A0A093JI13_STRCA Loading...

U6 snRNA-associated Sm-like protein LSm3

Binds specifically to the 3'-terminal U-tract of U6 snRNA. Plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.

AlphaFold DB , UniProt , Accession A0A093JI13, Species STRCA (Struthio camelus australis), Gene LSM3, Length 96 aa.

						>A0A093JI13_STRCA|A0A093JI13|LSM3
QQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	Q	41.1	Very low	67.8	Low	249 Å²	249	136 Å²	136	100%	1.164	71%	0.707	S	S	*	*				0	108.9	0	-67.5	174.4	9.8	0	0	105.9	Q3	Q1-Q3 PolarHBondContact O-N 3.41Å
2	Q	44.4	Very low	69.8	Low	195 Å²	195	129.8 Å²	129.8	91%	0.911	68%	0.675	S	S	*	*			trans	-78.8	115.4	177.7	-84.5	170.5	-4.2	0	0	107.9	T4	Q2-T4 PolarHBondContact O-N 2.86Å; Q2-T4 VanDerWaalsContact O-N 3.15Å
3	Q	45.2	Very low	71.5	Confident	187 Å²	187	121.1 Å²	121.1	87%	0.874	63%	0.63	S	S	*	*			trans	-64.1	106	167.9	-114.2	166.5	-16.5	0	0	107.2	Q1 T5	Q1-Q3 PolarHBondContact O-N 3.41Å; Q3-T5 PolarHBondContact O-N 2.94Å; Q3-T5 VanDerWaalsContact O-N 3.08Å
4	T	56.1	Low	73	Confident	118 Å²	118	117.1 Å²	117.1	72%	0.724	61%	0.61	S	S	*	*			trans	-70.6	98.9	163.8	42.7	0	0	0	0	106.9	Q2 N6	Q2-T4 PolarHBondContact O-N 2.86Å; Q2-T4 VanDerWaalsContact O-N 3.15Å; T4-N6 PolarHBondContact O-N 3.48Å
5	T	57.5	Low	74.4	Confident	75 Å²	75	110.3 Å²	110.3	46%	0.46	57%	0.574	S	S	.	*			trans	-61.9	124.3	169	45.7	0	0	0	0	107.8	Q3 T7	Q3-T5 PolarHBondContact O-N 2.94Å; Q3-T5 VanDerWaalsContact O-N 3.08Å; T5-T7 WeakPolarHBondContact CB-OG1 3.37Å; T5-T7 PolarHBondContact O-N 3.13Å; T5-T7 PolarHBondContact OG1-OG1 3.46Å
6	N	65.5	Low	75.6	Confident	137 Å²	137	109.8 Å²	109.8	73%	0.733	56%	0.562	S	S	*	*			trans	-75.8	21.6	174.3	-78.9	-15.7	0	0	0	112	T4	T4-N6 PolarHBondContact O-N 3.48Å
7	T	78.1	Confident	76.7	Confident	69 Å²	69	106 Å²	106	42%	0.423	54%	0.543	S	S	.	.			trans	-84.9	135.7	178.1	46.6	0	0	0	0	109	T5 E9	T5-T7 WeakPolarHBondContact CB-OG1 3.37Å; T5-T7 PolarHBondContact O-N 3.13Å; T5-T7 PolarHBondContact OG1-OG1 3.46Å; T7-E9 PolarHBondContact O-N 3.22Å; T7-E9 PolarHBondContact OG1-OE1 3.47Å; T7-E9 VanDerWaalsContact OG1-OE1 3.13Å
8	V	85.8	Confident	77.7	Confident	79 Å²	79	100.2 Å²	100.2	48%	0.479	51%	0.513	S	S	.	.			trans	-83	110.5	171.1	179	0	0	0	0	106.6	D13 L14 L17	V8-D13 HydrophobicContact CG1-CB 4.35Å; V8-L14 HydrophobicContact CG1-CD2 3.99Å; V8-L14 HydrophobicContact CG1-CG 3.91Å; V8-L14 HydrophobicContact CG2-CD2 3.7Å; V8-L14 HydrophobicContact CG2-CG 4.44Å; V8-L17 HydrophobicContact CG2-CD1 3.7Å
9	E	90.4	Very high	78.7	Confident	147 Å²	147	98.6 Å²	98.6	69%	0.687	51%	0.506	S	S	*	.			trans	-107.1	-36.3	179.7	-65.9	179.8	-169.2	0	0	110.6	T7 D13	T7-E9 PolarHBondContact O-N 3.22Å; T7-E9 PolarHBondContact OG1-OE1 3.47Å; T7-E9 VanDerWaalsContact OG1-OE1 3.13Å; E9-D13 PolarHBondContact N-OD2 3.34Å
10	E	91.7	Very high	79.6	Confident	128 Å²	128	98.6 Å²	98.6	60%	0.598	51%	0.507	S	S	*	.	S	Bend	trans	-123.4	156.2	177.3	-63.4	-173.2	170.7	0	0	112.2	L12 D13	E10-L12 PolarHBondContact O-N 3.15Å; E10-L12 VanDerWaalsContact O-N 3.17Å; E10-D13 PolarHBondContact N-OD2 3.08Å; E10-D13 VanDerWaalsContact O-CB 3.26Å; E10-D13 WeakPolarHBondContact O-CB 3.39Å; E10-D13 PolarHBondContact O-N 3.16Å
11	P	89.8	Confident	80.4	Confident	112 Å²	112	97.1 Å²	97.1	73%	0.727	50%	0.498	S	S	*	.	H	α-helix	trans	-55	-36.5	178.9	-27.5	35.4	0	0	0	114.3	D13 L14	P11-D13 PolarHBondContact O-N 2.95Å; P11-L14 PolarHBondContact O-N 3.3Å
12	L	92.6	Very high	83.1	Confident	62 Å²	62	91.3 Å²	91.3	33%	0.325	47%	0.465	S	S	.	.	H	α-helix	trans	-70.4	-18.1	178.5	-70.8	179.9	0	0	0	113.2	E10 L14 I15 R16 L44	E10-L12 PolarHBondContact O-N 3.15Å; E10-L12 VanDerWaalsContact O-N 3.17Å; L12-L14 PolarHBondContact O-N 3.32Å; L12-I15 HydrophobicContact CD2-CG1 4.4Å; L12-I15 WeakPolarHBondContact O-CA 3.42Å; L12-I15 WeakPolarHBondContact O-CB 3.49Å; L12-I15 PolarHBondContact O-N 2.88Å; L12-R16 PolarHBondContact O-N 2.8Å; L12-L44 HydrophobicContact CD2-CD2 3.62Å; L12-L44 HydrophobicContact CD2-CG 4.27Å
13	D	92	Very high	85.6	Confident	16 Å²	16	82.2 Å²	82.2	9%	0.086	42%	0.423	C	S	.	.	H	α-helix	trans	-62.9	-31.4	174.7	-70.1	-35.4	0	0	0	111.4	V8 E9 E10 P11 I15 R16 L17	V8-D13 HydrophobicContact CG1-CB 4.35Å; E9-D13 PolarHBondContact N-OD2 3.34Å; E10-D13 PolarHBondContact N-OD2 3.08Å; E10-D13 VanDerWaalsContact O-CB 3.26Å; E10-D13 WeakPolarHBondContact O-CB 3.39Å; E10-D13 PolarHBondContact O-N 3.16Å; P11-D13 PolarHBondContact O-N 2.95Å; D13-I15 PolarHBondContact O-N 3.17Å; D13-R16 WeakPolarHBondContact O-CB 3.26Å; D13-R16 PolarHBondContact O-N 3.05Å; D13-R16 IonicContact OD1-CZ 3.17Å; D13-R16 IonicContact OD1-NE 3.37Å; D13-R16 IonicContact OD1-NH1 3.47Å; D13-R16 PolarHBondContact OD1-NH1 2.83Å; D13-R16 IonicContact OD1-NH2 3.22Å; D13-R16 PolarHBondContact OD1-NH2 3.36Å; D13-L17 WeakPolarHBondContact O-CB 3.5Å; D13-L17 WeakPolarHBondContact O-CG 3.17Å; D13-L17 PolarHBondContact O-N 3.23Å
14	L	91.3	Very high	88.2	Confident	66 Å²	66	76 Å²	76	35%	0.346	39%	0.392	S	S	.	.	H	α-helix	trans	-61.2	-36.8	173.9	-68.4	172.7	0	0	0	111.7	V8 P11 L12 S18	V8-L14 HydrophobicContact CG1-CD2 3.99Å; V8-L14 HydrophobicContact CG1-CG 3.91Å; V8-L14 HydrophobicContact CG2-CD2 3.7Å; V8-L14 HydrophobicContact CG2-CG 4.44Å; P11-L14 PolarHBondContact O-N 3.3Å; L12-L14 PolarHBondContact O-N 3.32Å; L14-S18 PolarHBondContact O-N 3.36Å; L14-S18 PolarHBondContact O-OG 3.29Å
15	I	94.7	Very high	90.2	Very high	14 Å²	14	70.4 Å²	70.4	7%	0.072	36%	0.357	C	S	.	.	H	α-helix	trans	-72.5	-44	176.5	-51	-52.6	0	0	0	109.9	L12 D13 L17 S18 L19 L37 Y40 L44 V89	L12-I15 HydrophobicContact CD2-CG1 4.4Å; L12-I15 WeakPolarHBondContact O-CA 3.42Å; L12-I15 WeakPolarHBondContact O-CB 3.49Å; L12-I15 PolarHBondContact O-N 2.88Å; D13-I15 PolarHBondContact O-N 3.17Å; I15-L17 VanDerWaalsContact C-N 3.3Å; I15-L17 PolarHBondContact O-N 3.35Å; I15-S18 WeakPolarHBondContact O-CA 3.35Å; I15-S18 PolarHBondContact O-N 3.43Å; I15-L19 PolarHBondContact O-N 3.29Å; I15-L37 HydrophobicContact CG2-CD2 3.72Å; I15-Y40 HydrophobicContact CB-CD2 4.41Å; I15-Y40 HydrophobicContact CB-CE2 4.29Å; I15-Y40 HydrophobicContact CG2-CD1 3.8Å; I15-Y40 HydrophobicContact CG2-CD2 3.73Å; I15-Y40 HydrophobicContact CG2-CE1 4.12Å; I15-Y40 HydrophobicContact CG2-CE2 4.04Å; I15-Y40 HydrophobicContact CG2-CG 3.63Å; I15-L44 HydrophobicContact CG1-CD2 4.12Å; I15-L44 HydrophobicContact CG2-CD2 4.43Å; I15-V89 HydrophobicContact CD1-CB 3.97Å; I15-V89 HydrophobicContact CD1-CG1 3.58Å
16	R	93.8	Very high	92.1	Very high	102 Å²	102	68.9 Å²	68.9	39%	0.385	34%	0.344	S	S	.	.	H	α-helix	trans	-53.4	-47.7	173.8	-167.3	176.3	66.5	-173.7	-2.7	112.1	L12 D13 S18 L19 Y40	L12-R16 PolarHBondContact O-N 2.8Å; D13-R16 WeakPolarHBondContact O-CB 3.26Å; D13-R16 PolarHBondContact O-N 3.05Å; D13-R16 IonicContact OD1-CZ 3.17Å; D13-R16 IonicContact OD1-NE 3.37Å; D13-R16 IonicContact OD1-NH1 3.47Å; D13-R16 PolarHBondContact OD1-NH1 2.83Å; D13-R16 IonicContact OD1-NH2 3.22Å; D13-R16 PolarHBondContact OD1-NH2 3.36Å; R16-S18 PolarHBondContact O-N 3.01Å; R16-L19 WeakPolarHBondContact O-CG 3.4Å; R16-L19 PolarHBondContact O-N 2.94Å; R16-Y40 WeakPolarHBondContact CA-OH 3.39Å; R16-Y40 HydrophobicContact CB-CE1 4.44Å; R16-Y40 WeakPolarHBondContact CB-OH 3.42Å
17	L	93.4	Very high	93.7	Very high	46 Å²	46	63.1 Å²	63.1	24%	0.241	31%	0.313	C	S	.	.	T	Hydrogen-bonded Turn	trans	-69.1	-15.2	179.7	-67.9	170.6	0	0	0	112.7	V8 D13 I15 R94	V8-L17 HydrophobicContact CG2-CD1 3.7Å; D13-L17 WeakPolarHBondContact O-CB 3.5Å; D13-L17 WeakPolarHBondContact O-CG 3.17Å; D13-L17 PolarHBondContact O-N 3.23Å; I15-L17 VanDerWaalsContact C-N 3.3Å; I15-L17 PolarHBondContact O-N 3.35Å; L17-R94 PolarHBondContact O-NH2 2.83Å; L17-R94 VanDerWaalsContact O-NH2 3.15Å
18	S	94.8	Very high	94.5	Very high	1 Å²	1	67.4 Å²	67.4	1%	0.007	32%	0.322	C	S	.	.	T	Hydrogen-bonded Turn	trans	-97.6	-2.9	178.2	-50.2	0	0	0	0	113.8	L14 I15 R16 D20 E21 P91 R94	L14-S18 PolarHBondContact O-N 3.36Å; L14-S18 PolarHBondContact O-OG 3.29Å; I15-S18 WeakPolarHBondContact O-CA 3.35Å; I15-S18 PolarHBondContact O-N 3.43Å; R16-S18 PolarHBondContact O-N 3.01Å; S18-D20 PolarHBondContact O-N 2.99Å; S18-E21 WeakPolarHBondContact O-CB 3.39Å; S18-E21 PolarHBondContact O-N 3.18Å; S18-P91 VanDerWaalsContact OG-CB 3.27Å; S18-P91 WeakPolarHBondContact OG-CB 3.29Å; S18-R94 PolarHBondContact OG-NH2 2.97Å
19	L	96.5	Very high	94.9	Very high	71 Å²	71	70.6 Å²	70.6	37%	0.372	34%	0.336	S	S	.	.	T	Hydrogen-bonded Turn		17.1	89.9	122.7	-4.3	147.5	0	0	0	117.4	I15 R16 E21 L37 Y40	I15-L19 PolarHBondContact O-N 3.29Å; R16-L19 WeakPolarHBondContact O-CG 3.4Å; R16-L19 PolarHBondContact O-N 2.94Å; L19-E21 PolarHBondContact O-N 2.76Å; L19-E21 VanDerWaalsContact O-N 3.08Å; L19-L37 HydrophobicContact CD2-CD2 4.12Å; L19-L37 HydrophobicContact CD2-CG 3.93Å; L19-Y40 HydrophobicContact CD1-CE1 4.1Å; L19-Y40 HydrophobicContact CD2-CD1 4.15Å; L19-Y40 HydrophobicContact CD2-CE1 4.41Å; L19-Y40 HydrophobicContact CG-CD1 4.48Å; L19-Y40 HydrophobicContact CG-CE1 4.25Å
20	D	96.9	Very high	95.2	Very high	97 Å²	97	67.6 Å²	67.6	52%	0.519	32%	0.324	S	S	.	.	T	Hydrogen-bonded Turn	trans	70.1	3.3	171.1	-155.2	60.4	0	0	0	114.8	S18 R36 L37	S18-D20 PolarHBondContact O-N 2.99Å; D20-R36 WeakPolarHBondContact O-CG 3.48Å; D20-R36 PolarHBondContact O-NE 2.86Å; D20-R36 IonicContact OD1-CZ 3.52Å; D20-R36 IonicContact OD1-NE 3.79Å; D20-R36 PolarHBondContact OD1-NE 2.91Å; D20-R36 IonicContact OD1-NH1 2.67Å; D20-R36 PolarHBondContact OD1-NH1 2.74Å; D20-R36 IonicContact OD1-NH2 3.03Å; D20-R36 PolarHBondContact OD1-NH2 3.49Å; D20-R36 IonicContact OD2-CZ 2.74Å; D20-R36 IonicContact OD2-NE 2.74Å; D20-R36 IonicContact OD2-NH2 2.84Å; D20-R36 PolarHBondContact OD2-NH2 2.85Å; D20-L37 WeakPolarHBondContact CA-O 3.35Å; D20-L37 PolarHBondContact N-O 3.37Å
21	E	97	Very high	95.4	Very high	69 Å²	69	64.9 Å²	64.9	32%	0.322	31%	0.309	S	S	.	.	S	Bend	trans	-99.5	162.6	179.4	-54.3	-170.1	108.1	0	0	112.1	S18 L19 R36 L37 P92 R94	S18-E21 WeakPolarHBondContact O-CB 3.39Å; S18-E21 PolarHBondContact O-N 3.18Å; L19-E21 PolarHBondContact O-N 2.76Å; L19-E21 VanDerWaalsContact O-N 3.08Å; E21-R36 CarbonylContact O-C 3.59Å; E21-R36 VanDerWaalsContact O-CA 3.31Å; E21-R36 WeakPolarHBondContact O-CA 3.16Å; E21-L37 PolarHBondContact O-N 3.34Å; E21-P92 HydrophobicContact CB-CG 3.86Å; E21-P92 VanDerWaalsContact CD-CG 3.43Å; E21-P92 HydrophobicContact CG-CG 4.26Å; E21-P92 WeakPolarHBondContact OE2-CG 3.43Å; E21-R94 IonicContact OE2-CZ 3.6Å; E21-R94 IonicContact OE2-NH2 3.17Å; E21-R94 PolarHBondContact OE2-NH2 3.36Å
22	R	97.3	Very high	95.9	Very high	126 Å²	126	61.4 Å²	61.4	48%	0.475	28%	0.283	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.8	120.5	174	-174.7	167.9	-80.4	-103.5	-5.4	110.2	R34 G35 D50	R22-R34 PolarHBondContact NH1-O 2.96Å; R22-G35 CarbonylContact C-O 3.54Å; R22-G35 WeakPolarHBondContact CA-O 3.36Å; R22-D50 PolarHBondContact NH1-O 2.85Å; R22-D50 PolarHBondContact NH2-O 3.44Å
23	I	97.8	Very high	96.2	Very high	5 Å²	5	58.4 Å²	58.4	3%	0.026	27%	0.267	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113	161.8	-179.7	64.6	166.1	0	0	0	111.4	V25 R34 G35 L37 M46 L48 V89	I23-V25 HydrophobicContact CD1-CG2 3.69Å; I23-V25 HydrophobicContact CG1-CG2 4.14Å; I23-R34 WeakPolarHBondContact O-CA 3.45Å; I23-G35 PolarHBondContact N-O 3.16Å; I23-G35 PolarHBondContact O-N 2.96Å; I23-L37 HydrophobicContact CD1-CB 3.99Å; I23-L37 HydrophobicContact CD1-CD1 4.18Å; I23-L37 HydrophobicContact CD1-CD2 4.27Å; I23-L37 HydrophobicContact CD1-CG 4.36Å; I23-L37 HydrophobicContact CG1-CB 4.23Å; I23-L37 HydrophobicContact CG2-CB 4.35Å; I23-M46 HydrophobicContact CD1-SD 4.06Å; I23-L48 HydrophobicContact CD1-CD2 4Å; I23-L48 HydrophobicContact CG1-CD2 4.3Å; I23-V89 HydrophobicContact CD1-CG1 3.97Å
24	Y	98.3	Very high	96.5	Very high	57 Å²	57	62.1 Å²	62.1	22%	0.224	28%	0.28	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.1	134.3	168.2	169.7	-96.7	0	0	0	110.2	K26 E32 L33 R34 L88 V89 A90	Y24-K26 HydrophobicContact CE1-CB 4.03Å; Y24-E32 HydrophobicContact CE2-CB 4Å; Y24-E32 HydrophobicContact CE2-CG 4.05Å; Y24-E32 VanDerWaalsContact CE2-OE2 3.26Å; Y24-E32 WeakPolarHBondContact CE2-OE2 3.28Å; Y24-E32 WeakPolarHBondContact OH-CG 3.38Å; Y24-E32 PolarHBondContact OH-OE1 3.44Å; Y24-E32 PolarHBondContact OH-OE2 2.84Å; Y24-L33 WeakPolarHBondContact CA-O 3.23Å; Y24-R34 HydrophobicContact CD2-CG 3.87Å; Y24-L88 HydrophobicContact CD1-CD2 3.9Å; Y24-L88 HydrophobicContact CE1-CD2 3.89Å; Y24-V89 WeakPolarHBondContact O-CA 3.42Å; Y24-A90 HydrophobicContact CD1-CB 4.09Å; Y24-A90 PolarHBondContact N-O 2.86Å; Y24-A90 PolarHBondContact O-N 3.4Å
25	V	98.4	Very high	96.8	Very high	0 Å²	0	59 Å²	59	0%	0	26%	0.263	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128	119.5	177	-173.3	0	0	0	0	109.1	I23 M27 E32 L33 M46 L48 V86 L88 V89	I23-V25 HydrophobicContact CD1-CG2 3.69Å; I23-V25 HydrophobicContact CG1-CG2 4.14Å; V25-M27 HydrophobicContact CG1-CG 4.43Å; V25-M27 HydrophobicContact CG1-SD 3.68Å; V25-E32 WeakPolarHBondContact O-CA 3.27Å; V25-L33 HydrophobicContact CB-CB 4.25Å; V25-L33 PolarHBondContact N-O 3.15Å; V25-L33 PolarHBondContact O-N 3.26Å; V25-M46 HydrophobicContact CG1-CE 4.07Å; V25-M46 HydrophobicContact CG2-CE 4.24Å; V25-M46 HydrophobicContact CG2-SD 4.27Å; V25-L48 HydrophobicContact CG2-CD1 4.37Å; V25-V86 HydrophobicContact CG1-CG1 4Å; V25-V86 HydrophobicContact CG1-CG2 4.23Å; V25-L88 CarbonylContact C-O 3.48Å; V25-L88 WeakPolarHBondContact CA-O 3.23Å; V25-V89 HydrophobicContact CG1-CG2 4.4Å; V25-V89 HydrophobicContact CG2-CG1 4.39Å
26	K	98.3	Very high	97	Very high	43 Å²	43	62.5 Å²	62.5	19%	0.187	28%	0.276	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90	123.3	167.4	-174.9	67.4	171.2	-178.2	0	108	Y24 D30 E32 V87 L88	Y24-K26 HydrophobicContact CE1-CB 4.03Å; K26-D30 IonicContact NZ-OD1 3.73Å; K26-D30 PolarHBondContact NZ-OD1 3.34Å; K26-E32 HydrophobicContact CD-CG 3.43Å; K26-E32 VanDerWaalsContact CD-CG 3.43Å; K26-E32 IonicContact NZ-OE1 3.3Å; K26-E32 PolarHBondContact NZ-OE1 2.68Å; K26-V87 PolarHBondContact O-N 2.83Å; K26-L88 HydrophobicContact CB-CB 4.15Å; K26-L88 PolarHBondContact N-O 3.22Å; K26-L88 PolarHBondContact O-N 3.44Å
27	M	98.2	Very high	97.2	Very high	15 Å²	15	57.6 Å²	57.6	7%	0.074	26%	0.257	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.3	167.2	174.5	-57	-64.8	-70.4	0	0	109.6	V25 R31 L33 V81 G85 V86	V25-M27 HydrophobicContact CG1-CG 4.43Å; V25-M27 HydrophobicContact CG1-SD 3.68Å; M27-R31 WeakPolarHBondContact CA-O 3.14Å; M27-R31 HydrophobicContact CB-CB 4.06Å; M27-R31 HydrophobicContact CB-CG 4.25Å; M27-R31 WeakPolarHBondContact CB-O 3.47Å; M27-R31 HydrophobicContact CG-CG 4.39Å; M27-R31 PolarHBondContact N-O 3.28Å; M27-L33 HydrophobicContact CG-CD1 4.02Å; M27-L33 HydrophobicContact CG-CG 4.25Å; M27-L33 HydrophobicContact SD-CD1 4.27Å; M27-V81 HydrophobicContact CE-CG1 3.51Å; M27-V81 HydrophobicContact SD-CG1 3.7Å; M27-G85 CarbonylContact C-O 3.5Å; M27-G85 VanDerWaalsContact CA-O 3.23Å; M27-G85 WeakPolarHBondContact CA-O 3.46Å; M27-G85 VanDerWaalsContact CE-C 3.47Å; M27-V86 HydrophobicContact CE-CG2 4.17Å; M27-V86 HydrophobicContact SD-CB 4.36Å; M27-V86 HydrophobicContact SD-CG2 3.73Å
28	R	96.7	Very high	97.4	Very high	160 Å²	160	59.1 Å²	59.1	60%	0.604	26%	0.263	S	S	*	.	S	Bend	trans	-58.8	160.5	165.2	-62.1	-179.1	-170.3	-160.4	3.3	110.9	D84 G85 V87	R28-D84 VanDerWaalsContact CZ-O 3.3Å; R28-D84 PolarHBondContact NE-O 2.88Å; R28-D84 VanDerWaalsContact NE-O 3.14Å; R28-D84 PolarHBondContact NH2-O 2.93Å; R28-D84 VanDerWaalsContact NH2-O 3.1Å; R28-G85 PolarHBondContact N-O 2.9Å; R28-V87 HydrophobicContact CG-CG2 3.71Å
29	N	94	Very high	97.6	Very high	145 Å²	145	61.1 Å²	61.1	78%	0.775	28%	0.28	S	S	*	.	T	Hydrogen-bonded Turn	trans	60.5	45.3	175.6	-49.8	-22.1	0	0	0	113.5	R31	N29-R31 PolarHBondContact O-N 3.05Å
30	D	95.1	Very high	97.7	Very high	84 Å²	84	60.9 Å²	60.9	45%	0.449	27%	0.274	S	S	.	.	T	Hydrogen-bonded Turn	trans	50.3	35.7	174.1	-67.7	-60.7	0	0	0	115.7	K26 T56	K26-D30 IonicContact NZ-OD1 3.73Å; K26-D30 PolarHBondContact NZ-OD1 3.34Å; D30-T56 PolarHBondContact O-N 2.87Å
31	R	97.7	Very high	97.7	Very high	72 Å²	72	59.1 Å²	59.1	27%	0.272	27%	0.265	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.1	134.7	174.3	177	176.4	178.8	-148.4	0.3	110.4	M27 N29 E53 T54 V55	M27-R31 WeakPolarHBondContact CA-O 3.14Å; M27-R31 HydrophobicContact CB-CB 4.06Å; M27-R31 HydrophobicContact CB-CG 4.25Å; M27-R31 WeakPolarHBondContact CB-O 3.47Å; M27-R31 HydrophobicContact CG-CG 4.39Å; M27-R31 PolarHBondContact N-O 3.28Å; N29-R31 PolarHBondContact O-N 3.05Å; R31-E53 HydrophobicContact CG-CG 4.34Å; R31-E53 IonicContact CZ-OE1 2.76Å; R31-E53 IonicContact NE-OE1 2.65Å; R31-E53 PolarHBondContact NE-OE1 3.1Å; R31-E53 IonicContact NH2-OE1 3.86Å; R31-E53 PolarHBondContact NH2-OE1 3.14Å; R31-T54 CarbonylContact C-O 3.55Å; R31-T54 WeakPolarHBondContact CA-O 3.25Å; R31-V55 HydrophobicContact CB-CG2 4.34Å; R31-V55 HydrophobicContact CG-CG2 4.07Å
32	E	98.5	Very high	97.7	Very high	38 Å²	38	63.2 Å²	63.2	18%	0.178	28%	0.284	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.5	138.7	-177.5	-69	179	-153.2	0	0	109.9	Y24 V25 K26 R34 E53 T54	Y24-E32 HydrophobicContact CE2-CB 4Å; Y24-E32 HydrophobicContact CE2-CG 4.05Å; Y24-E32 VanDerWaalsContact CE2-OE2 3.26Å; Y24-E32 WeakPolarHBondContact CE2-OE2 3.28Å; Y24-E32 WeakPolarHBondContact OH-CG 3.38Å; Y24-E32 PolarHBondContact OH-OE1 3.44Å; Y24-E32 PolarHBondContact OH-OE2 2.84Å; V25-E32 WeakPolarHBondContact O-CA 3.27Å; K26-E32 HydrophobicContact CD-CG 3.43Å; K26-E32 VanDerWaalsContact CD-CG 3.43Å; K26-E32 IonicContact NZ-OE1 3.3Å; K26-E32 PolarHBondContact NZ-OE1 2.68Å; E32-R34 IonicContact OE2-NH2 2.83Å; E32-E53 CarbonylContact O-C 3.56Å; E32-E53 WeakPolarHBondContact O-CA 3.48Å; E32-T54 PolarHBondContact N-O 2.87Å; E32-T54 PolarHBondContact O-N 2.95Å
33	L	98.6	Very high	97.6	Very high	0 Å²	0	62.7 Å²	62.7	0%	0	29%	0.287	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.6	134	179	-51.7	173	0	0	0	109.2	Y24 V25 M27 L48 V51 E53 L79 V81	Y24-L33 WeakPolarHBondContact CA-O 3.23Å; V25-L33 HydrophobicContact CB-CB 4.25Å; V25-L33 PolarHBondContact N-O 3.15Å; V25-L33 PolarHBondContact O-N 3.26Å; M27-L33 HydrophobicContact CG-CD1 4.02Å; M27-L33 HydrophobicContact CG-CG 4.25Å; M27-L33 HydrophobicContact SD-CD1 4.27Å; L33-L48 HydrophobicContact CB-CD1 4.29Å; L33-L48 HydrophobicContact CD1-CD1 4.21Å; L33-V51 HydrophobicContact CB-CG1 4.1Å; L33-V51 HydrophobicContact CD2-CG1 4.04Å; L33-E53 HydrophobicContact CD2-CB 3.8Å; L33-E53 HydrophobicContact CD2-CG 3.76Å; L33-L79 HydrophobicContact CD1-CD2 3.87Å; L33-L79 HydrophobicContact CD2-CD2 3.92Å; L33-V81 HydrophobicContact CD1-CG1 4.31Å; L33-V81 HydrophobicContact CD1-CG2 3.6Å
34	R	98.4	Very high	97.6	Very high	93 Å²	93	64.4 Å²	64.4	35%	0.351	30%	0.296	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.1	112.2	167.5	-69.2	-179.2	-179	84.2	7.7	108.3	R22 I23 Y24 E32 V51 E52	R22-R34 PolarHBondContact NH1-O 2.96Å; I23-R34 WeakPolarHBondContact O-CA 3.45Å; Y24-R34 HydrophobicContact CD2-CG 3.87Å; E32-R34 IonicContact OE2-NH2 2.83Å; R34-V51 CarbonylContact O-C 3.59Å; R34-V51 WeakPolarHBondContact O-CA 3.36Å; R34-E52 PolarHBondContact N-O 2.65Å; R34-E52 PolarHBondContact O-N 3.3Å
35	G	98.3	Very high	97.6	Very high	0 Å²	0	63 Å²	63	0%	0	29%	0.292	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-159.2	167.9	-173.9	0	0	0	0	0	112.5	R22 I23 G49	R22-G35 CarbonylContact C-O 3.54Å; R22-G35 WeakPolarHBondContact CA-O 3.36Å; I23-G35 PolarHBondContact N-O 3.16Å; I23-G35 PolarHBondContact O-N 2.96Å; G35-G49 WeakPolarHBondContact CA-O 3.42Å
36	R	98.4	Very high	97.6	Very high	88 Å²	88	63 Å²	63	33%	0.332	29%	0.292	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.9	125.7	177.9	-170	177.3	-175.7	-141.1	16.9	110.3	D20 E21 H38 L48 G49	D20-R36 WeakPolarHBondContact O-CG 3.48Å; D20-R36 PolarHBondContact O-NE 2.86Å; D20-R36 IonicContact OD1-CZ 3.52Å; D20-R36 IonicContact OD1-NE 3.79Å; D20-R36 PolarHBondContact OD1-NE 2.91Å; D20-R36 IonicContact OD1-NH1 2.67Å; D20-R36 PolarHBondContact OD1-NH1 2.74Å; D20-R36 IonicContact OD1-NH2 3.03Å; D20-R36 PolarHBondContact OD1-NH2 3.49Å; D20-R36 IonicContact OD2-CZ 2.74Å; D20-R36 IonicContact OD2-NE 2.74Å; D20-R36 IonicContact OD2-NH2 2.84Å; D20-R36 PolarHBondContact OD2-NH2 2.85Å; E21-R36 CarbonylContact O-C 3.59Å; E21-R36 VanDerWaalsContact O-CA 3.31Å; E21-R36 WeakPolarHBondContact O-CA 3.16Å; R36-H38 PolarHBondContact O-CD2 2.96Å; R36-H38 PolarHBondContact O-N 2.94Å; R36-L48 CarbonylContact O-C 3.56Å; R36-L48 VanDerWaalsContact O-CA 3.24Å; R36-L48 WeakPolarHBondContact O-CA 3.42Å; R36-G49 PolarHBondContact N-O 3.19Å; R36-G49 PolarHBondContact O-N 3.08Å
37	L	98.5	Very high	97.6	Very high	0 Å²	0	63.6 Å²	63.6	0%	0	30%	0.297	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-79	113.2	179.6	-179	63.4	0	0	0	110.8	I15 L19 D20 E21 I23 A39 Y40 M46 L48	I15-L37 HydrophobicContact CG2-CD2 3.72Å; L19-L37 HydrophobicContact CD2-CD2 4.12Å; L19-L37 HydrophobicContact CD2-CG 3.93Å; D20-L37 WeakPolarHBondContact CA-O 3.35Å; D20-L37 PolarHBondContact N-O 3.37Å; E21-L37 PolarHBondContact O-N 3.34Å; I23-L37 HydrophobicContact CD1-CB 3.99Å; I23-L37 HydrophobicContact CD1-CD1 4.18Å; I23-L37 HydrophobicContact CD1-CD2 4.27Å; I23-L37 HydrophobicContact CD1-CG 4.36Å; I23-L37 HydrophobicContact CG1-CB 4.23Å; I23-L37 HydrophobicContact CG2-CB 4.35Å; L37-A39 WeakPolarHBondContact CD1-O 3.49Å; L37-Y40 HydrophobicContact CD2-CD1 4.4Å; L37-M46 HydrophobicContact CD1-CB 4.05Å; L37-M46 HydrophobicContact CD1-CG 3.93Å; L37-M46 HydrophobicContact CD1-SD 4.16Å; L37-L48 HydrophobicContact CB-CD2 4.28Å; L37-L48 HydrophobicContact CD1-CD2 3.73Å
38	H	98.3	Very high	97.7	Very high	77 Å²	77	62.9 Å²	62.9	36%	0.356	29%	0.293	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.3	-37.9	178.7	-75.1	-150.2	0	0	0	112.4	R36 I47	R36-H38 PolarHBondContact O-CD2 2.96Å; R36-H38 PolarHBondContact O-N 2.94Å; H38-I47 HydrophobicContact CB-CB 4.21Å; H38-I47 HydrophobicContact CB-CG2 3.99Å; H38-I47 WeakPolarHBondContact CB-O 3.39Å; H38-I47 PolarHBondContact N-O 3.38Å
39	A	98.3	Very high	97.8	Very high	43 Å²	43	55.3 Å²	55.3	36%	0.355	27%	0.265	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-158.3	156.6	-179.6	0	0	0	0	0	111	L37 M46 I47	L37-A39 WeakPolarHBondContact CD1-O 3.49Å; A39-M46 WeakPolarHBondContact O-CA 3.4Å; A39-I47 HydrophobicContact CB-CB 4.2Å; A39-I47 HydrophobicContact CB-CG1 4.14Å; A39-I47 PolarHBondContact N-O 2.82Å; A39-I47 PolarHBondContact O-N 2.85Å
40	Y	98.3	Very high	98	Very high	67 Å²	67	53.3 Å²	53.3	26%	0.263	25%	0.254	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.1	168.1	171.6	72.4	-74.9	0	0	0	111.5	I15 R16 L19 L37 N45	I15-Y40 HydrophobicContact CB-CD2 4.41Å; I15-Y40 HydrophobicContact CB-CE2 4.29Å; I15-Y40 HydrophobicContact CG2-CD1 3.8Å; I15-Y40 HydrophobicContact CG2-CD2 3.73Å; I15-Y40 HydrophobicContact CG2-CE1 4.12Å; I15-Y40 HydrophobicContact CG2-CE2 4.04Å; I15-Y40 HydrophobicContact CG2-CG 3.63Å; R16-Y40 WeakPolarHBondContact CA-OH 3.39Å; R16-Y40 HydrophobicContact CB-CE1 4.44Å; R16-Y40 WeakPolarHBondContact CB-OH 3.42Å; L19-Y40 HydrophobicContact CD1-CE1 4.1Å; L19-Y40 HydrophobicContact CD2-CD1 4.15Å; L19-Y40 HydrophobicContact CD2-CE1 4.41Å; L19-Y40 HydrophobicContact CG-CD1 4.48Å; L19-Y40 HydrophobicContact CG-CE1 4.25Å; L37-Y40 HydrophobicContact CD2-CD1 4.4Å; Y40-N45 CarbonylContact C-O 3.57Å; Y40-N45 WeakPolarHBondContact CA-O 3.31Å
41	D	97.4	Very high	98.1	Very high	59 Å²	59	49.3 Å²	49.3	32%	0.316	23%	0.233	S	C	.	.			trans	-127.9	-178.3	170.2	71.3	13.1	0	0	0	112.4	H43 L44 N45	D41-H43 PolarHBondContact O-N 2.88Å; D41-H43 VanDerWaalsContact O-N 3.16Å; D41-H43 WeakPolarHBondContact OD1-CA 3.39Å; D41-H43 WeakPolarHBondContact OD1-CB 3.46Å; D41-H43 PolarHBondContact OD1-N 3.22Å; D41-L44 PolarHBondContact O-N 3.03Å; D41-L44 PolarHBondContact OD1-N 2.82Å; D41-N45 PolarHBondContact N-O 2.86Å; D41-N45 VanDerWaalsContact N-O 3.16Å; D41-N45 WeakPolarHBondContact OD1-CB 3.39Å; D41-N45 PolarHBondContact OD1-N 2.85Å; D41-N45 PolarHBondContact OD1-ND2 2.9Å; D41-N45 WeakPolarHBondContact OD2-CB 3.47Å; D41-N45 PolarHBondContact OD2-ND2 2.81Å
42	Q	96.1	Very high	98.2	Very high	155 Å²	155	48.4 Å²	48.4	72%	0.724	23%	0.232	S	C	*	.	T	Hydrogen-bonded Turn	trans	-61.1	-20.8	179.4	69.2	-174.5	-42	0	0	114.4	L44	Q42-L44 VanDerWaalsContact C-N 3.32Å
43	H	96.7	Very high	98.2	Very high	115 Å²	115	47 Å²	47	53%	0.532	23%	0.225	S	C	.	.	T	Hydrogen-bonded Turn	trans	-90.8	-0.7	178.2	-57.1	-63.4	0	0	0	111.9	D41 N45 G83	D41-H43 PolarHBondContact O-N 2.88Å; D41-H43 VanDerWaalsContact O-N 3.16Å; D41-H43 WeakPolarHBondContact OD1-CA 3.39Å; D41-H43 WeakPolarHBondContact OD1-CB 3.46Å; D41-H43 PolarHBondContact OD1-N 3.22Å; H43-N45 PolarHBondContact O-N 2.82Å; H43-G83 VanDerWaalsContact O-CA 3.29Å; H43-G83 WeakPolarHBondContact O-CA 3.15Å
44	L	97.2	Very high	98.2	Very high	42 Å²	42	47.5 Å²	47.5	22%	0.22	23%	0.228	C	C	.	.			trans	59.8	31.2	-168.9	-60.1	175.6	0	0	0	113	L12 I15 D41 Q42 M46 G83	L12-L44 HydrophobicContact CD2-CD2 3.62Å; L12-L44 HydrophobicContact CD2-CG 4.27Å; I15-L44 HydrophobicContact CG1-CD2 4.12Å; I15-L44 HydrophobicContact CG2-CD2 4.43Å; D41-L44 PolarHBondContact O-N 3.03Å; D41-L44 PolarHBondContact OD1-N 2.82Å; Q42-L44 VanDerWaalsContact C-N 3.32Å; L44-M46 HydrophobicContact CB-CE 4.45Å; L44-M46 WeakPolarHBondContact O-CE 3.37Å; L44-G83 VanDerWaalsContact O-CA 3.28Å; L44-G83 WeakPolarHBondContact O-CA 3.45Å
45	N	98.4	Very high	98.1	Very high	26 Å²	26	44.7 Å²	44.7	14%	0.139	22%	0.221	C	C	.	.			trans	-65.6	134.8	155.6	-59	-50.2	0	0	0	107.6	Y40 D41 H43 F80 V81 R82 G83	Y40-N45 CarbonylContact C-O 3.57Å; Y40-N45 WeakPolarHBondContact CA-O 3.31Å; D41-N45 PolarHBondContact N-O 2.86Å; D41-N45 VanDerWaalsContact N-O 3.16Å; D41-N45 WeakPolarHBondContact OD1-CB 3.39Å; D41-N45 PolarHBondContact OD1-N 2.85Å; D41-N45 PolarHBondContact OD1-ND2 2.9Å; D41-N45 WeakPolarHBondContact OD2-CB 3.47Å; D41-N45 PolarHBondContact OD2-ND2 2.81Å; H43-N45 PolarHBondContact O-N 2.82Å; N45-F80 HydrophobicContact CB-CE2 4.01Å; N45-F80 HydrophobicContact CB-CZ 4.08Å; N45-V81 CarbonylContact C-O 3.49Å; N45-V81 VanDerWaalsContact CA-O 3.25Å; N45-V81 WeakPolarHBondContact CA-O 3.47Å; N45-R82 WeakPolarHBondContact OD1-CA 3.24Å; N45-G83 PolarHBondContact OD1-N 2.85Å
46	M	98.5	Very high	98	Very high	1 Å²	1	46.7 Å²	46.7	1%	0.005	23%	0.233	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-131.6	146.8	-173.1	-67.5	174.8	-93.7	0	0	111.8	I23 V25 L37 A39 L44 L48 F80 V81 V86 V89	I23-M46 HydrophobicContact CD1-SD 4.06Å; V25-M46 HydrophobicContact CG1-CE 4.07Å; V25-M46 HydrophobicContact CG2-CE 4.24Å; V25-M46 HydrophobicContact CG2-SD 4.27Å; L37-M46 HydrophobicContact CD1-CB 4.05Å; L37-M46 HydrophobicContact CD1-CG 3.93Å; L37-M46 HydrophobicContact CD1-SD 4.16Å; A39-M46 WeakPolarHBondContact O-CA 3.4Å; L44-M46 HydrophobicContact CB-CE 4.45Å; L44-M46 WeakPolarHBondContact O-CE 3.37Å; M46-L48 HydrophobicContact CB-CD2 4.19Å; M46-L48 HydrophobicContact CB-CG 4.39Å; M46-F80 WeakPolarHBondContact O-CA 3.32Å; M46-V81 HydrophobicContact CB-CB 4.26Å; M46-V81 HydrophobicContact CE-CG1 4.49Å; M46-V81 PolarHBondContact N-O 3.24Å; M46-V81 PolarHBondContact O-N 2.87Å; M46-V86 HydrophobicContact CE-CB 4.49Å; M46-V86 HydrophobicContact CE-CG1 4.19Å; M46-V86 HydrophobicContact CE-CG2 3.5Å; M46-V89 HydrophobicContact CE-CG2 4.05Å
47	I	98.6	Very high	97.8	Very high	56 Å²	56	45.3 Å²	45.3	29%	0.287	24%	0.235	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-104.8	117.6	163.7	-56.5	-67.7	0	0	0	107.2	H38 A39 M78 F80	H38-I47 HydrophobicContact CB-CB 4.21Å; H38-I47 HydrophobicContact CB-CG2 3.99Å; H38-I47 WeakPolarHBondContact CB-O 3.39Å; H38-I47 PolarHBondContact N-O 3.38Å; A39-I47 HydrophobicContact CB-CB 4.2Å; A39-I47 HydrophobicContact CB-CG1 4.14Å; A39-I47 PolarHBondContact N-O 2.82Å; A39-I47 PolarHBondContact O-N 2.85Å; I47-M78 HydrophobicContact CG2-CE 3.38Å; I47-F80 HydrophobicContact CD1-CB 4.15Å; I47-F80 HydrophobicContact CD1-CD2 3.67Å; I47-F80 HydrophobicContact CD1-CG 4.4Å
48	L	98.8	Very high	97.5	Very high	0 Å²	0	49.7 Å²	49.7	0%	0	26%	0.257	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113	135.9	177.7	-55.5	-176.7	0	0	0	110.7	I23 V25 L33 R36 L37 M46 V51 M78 L79 V81	I23-L48 HydrophobicContact CD1-CD2 4Å; I23-L48 HydrophobicContact CG1-CD2 4.3Å; V25-L48 HydrophobicContact CG2-CD1 4.37Å; L33-L48 HydrophobicContact CB-CD1 4.29Å; L33-L48 HydrophobicContact CD1-CD1 4.21Å; R36-L48 CarbonylContact O-C 3.56Å; R36-L48 VanDerWaalsContact O-CA 3.24Å; R36-L48 WeakPolarHBondContact O-CA 3.42Å; L37-L48 HydrophobicContact CB-CD2 4.28Å; L37-L48 HydrophobicContact CD1-CD2 3.73Å; M46-L48 HydrophobicContact CB-CD2 4.19Å; M46-L48 HydrophobicContact CB-CG 4.39Å; L48-V51 HydrophobicContact CB-CG2 3.43Å; L48-V51 VanDerWaalsContact CB-CG2 3.43Å; L48-V51 HydrophobicContact CD1-CG2 4.5Å; L48-M78 CarbonylContact O-C 3.52Å; L48-M78 WeakPolarHBondContact O-CA 3.34Å; L48-L79 PolarHBondContact N-O 2.79Å; L48-L79 PolarHBondContact O-N 2.86Å; L48-V81 HydrophobicContact CD1-CG2 3.89Å; L48-V81 HydrophobicContact CG-CG2 4.19Å
49	G	98.7	Very high	97.1	Very high	1 Å²	1	50.3 Å²	50.3	1%	0.01	26%	0.261	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104	157.3	170.5	0	0	0	0	0	112.4	G35 R36 V51 P77	G35-G49 WeakPolarHBondContact CA-O 3.42Å; R36-G49 PolarHBondContact N-O 3.19Å; R36-G49 PolarHBondContact O-N 3.08Å; G49-V51 VanDerWaalsContact C-N 3.3Å; G49-V51 PolarHBondContact O-N 2.88Å; G49-P77 CarbonylContact C-O 3.58Å; G49-P77 WeakPolarHBondContact CA-O 3.38Å
50	D	98.5	Very high	96.8	Very high	102 Å²	102	53.8 Å²	53.8	55%	0.545	27%	0.272	S	S	.	.	E	Extended strand (participates in β ladder)	trans	49.1	47.6	175.1	-57.8	-46	0	0	0	113.3	R22 P77	R22-D50 PolarHBondContact NH1-O 2.85Å; R22-D50 PolarHBondContact NH2-O 3.44Å; D50-P77 PolarHBondContact N-O 3.33Å
51	V	98.8	Very high	96.3	Very high	0 Å²	0	53.1 Å²	53.1	0%	0	27%	0.273	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.8	126.1	-168.8	-174	0	0	0	0	110.8	L33 R34 L48 G49 N75 I76 L79	L33-V51 HydrophobicContact CB-CG1 4.1Å; L33-V51 HydrophobicContact CD2-CG1 4.04Å; R34-V51 CarbonylContact O-C 3.59Å; R34-V51 WeakPolarHBondContact O-CA 3.36Å; L48-V51 HydrophobicContact CB-CG2 3.43Å; L48-V51 VanDerWaalsContact CB-CG2 3.43Å; L48-V51 HydrophobicContact CD1-CG2 4.5Å; G49-V51 VanDerWaalsContact C-N 3.3Å; G49-V51 PolarHBondContact O-N 2.88Å; V51-N75 CarbonylContact O-C 3.58Å; V51-N75 VanDerWaalsContact O-CA 3.27Å; V51-N75 WeakPolarHBondContact O-CA 3.43Å; V51-I76 HydrophobicContact CB-CB 4.29Å; V51-I76 PolarHBondContact N-O 2.74Å; V51-I76 PolarHBondContact O-N 3.36Å; V51-L79 HydrophobicContact CG1-CD2 4.14Å; V51-L79 HydrophobicContact CG2-CB 3.98Å
52	E	98.7	Very high	96	Very high	54 Å²	54	59 Å²	59	25%	0.252	30%	0.298	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.1	117.3	157.8	-178.6	-179.2	112.3	0	0	107.9	R34 K73	R34-E52 PolarHBondContact N-O 2.65Å; R34-E52 PolarHBondContact O-N 3.3Å; E52-K73 IonicContact OE1-NZ 2.64Å; E52-K73 PolarHBondContact OE1-NZ 2.82Å
53	E	98.6	Very high	95.7	Very high	8 Å²	8	60 Å²	60	4%	0.037	30%	0.303	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.3	136.9	171.3	176.2	178.5	-86.9	0	0	109.9	R31 E32 L33 V55 K73 R74 I76	R31-E53 HydrophobicContact CG-CG 4.34Å; R31-E53 IonicContact CZ-OE1 2.76Å; R31-E53 IonicContact NE-OE1 2.65Å; R31-E53 PolarHBondContact NE-OE1 3.1Å; R31-E53 IonicContact NH2-OE1 3.86Å; R31-E53 PolarHBondContact NH2-OE1 3.14Å; E32-E53 CarbonylContact O-C 3.56Å; E32-E53 WeakPolarHBondContact O-CA 3.48Å; L33-E53 HydrophobicContact CD2-CB 3.8Å; L33-E53 HydrophobicContact CD2-CG 3.76Å; E53-V55 HydrophobicContact CG-CG2 4.01Å; E53-K73 VanDerWaalsContact O-CA 3.24Å; E53-K73 WeakPolarHBondContact O-CA 3.48Å; E53-R74 HydrophobicContact CB-CG 4.15Å; E53-R74 PolarHBondContact N-O 2.63Å; E53-R74 PolarHBondContact O-N 3.35Å; E53-R74 IonicContact OE1-NH2 2.83Å; E53-R74 IonicContact OE2-CZ 2.63Å; E53-R74 IonicContact OE2-NE 3.35Å; E53-R74 PolarHBondContact OE2-NE 3.2Å; E53-R74 IonicContact OE2-NH2 3.52Å; E53-R74 PolarHBondContact OE2-NH2 2.75Å; E53-I76 HydrophobicContact CB-CD1 4.31Å
54	T	98.5	Very high	95.5	Very high	10 Å²	10	57.7 Å²	57.7	6%	0.061	30%	0.297	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	127.5	168.8	-55.7	0	0	0	0	109	R31 E32 S71 T72 K73	R31-T54 CarbonylContact C-O 3.55Å; R31-T54 WeakPolarHBondContact CA-O 3.25Å; E32-T54 PolarHBondContact N-O 2.87Å; E32-T54 PolarHBondContact O-N 2.95Å; T54-S71 WeakPolarHBondContact CG2-OG 3.26Å; T54-T72 CarbonylContact C-O 3.57Å; T54-T72 VanDerWaalsContact CA-O 3.3Å; T54-T72 WeakPolarHBondContact CA-O 3.3Å; T54-K73 HydrophobicContact CG2-CG 4.22Å
55	V	97.4	Very high	95.2	Very high	34 Å²	34	64.7 Å²	64.7	21%	0.206	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.4	125.5	173.3	-177.1	0	0	0	0	108.5	R31 E53 T57 S71 T72	R31-V55 HydrophobicContact CB-CG2 4.34Å; R31-V55 HydrophobicContact CG-CG2 4.07Å; E53-V55 HydrophobicContact CG-CG2 4.01Å; V55-T57 HydrophobicContact CG1-CG2 4.32Å; V55-S71 WeakPolarHBondContact O-CA 3.41Å; V55-T72 PolarHBondContact N-O 2.64Å; V55-T72 PolarHBondContact O-N 2.88Å; V55-T72 PolarHBondContact O-OG1 2.87Å
56	T	96.3	Very high	94.9	Very high	42 Å²	42	69.7 Å²	69.7	26%	0.258	34%	0.344	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.3	128.2	174.3	-59.3	0	0	0	0	109.9	D30 Y69 K70	D30-T56 PolarHBondContact O-N 2.87Å; T56-Y69 HydrophobicContact CG2-CD1 4.48Å; T56-K70 CarbonylContact C-O 3.58Å; T56-K70 VanDerWaalsContact CA-O 3.29Å; T56-K70 WeakPolarHBondContact CA-O 3.37Å
57	T	93.6	Very high	94.7	Very high	59 Å²	59	75 Å²	75	36%	0.362	37%	0.37	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.2	147	175.8	55.8	0	0	0	0	110	V55 K70	V55-T57 HydrophobicContact CG1-CG2 4.32Å; T57-K70 PolarHBondContact N-O 2.83Å; T57-K70 PolarHBondContact O-N 2.67Å
58	I	92.3	Very high	94.3	Very high	93 Å²	93	76 Å²	76	48%	0.477	38%	0.375	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.1	117.4	173.1	-55.3	172.6	0	0	0	106.5	E67 Y69	I58-E67 HydrophobicContact CG2-CB 4.13Å; I58-E67 HydrophobicContact CG2-CG 4.18Å; I58-Y69 HydrophobicContact CD1-CE1 3.86Å; I58-Y69 HydrophobicContact CG1-CD1 3.97Å; I58-Y69 HydrophobicContact CG1-CE1 3.77Å
59	E	90.1	Very high	94	Very high	90 Å²	90	83 Å²	83	42%	0.421	40%	0.402	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106	142.7	171.4	-65.9	175.8	-165.8	0	0	107.3	I68 K70	E59-I68 PolarHBondContact N-O 3.02Å; E59-I68 PolarHBondContact O-N 3.36Å; E59-K70 VanDerWaalsContact OE1-CD 3.32Å; E59-K70 WeakPolarHBondContact OE1-CD 3.46Å; E59-K70 IonicContact OE1-NZ 3.44Å; E59-K70 PolarHBondContact OE1-NZ 3.18Å
60	I	90.6	Very high	93.8	Very high	116 Å²	116	87.5 Å²	87.5	60%	0.595	42%	0.421	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-102.9	125.9	174.4	-60.2	173.6	0	0	0	106.9	E62	I60-E62 PolarHBondContact O-N 2.77Å
61	D	88.6	Confident	93.7	Very high	52 Å²	52	86.1 Å²	86.1	28%	0.278	42%	0.419	S	S	.	.			trans	-66.8	122.3	172.3	-170.1	-62.7	0	0	0	109.5	E63 T64 Y65 E66 I68	D61-E63 PolarHBondContact O-N 3.47Å; D61-E63 WeakPolarHBondContact OD1-CA 3.47Å; D61-E63 WeakPolarHBondContact OD1-CB 3.38Å; D61-E63 PolarHBondContact OD1-N 2.88Å; D61-T64 VanDerWaalsContact CB-OG1 3.23Å; D61-T64 WeakPolarHBondContact CB-OG1 3.38Å; D61-T64 VanDerWaalsContact CG-OG1 3.26Å; D61-T64 PolarHBondContact OD1-N 3.01Å; D61-T64 PolarHBondContact OD1-OG1 3.02Å; D61-Y65 WeakPolarHBondContact O-CA 3.27Å; D61-Y65 PolarHBondContact O-N 2.85Å; D61-E66 PolarHBondContact N-O 3.37Å; D61-I68 HydrophobicContact CB-CD1 3.97Å
62	E	90.4	Very high	93.6	Very high	183 Å²	183	89.5 Å²	89.5	86%	0.855	44%	0.44	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.4	-20.7	-175.7	-63.9	-175.4	170.7	0	0	113.2	I60	I60-E62 PolarHBondContact O-N 2.77Å
63	E	90.9	Very high	93.5	Very high	175 Å²	175	93.3 Å²	93.3	82%	0.818	46%	0.456	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93.6	-44.9	-179.5	-172.5	173.9	178.8	0	0	111.4	D61	D61-E63 PolarHBondContact O-N 3.47Å; D61-E63 WeakPolarHBondContact OD1-CA 3.47Å; D61-E63 WeakPolarHBondContact OD1-CB 3.38Å; D61-E63 PolarHBondContact OD1-N 2.88Å
64	T	92.6	Very high	93.5	Very high	68 Å²	68	99.8 Å²	99.8	42%	0.417	48%	0.48	S	S	.	.	T	Hydrogen-bonded Turn	trans	-96.5	-13.8	-175.3	70.6	0	0	0	0	113.9	D61 E66	D61-T64 VanDerWaalsContact CB-OG1 3.23Å; D61-T64 WeakPolarHBondContact CB-OG1 3.38Å; D61-T64 VanDerWaalsContact CG-OG1 3.26Å; D61-T64 PolarHBondContact OD1-N 3.01Å; D61-T64 PolarHBondContact OD1-OG1 3.02Å; T64-E66 PolarHBondContact O-N 2.82Å; T64-E66 WeakPolarHBondContact OG1-CB 3.29Å; T64-E66 WeakPolarHBondContact OG1-CG 3.09Å; T64-E66 PolarHBondContact OG1-N 3.19Å
65	Y	89.6	Confident	93.5	Very high	189 Å²	189	105.6 Å²	105.6	74%	0.741	51%	0.511	S	S	*	.			trans	57.9	18.9	-171.9	-61.1	-89.8	0	0	0	114.1	D61	D61-Y65 WeakPolarHBondContact O-CA 3.27Å; D61-Y65 PolarHBondContact O-N 2.85Å
66	E	93.9	Very high	93.6	Very high	130 Å²	130	105.3 Å²	105.3	61%	0.607	51%	0.508	S	S	*	.	P	Polyproline II helix	trans	-82.4	145.6	177.7	-66	-177.4	160.5	0	0	111.4	D61 T64	D61-E66 PolarHBondContact N-O 3.37Å; T64-E66 PolarHBondContact O-N 2.82Å; T64-E66 WeakPolarHBondContact OG1-CB 3.29Å; T64-E66 WeakPolarHBondContact OG1-CG 3.09Å; T64-E66 PolarHBondContact OG1-N 3.19Å
67	E	92.4	Very high	93.7	Very high	114 Å²	114	108.2 Å²	108.2	53%	0.533	53%	0.527	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.2	118	172.8	-68.8	-176.1	173.9	0	0	110.7	I58 Y69	I58-E67 HydrophobicContact CG2-CB 4.13Å; I58-E67 HydrophobicContact CG2-CG 4.18Å; E67-Y69 HydrophobicContact CB-CE2 3.95Å; E67-Y69 PolarHBondContact OE2-OH 2.85Å
68	I	91.6	Very high	93.9	Very high	77 Å²	77	110.3 Å²	110.3	40%	0.395	54%	0.535	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.5	116.8	176.4	-57.4	176.2	0	0	0	109	E59 D61	E59-I68 PolarHBondContact N-O 3.02Å; E59-I68 PolarHBondContact O-N 3.36Å; D61-I68 HydrophobicContact CB-CD1 3.97Å
69	Y	92.5	Very high	94.2	Very high	145 Å²	145	107.3 Å²	107.3	57%	0.569	52%	0.519	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-89.6	112.9	176.1	-65.8	-98.1	0	0	0	109.9	T56 I58 E67	T56-Y69 HydrophobicContact CG2-CD1 4.48Å; I58-Y69 HydrophobicContact CD1-CE1 3.86Å; I58-Y69 HydrophobicContact CG1-CD1 3.97Å; I58-Y69 HydrophobicContact CG1-CE1 3.77Å; E67-Y69 HydrophobicContact CB-CE2 3.95Å; E67-Y69 PolarHBondContact OE2-OH 2.85Å
70	K	94.3	Very high	94.6	Very high	97 Å²	97	109 Å²	109	42%	0.422	53%	0.526	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111	127.8	179.8	-172	178.3	-176.3	174.7	0	110.4	T56 T57 E59	T56-K70 CarbonylContact C-O 3.58Å; T56-K70 VanDerWaalsContact CA-O 3.29Å; T56-K70 WeakPolarHBondContact CA-O 3.37Å; T57-K70 PolarHBondContact N-O 2.83Å; T57-K70 PolarHBondContact O-N 2.67Å; E59-K70 VanDerWaalsContact OE1-CD 3.32Å; E59-K70 WeakPolarHBondContact OE1-CD 3.46Å; E59-K70 IonicContact OE1-NZ 3.44Å; E59-K70 PolarHBondContact OE1-NZ 3.18Å
71	S	95.6	Very high	95	Very high	72 Å²	72	103.8 Å²	103.8	50%	0.503	50%	0.499	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111	126.4	177	-162.4	0	0	0	0	110.2	T54 V55	T54-S71 WeakPolarHBondContact CG2-OG 3.26Å; V55-S71 WeakPolarHBondContact O-CA 3.41Å
72	T	96.9	Very high	95.4	Very high	72 Å²	72	108.5 Å²	108.5	44%	0.442	51%	0.513	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.1	139.3	175.9	58.2	0	0	0	0	110.1	T54 V55	T54-T72 CarbonylContact C-O 3.57Å; T54-T72 VanDerWaalsContact CA-O 3.3Å; T54-T72 WeakPolarHBondContact CA-O 3.3Å; V55-T72 PolarHBondContact N-O 2.64Å; V55-T72 PolarHBondContact O-N 2.88Å; V55-T72 PolarHBondContact O-OG1 2.87Å
73	K	98	Very high	95.8	Very high	133 Å²	133	100.2 Å²	100.2	58%	0.578	48%	0.476	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-121.6	140.8	179	-66.8	-167.5	171.3	-156	0	111.6	E52 E53 T54	E52-K73 IonicContact OE1-NZ 2.64Å; E52-K73 PolarHBondContact OE1-NZ 2.82Å; E53-K73 VanDerWaalsContact O-CA 3.24Å; E53-K73 WeakPolarHBondContact O-CA 3.48Å; T54-K73 HydrophobicContact CG2-CG 4.22Å
74	R	97.9	Very high	96.1	Very high	144 Å²	144	96.4 Å²	96.4	54%	0.543	46%	0.462	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.8	153.3	169.7	65.1	176.2	176.4	176.5	-0.9	111.8	E53 I76	E53-R74 HydrophobicContact CB-CG 4.15Å; E53-R74 PolarHBondContact N-O 2.63Å; E53-R74 PolarHBondContact O-N 3.35Å; E53-R74 IonicContact OE1-NH2 2.83Å; E53-R74 IonicContact OE2-CZ 2.63Å; E53-R74 IonicContact OE2-NE 3.35Å; E53-R74 PolarHBondContact OE2-NE 3.2Å; E53-R74 IonicContact OE2-NH2 3.52Å; E53-R74 PolarHBondContact OE2-NH2 2.75Å; R74-I76 HydrophobicContact CG-CD1 4.48Å; R74-I76 HydrophobicContact CG-CG1 4.31Å
75	N	98.5	Very high	96.3	Very high	132 Å²	132	94.1 Å²	94.1	71%	0.706	45%	0.452	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-99.2	135.7	174.2	-64.7	-32.2	0	0	0	110.2	V51	V51-N75 CarbonylContact O-C 3.58Å; V51-N75 VanDerWaalsContact O-CA 3.27Å; V51-N75 WeakPolarHBondContact O-CA 3.43Å
76	I	98.6	Very high	96.7	Very high	28 Å²	28	86.3 Å²	86.3	14%	0.144	42%	0.423	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129	117.1	-179.1	-52.4	172.7	0	0	0	107.5	V51 E53 R74 M78 L79	V51-I76 HydrophobicContact CB-CB 4.29Å; V51-I76 PolarHBondContact N-O 2.74Å; V51-I76 PolarHBondContact O-N 3.36Å; E53-I76 HydrophobicContact CB-CD1 4.31Å; R74-I76 HydrophobicContact CG-CD1 4.48Å; R74-I76 HydrophobicContact CG-CG1 4.31Å; I76-M78 VanDerWaalsContact C-N 3.32Å; I76-M78 WeakPolarHBondContact CG2-O 3.24Å; I76-M78 PolarHBondContact O-N 2.67Å; I76-L79 HydrophobicContact CD1-CD1 4.36Å; I76-L79 HydrophobicContact CD1-CD2 4.35Å; I76-L79 HydrophobicContact CG2-CB 4.22Å
77	P	98.3	Very high	96.9	Very high	103 Å²	103	84.7 Å²	84.7	67%	0.669	42%	0.422	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-58.8	-41.5	-176.9	-27.2	35.1	0	0	0	113.6	G49 D50	G49-P77 CarbonylContact C-O 3.58Å; G49-P77 WeakPolarHBondContact CA-O 3.38Å; D50-P77 PolarHBondContact N-O 3.33Å
78	M	98.3	Very high	97.1	Very high	104 Å²	104	83.5 Å²	83.5	51%	0.512	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-145	134.8	178.7	-76	-67.2	-72.7	0	0	110	I47 L48 I76	I47-M78 HydrophobicContact CG2-CE 3.38Å; L48-M78 CarbonylContact O-C 3.52Å; L48-M78 WeakPolarHBondContact O-CA 3.34Å; I76-M78 VanDerWaalsContact C-N 3.32Å; I76-M78 WeakPolarHBondContact CG2-O 3.24Å; I76-M78 PolarHBondContact O-N 2.67Å
79	L	98.4	Very high	97.4	Very high	29 Å²	29	81.3 Å²	81.3	15%	0.152	41%	0.409	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.1	126.9	-177.3	-177.9	65.6	0	0	0	110.7	L33 L48 V51 I76 V81	L33-L79 HydrophobicContact CD1-CD2 3.87Å; L33-L79 HydrophobicContact CD2-CD2 3.92Å; L48-L79 PolarHBondContact N-O 2.79Å; L48-L79 PolarHBondContact O-N 2.86Å; V51-L79 HydrophobicContact CG1-CD2 4.14Å; V51-L79 HydrophobicContact CG2-CB 3.98Å; I76-L79 HydrophobicContact CD1-CD1 4.36Å; I76-L79 HydrophobicContact CD1-CD2 4.35Å; I76-L79 HydrophobicContact CG2-CB 4.22Å; L79-V81 HydrophobicContact CD2-CG2 3.87Å; L79-V81 HydrophobicContact CG-CG2 3.96Å
80	F	98.4	Very high	97.5	Very high	127 Å²	127	76 Å²	76	56%	0.557	40%	0.395	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.3	127.8	162.2	173.2	-97.7	0	0	0	109.3	N45 M46 I47 R82	N45-F80 HydrophobicContact CB-CE2 4.01Å; N45-F80 HydrophobicContact CB-CZ 4.08Å; M46-F80 WeakPolarHBondContact O-CA 3.32Å; I47-F80 HydrophobicContact CD1-CB 4.15Å; I47-F80 HydrophobicContact CD1-CD2 3.67Å; I47-F80 HydrophobicContact CD1-CG 4.4Å; F80-R82 HydrophobicContact CE1-CB 4.33Å
81	V	98.4	Very high	97.4	Very high	5 Å²	5	73.5 Å²	73.5	3%	0.03	39%	0.389	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.5	128.4	178.4	-178.1	0	0	0	0	108.4	M27 L33 N45 M46 L48 L79 V86	M27-V81 HydrophobicContact CE-CG1 3.51Å; M27-V81 HydrophobicContact SD-CG1 3.7Å; L33-V81 HydrophobicContact CD1-CG1 4.31Å; L33-V81 HydrophobicContact CD1-CG2 3.6Å; N45-V81 CarbonylContact C-O 3.49Å; N45-V81 VanDerWaalsContact CA-O 3.25Å; N45-V81 WeakPolarHBondContact CA-O 3.47Å; M46-V81 HydrophobicContact CB-CB 4.26Å; M46-V81 HydrophobicContact CE-CG1 4.49Å; M46-V81 PolarHBondContact N-O 3.24Å; M46-V81 PolarHBondContact O-N 2.87Å; L48-V81 HydrophobicContact CD1-CG2 3.89Å; L48-V81 HydrophobicContact CG-CG2 4.19Å; L79-V81 HydrophobicContact CD2-CG2 3.87Å; L79-V81 HydrophobicContact CG-CG2 3.96Å; V81-V86 HydrophobicContact CG1-CG2 4.13Å
82	R	98.2	Very high	97	Very high	152 Å²	152	71.8 Å²	71.8	57%	0.574	38%	0.376	S	S	*	.			trans	-85.2	133.7	174.2	-174.2	178.7	175	85.7	7.4	110.6	N45 F80 D84 G85	N45-R82 WeakPolarHBondContact OD1-CA 3.24Å; F80-R82 HydrophobicContact CE1-CB 4.33Å; R82-D84 HydrophobicContact CG-CB 4.48Å; R82-D84 IonicContact CZ-OD2 2.77Å; R82-D84 IonicContact NE-OD2 3.09Å; R82-D84 PolarHBondContact NE-OD2 3.03Å; R82-D84 IonicContact NH2-OD2 2.67Å; R82-D84 PolarHBondContact NH2-OD2 2.86Å; R82-D84 PolarHBondContact O-N 3.37Å; R82-G85 PolarHBondContact O-N 2.71Å
83	G	97.9	Very high	96.3	Very high	9 Å²	9	76.4 Å²	76.4	9%	0.093	40%	0.397	C	S	.	.	G	3₁₀ helix	trans	-61.4	-33.4	-175.9	0	0	0	0	0	115.5	H43 L44 N45 G85 V86	H43-G83 VanDerWaalsContact O-CA 3.29Å; H43-G83 WeakPolarHBondContact O-CA 3.15Å; L44-G83 VanDerWaalsContact O-CA 3.28Å; L44-G83 WeakPolarHBondContact O-CA 3.45Å; N45-G83 PolarHBondContact OD1-N 2.85Å; G83-G85 PolarHBondContact O-N 2.76Å; G83-V86 WeakPolarHBondContact O-CB 3.17Å; G83-V86 PolarHBondContact O-N 2.89Å
84	D	98.1	Very high	95.2	Very high	95 Å²	95	76 Å²	76	51%	0.508	39%	0.392	S	S	.	.	G	3₁₀ helix	trans	-56.4	-29.1	180	-63.2	-16.9	0	0	0	113.6	R28 R82	R28-D84 VanDerWaalsContact CZ-O 3.3Å; R28-D84 PolarHBondContact NE-O 2.88Å; R28-D84 VanDerWaalsContact NE-O 3.14Å; R28-D84 PolarHBondContact NH2-O 2.93Å; R28-D84 VanDerWaalsContact NH2-O 3.1Å; R82-D84 HydrophobicContact CG-CB 4.48Å; R82-D84 IonicContact CZ-OD2 2.77Å; R82-D84 IonicContact NE-OD2 3.09Å; R82-D84 PolarHBondContact NE-OD2 3.03Å; R82-D84 IonicContact NH2-OD2 2.67Å; R82-D84 PolarHBondContact NH2-OD2 2.86Å; R82-D84 PolarHBondContact O-N 3.37Å
85	G	97.1	Very high	93.4	Very high	20 Å²	20	75.9 Å²	75.9	21%	0.206	41%	0.407	C	S	.	.	G	3₁₀ helix	trans	-88.6	-8.6	-179.5	0	0	0	0	0	114.3	M27 R28 R82 G83	M27-G85 CarbonylContact C-O 3.5Å; M27-G85 VanDerWaalsContact CA-O 3.23Å; M27-G85 WeakPolarHBondContact CA-O 3.46Å; M27-G85 VanDerWaalsContact CE-C 3.47Å; R28-G85 PolarHBondContact N-O 2.9Å; R82-G85 PolarHBondContact O-N 2.71Å; G83-G85 PolarHBondContact O-N 2.76Å
86	V	97.9	Very high	91.1	Very high	24 Å²	24	76.5 Å²	76.5	15%	0.145	45%	0.445	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.3	132.2	-178.3	179.3	0	0	0	0	109.2	V25 M27 M46 V81 G83 V89	V25-V86 HydrophobicContact CG1-CG1 4Å; V25-V86 HydrophobicContact CG1-CG2 4.23Å; M27-V86 HydrophobicContact CE-CG2 4.17Å; M27-V86 HydrophobicContact SD-CB 4.36Å; M27-V86 HydrophobicContact SD-CG2 3.73Å; M46-V86 HydrophobicContact CE-CB 4.49Å; M46-V86 HydrophobicContact CE-CG1 4.19Å; M46-V86 HydrophobicContact CE-CG2 3.5Å; V81-V86 HydrophobicContact CG1-CG2 4.13Å; G83-V86 WeakPolarHBondContact O-CB 3.17Å; G83-V86 PolarHBondContact O-N 2.89Å; V86-V89 HydrophobicContact CG1-CG2 3.59Å
87	V	97.9	Very high	90.8	Very high	97 Å²	97	79 Å²	79	59%	0.588	46%	0.46	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109.3	-41.7	176.4	179.1	0	0	0	0	110.4	K26 R28	K26-V87 PolarHBondContact O-N 2.83Å; R28-V87 HydrophobicContact CG-CG2 3.71Å
88	L	97.1	Very high	90.4	Very high	88 Å²	88	77.7 Å²	77.7	46%	0.461	45%	0.449	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.6	141.9	-179.6	175.7	149.5	0	0	0	110	Y24 V25 K26 A90	Y24-L88 HydrophobicContact CD1-CD2 3.9Å; Y24-L88 HydrophobicContact CE1-CD2 3.89Å; V25-L88 CarbonylContact C-O 3.48Å; V25-L88 WeakPolarHBondContact CA-O 3.23Å; K26-L88 HydrophobicContact CB-CB 4.15Å; K26-L88 PolarHBondContact N-O 3.22Å; K26-L88 PolarHBondContact O-N 3.44Å; L88-A90 HydrophobicContact CD2-CB 4.06Å
89	V	97.1	Very high	89.9	Confident	31 Å²	31	76.2 Å²	76.2	19%	0.188	45%	0.445	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.4	126.2	168.6	-173.9	0	0	0	0	108.1	I15 I23 Y24 V25 M46 V86	I15-V89 HydrophobicContact CD1-CB 3.97Å; I15-V89 HydrophobicContact CD1-CG1 3.58Å; I23-V89 HydrophobicContact CD1-CG1 3.97Å; Y24-V89 WeakPolarHBondContact O-CA 3.42Å; V25-V89 HydrophobicContact CG1-CG2 4.4Å; V25-V89 HydrophobicContact CG2-CG1 4.39Å; M46-V89 HydrophobicContact CE-CG2 4.05Å; V86-V89 HydrophobicContact CG1-CG2 3.59Å
90	A	95.8	Very high	89.4	Confident	33 Å²	33	79 Å²	79	27%	0.273	46%	0.463	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.9	120.4	174.3	0	0	0	0	0	109.9	Y24 L88	Y24-A90 HydrophobicContact CD1-CB 4.09Å; Y24-A90 PolarHBondContact N-O 2.86Å; Y24-A90 PolarHBondContact O-N 3.4Å; L88-A90 HydrophobicContact CD2-CB 4.06Å
91	P	90.5	Very high	88.8	Confident	46 Å²	46	76 Å²	76	30%	0.299	46%	0.457	S	S	.	.			trans	-67.3	165.4	172.6	30.9	-35	0	0	0	110.7	S18	S18-P91 VanDerWaalsContact OG-CB 3.27Å; S18-P91 WeakPolarHBondContact OG-CB 3.29Å
92	P	88	Confident	88.2	Confident	35 Å²	35	80.7 Å²	80.7	23%	0.227	49%	0.485	C	S	.	.			trans	-59.7	150.9	174.2	26.8	-35.8	0	0	0	111.4	E21 R94	E21-P92 HydrophobicContact CB-CG 3.86Å; E21-P92 VanDerWaalsContact CD-CG 3.43Å; E21-P92 HydrophobicContact CG-CG 4.26Å; E21-P92 WeakPolarHBondContact OE2-CG 3.43Å; P92-R94 PolarHBondContact O-N 3.35Å
93	L	81.7	Confident	87.5	Confident	169 Å²	169	75.6 Å²	75.6	89%	0.885	48%	0.479	S	S	*	.			trans	-65.2	106.5	171	-69.1	170.7	0	0	0	108.5	V95	L93-V95 PolarHBondContact O-N 3.44Å
94	R	74.6	Confident	86.7	Confident	125 Å²	125	80.8 Å²	80.8	47%	0.472	51%	0.509	S	S	.	.			trans	-78.4	99.6	170.7	-64.8	-174.9	177.2	93	11.7	107.2	L17 S18 E21 P92 G96	L17-R94 PolarHBondContact O-NH2 2.83Å; L17-R94 VanDerWaalsContact O-NH2 3.15Å; S18-R94 PolarHBondContact OG-NH2 2.97Å; E21-R94 IonicContact OE2-CZ 3.6Å; E21-R94 IonicContact OE2-NH2 3.17Å; E21-R94 PolarHBondContact OE2-NH2 3.36Å; P92-R94 PolarHBondContact O-N 3.35Å; R94-G96 PolarHBondContact O-N 2.89Å
95	V	60.2	Low	85.8	Confident	141 Å²	141	79.6 Å²	79.6	86%	0.855	51%	0.509	S	S	*	.			trans	-72.3	117.2	170.1	-147.2	0	0	0	0	106.2	L93	L93-V95 PolarHBondContact O-N 3.44Å
96	G	51.3	Low	84.7	Confident	146 Å²	146	85 Å²	85	100%	1.505	54%	0.536	S	S	*	.			trans	-71	0	179.4	0	0	0	0	0	113.4	R94	R94-G96 PolarHBondContact O-N 2.89Å

Retrieved 96 of 96 residues in 72.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).