WeakPolarHBondContact O-CB 3.48Å; L22-A26 PolarHBondContact O-N 3.42Å
23	R	98.1	Very high	96.8	Very high	182 Å²	182	114 Å²	114	69%	0.687	57%	0.565	S	S	*	*	H	α-helix	trans	-63.8	-40.8	174.4	-75.8	172.4	177.7	-161.2	-1.5	111.9	V19 Q20 Q21 S27	V19-R23 VanDerWaalsContact O-CG 3.27Å; V19-R23 WeakPolarHBondContact O-CG 3.37Å; V19-R23 PolarHBondContact O-N 3.1Å; Q20-R23 PolarHBondContact O-N 3.07Å; Q21-R23 VanDerWaalsContact C-N 3.26Å; Q21-R23 PolarHBondContact O-N 2.85Å; R23-S27 PolarHBondContact O-N 2.91Å
24	I	97.8	Very high	97.1	Very high	102 Å²	102	116.1 Å²	116.1	52%	0.523	58%	0.577	S	S	.	*	H	α-helix	trans	-64.6	-49.4	176.1	-63.6	165.5	0	0	0	109.5	Q20 Q21 L22 A26 S27	Q20-I24 WeakPolarHBondContact O-CG1 3.36Å; Q20-I24 PolarHBondContact O-N 3.3Å; Q21-I24 WeakPolarHBondContact O-CB 3.5Å; Q21-I24 PolarHBondContact O-N 3.28Å; L22-I24 VanDerWaalsContact C-N 3.35Å; I24-A26 VanDerWaalsContact C-N 3.31Å; I24-A26 PolarHBondContact O-N 3.22Å; I24-S27 PolarHBondContact O-N 3Å; I24-S27 PolarHBondContact O-OG 3.24Å
25	E	97.3	Very high	97.4	Very high	86 Å²	86	116.5 Å²	116.5	40%	0.402	58%	0.577	S	S	.	*	H	α-helix	trans	-64.6	-33.9	-179.5	-70	174.5	-166.9	0	0	113.3	Q21 L22 S27 I28	Q21-E25 WeakPolarHBondContact CG-OE1 3.29Å; Q21-E25 PolarHBondContact NE2-OE1 2.91Å; Q21-E25 PolarHBondContact O-N 3.18Å; L22-E25 PolarHBondContact O-N 3.1Å; E25-S27 VanDerWaalsContact C-N 3.28Å; E25-S27 PolarHBondContact O-N 2.79Å; E25-I28 WeakPolarHBondContact O-CB 3.49Å; E25-I28 PolarHBondContact O-N 2.96Å
26	A	97.4	Very high	97.6	Very high	73 Å²	73	115.5 Å²	115.5	60%	0.603	57%	0.568	S	S	*	*	H	α-helix	trans	-67.9	-29.5	174.7	0	0	0	0	0	112.4	L22 I24 I28	L22-A26 WeakPolarHBondContact O-CB 3.48Å; L22-A26 PolarHBondContact O-N 3.42Å; I24-A26 VanDerWaalsContact C-N 3.31Å; I24-A26 PolarHBondContact O-N 3.22Å; A26-I28 VanDerWaalsContact C-N 3.26Å; A26-I28 PolarHBondContact O-N 3.43Å
27	S	97.4	Very high	97.7	Very high	89 Å²	89	109.9 Å²	109.9	62%	0.622	56%	0.556	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.1	-3.6	178	71	0	0	0	0	114.4	R23 I24 E25 E29	R23-S27 PolarHBondContact O-N 2.91Å; I24-S27 PolarHBondContact O-N 3Å; I24-S27 PolarHBondContact O-OG 3.24Å; E25-S27 VanDerWaalsContact C-N 3.28Å; E25-S27 PolarHBondContact O-N 2.79Å; S27-E29 PolarHBondContact O-N 3.37Å
28	I	97.6	Very high	97.8	Very high	99 Å²	99	104.1 Å²	104.1	51%	0.508	54%	0.543	S	S	.	.	P	Polyproline II helix	trans	-71.5	117.9	176.6	-59.4	174.1	0	0	0	109.4	E25 A26 R30	E25-I28 WeakPolarHBondContact O-CB 3.49Å; E25-I28 PolarHBondContact O-N 2.96Å; A26-I28 VanDerWaalsContact C-N 3.26Å; A26-I28 PolarHBondContact O-N 3.43Å; I28-R30 PolarHBondContact O-N 2.9Å
29	E	97.7	Very high	97.9	Very high	190 Å²	190	104.5 Å²	104.5	89%	0.888	54%	0.543	S	S	*	.	P	Polyproline II helix	trans	-67	124.3	172.1	-68.4	-172.1	178.1	0	0	110.5	S27	S27-E29 PolarHBondContact O-N 3.37Å
30	R	97.4	Very high	97.9	Very high	193 Å²	193	106.8 Å²	106.8	73%	0.728	55%	0.552	S	S	*	*	P	Polyproline II helix	trans	-101.5	142.2	178.7	-64.1	-178.5	-175.1	76.1	2.1	110.4	I28	I28-R30 PolarHBondContact O-N 2.9Å
31	I	97.8	Very high	97.9	Very high	107 Å²	107	106.4 Å²	106.4	55%	0.549	55%	0.551	S	S	.	*	P	Polyproline II helix	trans	-84.5	159	166.8	62.6	171.4	0	0	0	110.7	A36	I31-A36 HydrophobicContact CD1-CB 3.81Å; I31-A36 HydrophobicContact CG1-CB 4.31Å
32	K	98.3	Very high	97.9	Very high	161 Å²	161	106.8 Å²	106.8	70%	0.7	56%	0.556	S	S	*	*	P	Polyproline II helix	trans	-62.4	137.9	174	-67.7	-176.9	-179.9	178.4	0	110	S34 K35 A36	K32-S34 PolarHBondContact O-N 3.33Å; K32-K35 HydrophobicContact CB-CB 4.44Å; K32-K35 WeakPolarHBondContact O-CB 3.49Å; K32-K35 PolarHBondContact O-N 3.03Å; K32-A36 PolarHBondContact O-N 3.09Å; K32-A36 VanDerWaalsContact O-N 3.1Å
33	V	98.3	Very high	97.9	Very high	114 Å²	114	109 Å²	109	69%	0.691	56%	0.559	S	S	*	*	H	α-helix	trans	-55.9	-41.6	176	178.5	0	0	0	0	110.9	K35 A36 S37	V33-K35 VanDerWaalsContact C-N 3.27Å; V33-K35 PolarHBondContact O-N 3.44Å; V33-A36 PolarHBondContact O-N 3.47Å; V33-S37 WeakPolarHBondContact O-CB 3.48Å; V33-S37 PolarHBondContact O-N 3.11Å; V33-S37 PolarHBondContact O-OG 3.42Å; V33-S37 VanDerWaalsContact O-OG 3.07Å
34	S	98.3	Very high	97.9	Very high	86 Å²	86	104.1 Å²	104.1	60%	0.601	55%	0.552	S	S	*	*	H	α-helix	trans	-58.6	-36.8	177.3	56.2	0	0	0	0	113.6	K32 A38	K32-S34 PolarHBondContact O-N 3.33Å; S34-A38 WeakPolarHBondContact O-CB 3.3Å; S34-A38 PolarHBondContact O-N 2.94Å; S34-A38 VanDerWaalsContact O-N 3.1Å
35	K	98.2	Very high	97.8	Very high	119 Å²	119	105 Å²	105	52%	0.517	55%	0.554	S	S	.	*	H	α-helix	trans	-69.1	-50	175.3	-177.4	-179.2	176	-177.1	0	110.5	K32 V33 S37 A38 D39	K32-K35 HydrophobicContact CB-CB 4.44Å; K32-K35 WeakPolarHBondContact O-CB 3.49Å; K32-K35 PolarHBondContact O-N 3.03Å; V33-K35 VanDerWaalsContact C-N 3.27Å; V33-K35 PolarHBondContact O-N 3.44Å; K35-S37 VanDerWaalsContact C-N 3.26Å; K35-S37 PolarHBondContact O-N 2.95Å; K35-A38 PolarHBondContact O-N 3.38Å; K35-A38 VanDerWaalsContact O-N 3.1Å; K35-D39 VanDerWaalsContact O-CG 3.28Å; K35-D39 PolarHBondContact O-N 2.95Å
36	A	98.3	Very high	97.7	Very high	32 Å²	32	107.2 Å²	107.2	26%	0.264	56%	0.564	S	S	.	*	H	α-helix	trans	-56.9	-41.5	178.1	0	0	0	0	0	111.9	I31 K32 V33 D39 L40	I31-A36 HydrophobicContact CD1-CB 3.81Å; I31-A36 HydrophobicContact CG1-CB 4.31Å; K32-A36 PolarHBondContact O-N 3.09Å; K32-A36 VanDerWaalsContact O-N 3.1Å; V33-A36 PolarHBondContact O-N 3.47Å; A36-D39 PolarHBondContact O-N 3.37Å; A36-L40 VanDerWaalsContact O-CG 3.3Å; A36-L40 WeakPolarHBondContact O-CG 3.34Å; A36-L40 PolarHBondContact O-N 3.27Å
37	S	98.3	Very high	97.7	Very high	55 Å²	55	106.9 Å²	106.9	39%	0.385	55%	0.55	S	S	.	.	H	α-helix	trans	-63.5	-43.5	175.8	-61.5	0	0	0	0	112.3	V33 K35 L40 M41	V33-S37 WeakPolarHBondContact O-CB 3.48Å; V33-S37 PolarHBondContact O-N 3.11Å; V33-S37 PolarHBondContact O-OG 3.42Å; V33-S37 VanDerWaalsContact O-OG 3.07Å; K35-S37 VanDerWaalsContact C-N 3.26Å; K35-S37 PolarHBondContact O-N 2.95Å; S37-L40 PolarHBondContact O-N 3.4Å; S37-M41 VanDerWaalsContact O-CG 3.3Å; S37-M41 WeakPolarHBondContact O-CG 3.3Å; S37-M41 PolarHBondContact O-N 3.17Å
38	A	98.3	Very high	97.5	Very high	44 Å²	44	103.8 Å²	103.8	36%	0.364	53%	0.53	S	S	.	.	H	α-helix	trans	-63.1	-43.5	176.4	0	0	0	0	0	111.8	S34 K35 L40 M41 L42	S34-A38 WeakPolarHBondContact O-CB 3.3Å; S34-A38 PolarHBondContact O-N 2.94Å; S34-A38 VanDerWaalsContact O-N 3.1Å; K35-A38 PolarHBondContact O-N 3.38Å; K35-A38 VanDerWaalsContact O-N 3.1Å; A38-L40 VanDerWaalsContact C-N 3.32Å; A38-L40 PolarHBondContact O-N 3.27Å; A38-M41 PolarHBondContact O-N 3.49Å; A38-L42 WeakPolarHBondContact O-CB 3.37Å; A38-L42 WeakPolarHBondContact O-CG 3.45Å; A38-L42 PolarHBondContact O-N 3.47Å
39	D	98.1	Very high	97.2	Very high	78 Å²	78	107.4 Å²	107.4	42%	0.417	54%	0.542	S	S	.	.	H	α-helix	trans	-61.4	-41.4	177.8	-64.5	-17.9	0	0	0	111	K35 A36 Y43	K35-D39 VanDerWaalsContact O-CG 3.28Å; K35-D39 PolarHBondContact O-N 2.95Å; A36-D39 PolarHBondContact O-N 3.37Å; D39-Y43 WeakPolarHBondContact O-CB 3.5Å; D39-Y43 PolarHBondContact O-N 3.21Å
40	L	98.3	Very high	96.9	Very high	118 Å²	118	105.6 Å²	105.6	62%	0.618	53%	0.531	S	S	*	.	H	α-helix	trans	-64.6	-43.4	174.6	-72.3	173.2	0	0	0	112.4	A36 S37 A38 Y43 C44	A36-L40 VanDerWaalsContact O-CG 3.3Å; A36-L40 WeakPolarHBondContact O-CG 3.34Å; A36-L40 PolarHBondContact O-N 3.27Å; S37-L40 PolarHBondContact O-N 3.4Å; A38-L40 VanDerWaalsContact C-N 3.32Å; A38-L40 PolarHBondContact O-N 3.27Å; L40-Y43 PolarHBondContact O-N 3.32Å; L40-C44 PolarHBondContact O-N 3.41Å; L40-C44 PolarHBondContact O-SG 3.42Å
41	M	97.6	Very high	96.8	Very high	114 Å²	114	99.7 Å²	99.7	56%	0.562	51%	0.514	S	S	*	.	H	α-helix	trans	-61.4	-47.6	177.4	-73.3	177.3	67.9	0	0	111.2	S37 A38 Y43 C44 E45	S37-M41 VanDerWaalsContact O-CG 3.3Å; S37-M41 WeakPolarHBondContact O-CG 3.3Å; S37-M41 PolarHBondContact O-N 3.17Å; A38-M41 PolarHBondContact O-N 3.49Å; M41-Y43 VanDerWaalsContact C-N 3.33Å; M41-Y43 PolarHBondContact O-N 3.03Å; M41-C44 PolarHBondContact O-N 3.05Å; M41-E45 WeakPolarHBondContact O-CG 3.19Å; M41-E45 PolarHBondContact O-N 2.98Å
42	L	98	Very high	96.5	Very high	105 Å²	105	97.6 Å²	97.6	55%	0.55	51%	0.507	S	S	.	.	H	α-helix	trans	-57.8	-46.2	177.7	-75	169.6	0	0	0	111.7	A38 C44 E45 E46	A38-L42 WeakPolarHBondContact O-CB 3.37Å; A38-L42 WeakPolarHBondContact O-CG 3.45Å; A38-L42 PolarHBondContact O-N 3.47Å; L42-C44 VanDerWaalsContact C-N 3.35Å; L42-C44 PolarHBondContact O-N 3.3Å; L42-E45 PolarHBondContact O-N 3.45Å; L42-E46 WeakPolarHBondContact O-CB 3.4Å; L42-E46 PolarHBondContact O-N 2.88Å
43	Y	97.9	Very high	96.2	Very high	142 Å²	142	97.9 Å²	97.9	56%	0.557	52%	0.515	S	S	*	.	H	α-helix	trans	-59.5	-46.6	177.5	180	-94.4	0	0	0	111.8	D39 L40 M41 E46 H47	D39-Y43 WeakPolarHBondContact O-CB 3.5Å; D39-Y43 PolarHBondContact O-N 3.21Å; L40-Y43 PolarHBondContact O-N 3.32Å; M41-Y43 VanDerWaalsContact C-N 3.33Å; M41-Y43 PolarHBondContact O-N 3.03Å; Y43-E46 PolarHBondContact O-N 3.5Å; Y43-H47 AromaticContact CD2-CE1 3.82Å; Y43-H47 AromaticContact CD2-ND1 3.8Å; Y43-H47 AromaticContact CE2-CE1 3.53Å; Y43-H47 AromaticContact CE2-ND1 3.7Å; Y43-H47 AromaticContact CZ-ND1 3.98Å; Y43-H47 PolarHBondContact O-N 2.77Å; Y43-H47 PolarHBondContact O-ND1 3.45Å
44	C	97.3	Very high	96	Very high	80 Å²	80	97.9 Å²	97.9	54%	0.541	51%	0.511	S	S	.	.	H	α-helix	trans	-62	-44.3	177.3	-71.7	0	0	0	0	111.8	L40 M41 L42 H47 A48	L40-C44 PolarHBondContact O-N 3.41Å; L40-C44 PolarHBondContact O-SG 3.42Å; M41-C44 PolarHBondContact O-N 3.05Å; L42-C44 VanDerWaalsContact C-N 3.35Å; L42-C44 PolarHBondContact O-N 3.3Å; C44-H47 PolarHBondContact O-N 2.89Å; C44-A48 WeakPolarHBondContact O-CA 3.49Å; C44-A48 WeakPolarHBondContact O-CB 3.36Å; C44-A48 PolarHBondContact O-N 3.36Å
45	E	95.6	Very high	95.7	Very high	120 Å²	120	99.6 Å²	99.6	56%	0.561	51%	0.511	S	S	*	.	H	α-helix	trans	-64.7	-40.9	180	-73.7	174.3	-175	0	0	112.7	M41 L42 H47	M41-E45 WeakPolarHBondContact O-CG 3.19Å; M41-E45 PolarHBondContact O-N 2.98Å; L42-E45 PolarHBondContact O-N 3.45Å; E45-H47 VanDerWaalsContact C-N 3.3Å; E45-H47 PolarHBondContact O-N 3.19Å
46	E	96.8	Very high	95.2	Very high	132 Å²	132	96.2 Å²	96.2	62%	0.617	51%	0.51	S	S	*	.	H	α-helix	trans	-64.4	-37.1	178.1	-171.7	-178.1	171	0	0	111.9	L42 Y43	L42-E46 WeakPolarHBondContact O-CB 3.4Å; L42-E46 PolarHBondContact O-N 2.88Å; Y43-E46 PolarHBondContact O-N 3.5Å
47	H	95.9	Very high	94.7	Very high	66 Å²	66	97.9 Å²	97.9	31%	0.306	51%	0.514	S	S	.	.	H	α-helix	trans	-95.1	-16.3	-175.9	-66.2	78.6	0	0	0	113.6	Y43 C44 E45 K49 K50 D51	Y43-H47 AromaticContact CD2-CE1 3.82Å; Y43-H47 AromaticContact CD2-ND1 3.8Å; Y43-H47 AromaticContact CE2-CE1 3.53Å; Y43-H47 AromaticContact CE2-ND1 3.7Å; Y43-H47 AromaticContact CZ-ND1 3.98Å; Y43-H47 PolarHBondContact O-N 2.77Å; Y43-H47 PolarHBondContact O-ND1 3.45Å; C44-H47 PolarHBondContact O-N 2.89Å; E45-H47 VanDerWaalsContact C-N 3.3Å; E45-H47 PolarHBondContact O-N 3.19Å; H47-K49 PolarHBondContact O-N 3.2Å; H47-K49 VanDerWaalsContact O-N 3.16Å; H47-K50 PolarHBondContact O-N 2.93Å; H47-D51 PolarHBondContact O-N 3.23Å
48	A	94.7	Very high	94.3	Very high	25 Å²	25	98.6 Å²	98.6	21%	0.207	52%	0.517	C	S	.	.	H	α-helix	trans	-50.6	-44.1	-178.9	0	0	0	0	0	112.3	C44 K50 D51 L54 M55	C44-A48 WeakPolarHBondContact O-CA 3.49Å; C44-A48 WeakPolarHBondContact O-CB 3.36Å; C44-A48 PolarHBondContact O-N 3.36Å; A48-K50 PolarHBondContact O-N 3.16Å; A48-D51 PolarHBondContact O-N 3.24Å; A48-L54 HydrophobicContact CB-CD2 3.56Å; A48-M55 VanDerWaalsContact O-CG 3.29Å; A48-M55 WeakPolarHBondContact O-CG 3.29Å
49	K	91.1	Very high	93.6	Very high	174 Å²	174	99 Å²	99	76%	0.757	52%	0.52	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.1	-23.8	-178.1	-67.4	-178.5	-177.4	174.7	0	113.9	H47	H47-K49 PolarHBondContact O-N 3.2Å; H47-K49 VanDerWaalsContact O-N 3.16Å
50	K	91.5	Very high	92.9	Very high	153 Å²	153	100 Å²	100	67%	0.665	53%	0.533	S	S	*	.	T	Hydrogen-bonded Turn	trans	-95.7	-8	-178.4	-62.8	175	-174.4	165	0	112	H47 A48 P52	H47-K50 PolarHBondContact O-N 2.93Å; A48-K50 PolarHBondContact O-N 3.16Å; K50-P52 WeakPolarHBondContact O-CD 3.37Å
51	D	94.7	Very high	92.3	Very high	68 Å²	68	100.5 Å²	100.5	36%	0.364	53%	0.532	S	S	.	.			trans	-81	111.4	179.3	-171.9	-26.2	0	0	0	109.9	H47 A48 L53 L54 M55	H47-D51 PolarHBondContact O-N 3.23Å; A48-D51 PolarHBondContact O-N 3.24Å; D51-L53 PolarHBondContact O-N 3.08Å; D51-L53 WeakPolarHBondContact OD1-CB 3.2Å; D51-L53 PolarHBondContact OD1-N 3.02Å; D51-L54 HydrophobicContact CB-CB 3.94Å; D51-L54 PolarHBondContact O-N 3.44Å; D51-L54 PolarHBondContact OD1-N 3.2Å; D51-M55 PolarHBondContact O-N 2.84Å
52	P	92.1	Very high	91.9	Very high	63 Å²	63	97.8 Å²	97.8	41%	0.409	52%	0.52	S	S	.	.	H	α-helix	trans	-61.9	-26.4	179.5	-26	39.4	0	0	0	113.9	K50 G56 I57	K50-P52 WeakPolarHBondContact O-CD 3.37Å; P52-G56 CarbonylContact O-C 3.51Å; P52-G56 WeakPolarHBondContact O-CA 3.1Å; P52-G56 PolarHBondContact O-N 3.24Å; P52-G56 VanDerWaalsContact O-N 3.08Å; P52-I57 HydrophobicContact CB-CD1 4.2Å; P52-I57 HydrophobicContact CB-CG1 4.26Å; P52-I57 HydrophobicContact CB-CG2 3.57Å; P52-I57 HydrophobicContact CG-CG2 4.11Å
53	L	91.8	Very high	91.5	Very high	167 Å²	167	98.1 Å²	98.1	87%	0.874	53%	0.529	S	S	*	.	H	α-helix	trans	-82.1	-24.9	-178.7	-58.8	179.2	0	0	0	111.7	D51	D51-L53 PolarHBondContact O-N 3.08Å; D51-L53 WeakPolarHBondContact OD1-CB 3.2Å; D51-L53 PolarHBondContact OD1-N 3.02Å
54	L	93	Very high	90.9	Very high	115 Å²	115	100 Å²	100	60%	0.602	54%	0.54	S	S	*	.	H	α-helix	trans	-89.3	-49.3	178.4	-171.9	62.7	0	0	0	112.3	A48 D51	A48-L54 HydrophobicContact CB-CD2 3.56Å; D51-L54 HydrophobicContact CB-CB 3.94Å; D51-L54 PolarHBondContact O-N 3.44Å; D51-L54 PolarHBondContact OD1-N 3.2Å
55	M	91.8	Very high	90.2	Very high	122 Å²	122	100.9 Å²	100.9	60%	0.601	54%	0.535	S	S	*	.	H	α-helix	trans	-88.7	-17.5	-177.8	-64.8	-59.1	-62.9	0	0	113.5	A48 D51	A48-M55 VanDerWaalsContact O-CG 3.29Å; A48-M55 WeakPolarHBondContact O-CG 3.29Å; D51-M55 PolarHBondContact O-N 2.84Å
56	G	87.6	Confident	89.4	Confident	47 Å²	47	102 Å²	102	49%	0.485	55%	0.545	S	S	.	.			trans	76.4	155.9	-166.5	0	0	0	0	0	111.8	P52	P52-G56 CarbonylContact O-C 3.51Å; P52-G56 WeakPolarHBondContact O-CA 3.1Å; P52-G56 PolarHBondContact O-N 3.24Å; P52-G56 VanDerWaalsContact O-N 3.08Å
57	I	89.4	Confident	88.4	Confident	68 Å²	68	105.2 Å²	105.2	35%	0.349	56%	0.556	S	S	.	*			trans	-124.5	152	172.7	50.5	171.4	0	0	0	110.5	P52 N62	P52-I57 HydrophobicContact CB-CD1 4.2Å; P52-I57 HydrophobicContact CB-CG1 4.26Å; P52-I57 HydrophobicContact CB-CG2 3.57Å; P52-I57 HydrophobicContact CG-CG2 4.11Å; I57-N62 HydrophobicContact CD1-CB 3.86Å; I57-N62 HydrophobicContact CG1-CB 4.23Å
58	P	87.9	Confident	87.1	Confident	69 Å²	69	111.3 Å²	111.3	45%	0.448	58%	0.582	S	S	.	*			trans	-55.7	145.2	172.3	-23.4	33.5	0	0	0	111.4	S60 E61 N62	P58-S60 PolarHBondContact O-N 2.92Å; P58-E61 PolarHBondContact O-N 3.13Å; P58-N62 PolarHBondContact O-N 2.96Å; P58-N62 VanDerWaalsContact O-N 3.13Å
59	A	83.9	Confident	85.6	Confident	53 Å²	53	116 Å²	116	44%	0.438	61%	0.608	S	S	.	*	T	Hydrogen-bonded Turn	trans	-60.8	-17.1	179.2	0	0	0	0	0	113.3	K65	A59-K65 HydrophobicContact CB-CD 4.38Å; A59-K65 HydrophobicContact CB-CG 4.17Å; A59-K65 VanDerWaalsContact O-CB 3.28Å; A59-K65 WeakPolarHBondContact O-CB 3.14Å; A59-K65 WeakPolarHBondContact O-CD 2.99Å; A59-K65 VanDerWaalsContact O-CE 3.29Å; A59-K65 WeakPolarHBondContact O-CE 3.12Å; A59-K65 WeakPolarHBondContact O-CG 3.29Å; A59-K65 PolarHBondContact O-NZ 3Å
60	S	84.6	Confident	84.3	Confident	98 Å²	98	113.2 Å²	113.2	69%	0.685	61%	0.609	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.6	-31.6	173.6	45.6	0	0	0	0	113.3	P58	P58-S60 PolarHBondContact O-N 2.92Å
61	E	86	Confident	83.1	Confident	129 Å²	129	112.2 Å²	112.2	60%	0.603	61%	0.61	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.2	-20.2	-179.3	-67.3	177.5	-156	0	0	111.7	P58 P63	P58-E61 PolarHBondContact O-N 3.13Å; E61-P63 WeakPolarHBondContact O-CD 3.28Å
62	N	89.2	Confident	81.5	Confident	57 Å²	57	116.3 Å²	116.3	31%	0.305	63%	0.63	S	S	.	*			trans	-67.2	112.6	176.5	-175.3	-0	0	0	0	111.4	I57 P58 F64 K65	I57-N62 HydrophobicContact CD1-CB 3.86Å; I57-N62 HydrophobicContact CG1-CB 4.23Å; P58-N62 PolarHBondContact O-N 2.96Å; P58-N62 VanDerWaalsContact O-N 3.13Å; N62-F64 PolarHBondContact O-N 3.08Å; N62-F64 VanDerWaalsContact O-N 3.16Å; N62-F64 WeakPolarHBondContact OD1-CB 3.45Å; N62-F64 PolarHBondContact OD1-N 2.91Å; N62-K65 HydrophobicContact CB-CB 4.4Å; N62-K65 WeakPolarHBondContact O-CB 3.33Å; N62-K65 PolarHBondContact O-N 3.16Å; N62-K65 VanDerWaalsContact O-N 3.08Å
63	P	87.9	Confident	80	Confident	112 Å²	112	124.2 Å²	124.2	73%	0.727	67%	0.668	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64	-21	178.1	-20.2	34.5	0	0	0	113.2	E61	E61-P63 WeakPolarHBondContact O-CD 3.28Å
64	F	86.9	Confident	79.4	Confident	182 Å²	182	122.1 Å²	122.1	80%	0.798	66%	0.657	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.8	11.5	179	-56.5	-79.4	0	0	0	113.2	N62	N62-F64 PolarHBondContact O-N 3.08Å; N62-F64 VanDerWaalsContact O-N 3.16Å; N62-F64 WeakPolarHBondContact OD1-CB 3.45Å; N62-F64 PolarHBondContact OD1-N 2.91Å
65	K	82.4	Confident	78.6	Confident	99 Å²	99	122.4 Å²	122.4	43%	0.43	66%	0.66	S	S	.	*	S	Bend	trans	-62.4	138.4	174.7	-166.5	-143	-155.8	123.6	0	110.6	A59 N62 K67	A59-K65 HydrophobicContact CB-CD 4.38Å; A59-K65 HydrophobicContact CB-CG 4.17Å; A59-K65 VanDerWaalsContact O-CB 3.28Å; A59-K65 WeakPolarHBondContact O-CB 3.14Å; A59-K65 WeakPolarHBondContact O-CD 2.99Å; A59-K65 VanDerWaalsContact O-CE 3.29Å; A59-K65 WeakPolarHBondContact O-CE 3.12Å; A59-K65 WeakPolarHBondContact O-CG 3.29Å; A59-K65 PolarHBondContact O-NZ 3Å; N62-K65 HydrophobicContact CB-CB 4.4Å; N62-K65 WeakPolarHBondContact O-CB 3.33Å; N62-K65 PolarHBondContact O-N 3.16Å; N62-K65 VanDerWaalsContact O-N 3.08Å; K65-K67 PolarHBondContact O-N 3.23Å
66	D	79	Confident	77.9	Confident	144 Å²	144	122.4 Å²	122.4	77%	0.77	66%	0.664	S	S	*	*	P	Polyproline II helix	trans	-52.9	125.6	170.2	-69.2	-43.5	0	0	0	111.1	K68	D66-K68 PolarHBondContact O-N 3.13Å
67	K	74.6	Confident	77.3	Confident	198 Å²	198	126.9 Å²	126.9	86%	0.861	67%	0.674	S	S	*	*	P	Polyproline II helix	trans	-68.8	116.1	170.8	-67.1	-179.2	176.2	177.1	0	107.1	K65 T69	K65-K67 PolarHBondContact O-N 3.23Å; K67-T69 PolarHBondContact O-N 3.22Å; K67-T69 VanDerWaalsContact O-N 3.13Å
68	K	68.9	Low	76.6	Confident	195 Å²	195	130.6 Å²	130.6	85%	0.848	69%	0.694	S	S	*	*	P	Polyproline II helix	trans	-56.9	122.2	165.9	-68.9	-168.1	176.9	-172.7	0	107.2	D66 C70	D66-K68 PolarHBondContact O-N 3.13Å; K68-C70 PolarHBondContact O-N 3.09Å; K68-C70 VanDerWaalsContact O-N 3.13Å
69	T	63.9	Low	75.8	Confident	123 Å²	123	134.7 Å²	134.7	76%	0.755	71%	0.711	S	S	*	*	P	Polyproline II helix	trans	-60.4	117.3	170.6	46.5	0	0	0	0	107.1	K67 I71	K67-T69 PolarHBondContact O-N 3.22Å; K67-T69 VanDerWaalsContact O-N 3.13Å; T69-I71 PolarHBondContact O-N 3.13Å; T69-I71 VanDerWaalsContact O-N 3.09Å
70	C	63.4	Low	75.3	Confident	115 Å²	115	140.5 Å²	140.5	78%	0.777	73%	0.73	S	S	*	*			trans	-67.4	108.9	171.3	-173.1	0	0	0	0	106.7	K68 I72	K68-C70 PolarHBondContact O-N 3.09Å; K68-C70 VanDerWaalsContact O-N 3.13Å; C70-I72 PolarHBondContact O-N 3.24Å
71	I	65.3	Low	74.5	Confident	133 Å²	133	143.8 Å²	143.8	68%	0.682	73%	0.734	S	S	*	*			trans	-82.4	104.9	165.9	-50.4	175.4	0	0	0	104.9	T69 L73	T69-I71 PolarHBondContact O-N 3.13Å; T69-I71 VanDerWaalsContact O-N 3.09Å; I71-L73 PolarHBondContact O-N 3.38Å
72	I	62.8	Low	73.6	Confident	154 Å²	154	145 Å²	145	79%	0.79	75%	0.745	S	S	*	*			trans	-68.5	112.8	166.4	-57.3	177.8	0	0	0	105.5	C70	C70-I72 PolarHBondContact O-N 3.24Å
73	L	58.6	Low	72.2	Confident	228 Å²	228	153 Å²	153	100%	1.194	79%	0.785	S	S	*	*			trans	-89	0	170.1	-79.7	160.9	0	0	0	109.7	I71	I71-L73 PolarHBondContact O-N 3.38Å

Retrieved 73 of 73 residues in 119.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).