A0A093JU61_STRCA Loading...

Coiled-coil domain-containing protein 126

AlphaFold DB , UniProt , Accession A0A093JU61, Species STRCA (Struthio camelus australis), Gene n/a, Length 139 aa.

						>A0A093JU61_STRCA|A0A093JU61
MFLTFSRKSMSQKLSLFLLVFGIIWGLMLLRYTFQYPRRQSSAELREQILDLSKRYVKALAEENKNLMNGGSGASMAGYADLKRTIAVLLDDILQRLVKLESKVDYIVVNGSAANTTNGTSNQVPLASSKRVNAASNIR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	40.4	Very low	53.4	Low	227 Å²	227	141 Å²	141	100%	1.118	72%	0.719	S	S	*	*				0	76.9	0	-167.3	170.3	-179.5	0	0	108.7
2	F	46.3	Very low	55.1	Low	192 Å²	192	135.7 Å²	135.7	84%	0.842	69%	0.689	S	S	*	*			trans	-127.7	40.8	-176.9	-67.4	-77.8	0	0	0	110.6	T4	F2-T4 PolarHBondContact O-N 3.35Å
3	L	57.1	Low	56.7	Low	164 Å²	164	134.4 Å²	134.4	86%	0.859	68%	0.676	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.3	110.5	174.6	-95.4	79.9	0	0	0	108.8
4	T	52.8	Low	58.5	Low	102 Å²	102	132.4 Å²	132.4	63%	0.626	67%	0.667	S	S	*	*	T	Hydrogen-bonded Turn	trans	166.2	25.3	142.2	44	0	0	0	0	111.1	F2 S6 K8	F2-T4 PolarHBondContact O-N 3.35Å; T4-S6 PolarHBondContact O-N 3.44Å; T4-K8 WeakPolarHBondContact O-CB 3.19Å; T4-K8 WeakPolarHBondContact O-CD 2.96Å; T4-K8 WeakPolarHBondContact O-CE 3.21Å; T4-K8 WeakPolarHBondContact O-CG 3.21Å; T4-K8 WeakPolarHBondContact OG1-CE 2.98Å
5	F	52.7	Low	60.1	Low	157 Å²	157	128.7 Å²	128.7	69%	0.689	66%	0.659	S	S	*	*	S	Bend	trans	-68.9	-5.1	-171	-129.5	-80.7	0	0	0	117.3	K8	F5-K8 VanDerWaalsContact C-CB 3.48Å; F5-K8 HydrophobicContact CB-CD 4.39Å; F5-K8 HydrophobicContact CD1-CD 4.39Å; F5-K8 HydrophobicContact CD2-CD 4.15Å; F5-K8 HydrophobicContact CG-CD 4.05Å; F5-K8 VanDerWaalsContact O-CB 3.31Å; F5-K8 WeakPolarHBondContact O-CB 3.31Å
6	S	48.3	Very low	61.5	Low	122 Å²	122	127.1 Å²	127.1	85%	0.853	65%	0.651	S	S	*	*	S	Bend	trans	-117.3	-23.2	-168.7	-157.2	0	0	0	0	116.9	T4 K8	T4-S6 PolarHBondContact O-N 3.44Å; S6-K8 PolarHBondContact O-N 3.21Å; S6-K8 VanDerWaalsContact O-N 3.16Å
7	R	51	Low	63.1	Low	242 Å²	242	128 Å²	128	91%	0.913	65%	0.65	S	S	*	*	S	Bend	trans	-81.1	12.9	165	-146.8	175	-166.2	-173.6	3.3	112.2
8	K	55.8	Low	64.5	Low	41 Å²	41	127.1 Å²	127.1	18%	0.178	65%	0.646	C	S	.	*	H	α-helix	trans	-97.7	-14.4	-142.6	-137.9	-167.6	-130	151.2	0	113	T4 F5 S6 M10 Q12	T4-K8 WeakPolarHBondContact O-CB 3.19Å; T4-K8 WeakPolarHBondContact O-CD 2.96Å; T4-K8 WeakPolarHBondContact O-CE 3.21Å; T4-K8 WeakPolarHBondContact O-CG 3.21Å; T4-K8 WeakPolarHBondContact OG1-CE 2.98Å; F5-K8 VanDerWaalsContact C-CB 3.48Å; F5-K8 HydrophobicContact CB-CD 4.39Å; F5-K8 HydrophobicContact CD1-CD 4.39Å; F5-K8 HydrophobicContact CD2-CD 4.15Å; F5-K8 HydrophobicContact CG-CD 4.05Å; F5-K8 VanDerWaalsContact O-CB 3.31Å; F5-K8 WeakPolarHBondContact O-CB 3.31Å; S6-K8 PolarHBondContact O-N 3.21Å; S6-K8 VanDerWaalsContact O-N 3.16Å; K8-M10 PolarHBondContact O-N 3.23Å; K8-Q12 VanDerWaalsContact CD-OE1 3.25Å; K8-Q12 HydrophobicContact CG-CB 4.14Å; K8-Q12 VanDerWaalsContact O-CA 3.32Å; K8-Q12 WeakPolarHBondContact O-CA 3.4Å; K8-Q12 WeakPolarHBondContact O-CB 3.04Å; K8-Q12 PolarHBondContact O-N 3.06Å
9	S	61.6	Low	65.8	Low	83 Å²	83	126.5 Å²	126.5	58%	0.58	64%	0.644	S	S	*	*	H	α-helix	trans	-64.2	-44	-176.2	64	0	0	0	0	112.8	K13	S9-K13 WeakPolarHBondContact O-CB 3.07Å; S9-K13 VanDerWaalsContact O-CD 3.27Å; S9-K13 WeakPolarHBondContact O-CD 3.44Å; S9-K13 WeakPolarHBondContact O-CG 3.19Å; S9-K13 PolarHBondContact O-N 3.28Å
10	M	57.8	Low	67	Low	141 Å²	141	123.8 Å²	123.8	70%	0.695	63%	0.634	S	S	*	*	H	α-helix	trans	-80.9	-39	-177.9	-145.1	59.8	173.6	0	0	112.8	K8 K13 L14	K8-M10 PolarHBondContact O-N 3.23Å; M10-K13 HydrophobicContact SD-CD 4.31Å; M10-L14 WeakPolarHBondContact O-CB 3.27Å; M10-L14 PolarHBondContact O-N 3.44Å
11	S	63.8	Low	68.1	Low	80 Å²	80	123.9 Å²	123.9	56%	0.559	63%	0.63	S	S	*	*	H	α-helix	trans	-72.3	-32.7	175	-177.1	0	0	0	0	112.8	S15	S11-S15 WeakPolarHBondContact O-CB 3.13Å; S11-S15 PolarHBondContact O-N 3.25Å
12	Q	73.3	Confident	70.5	Confident	77 Å²	77	115.1 Å²	115.1	36%	0.36	60%	0.598	S	S	.	*	H	α-helix	trans	-75.2	-38.4	174.5	-172.6	178.4	-33.8	0	0	110.6	K8 S15 L16	K8-Q12 VanDerWaalsContact CD-OE1 3.25Å; K8-Q12 HydrophobicContact CG-CB 4.14Å; K8-Q12 VanDerWaalsContact O-CA 3.32Å; K8-Q12 WeakPolarHBondContact O-CA 3.4Å; K8-Q12 WeakPolarHBondContact O-CB 3.04Å; K8-Q12 PolarHBondContact O-N 3.06Å; Q12-S15 PolarHBondContact O-N 3.16Å; Q12-L16 HydrophobicContact CG-CD1 4.41Å; Q12-L16 WeakPolarHBondContact O-CB 3.2Å; Q12-L16 PolarHBondContact O-N 3.35Å
13	K	75.8	Confident	72.5	Confident	119 Å²	119	110.3 Å²	110.3	52%	0.517	58%	0.58	S	S	.	*	H	α-helix	trans	-58.9	-49.9	168.7	-78.3	171.4	-175.9	-168.5	0	109.9	S9 M10 S15 L16 F17	S9-K13 WeakPolarHBondContact O-CB 3.07Å; S9-K13 VanDerWaalsContact O-CD 3.27Å; S9-K13 WeakPolarHBondContact O-CD 3.44Å; S9-K13 WeakPolarHBondContact O-CG 3.19Å; S9-K13 PolarHBondContact O-N 3.28Å; M10-K13 HydrophobicContact SD-CD 4.31Å; K13-S15 PolarHBondContact O-N 2.76Å; K13-L16 WeakPolarHBondContact O-CB 3.2Å; K13-L16 PolarHBondContact O-N 2.9Å; K13-F17 HydrophobicContact CB-CD2 4.3Å; K13-F17 HydrophobicContact CB-CE2 4.23Å; K13-F17 WeakPolarHBondContact O-CB 3.49Å; K13-F17 WeakPolarHBondContact O-CD2 3.25Å; K13-F17 WeakPolarHBondContact O-CG 3.4Å; K13-F17 PolarHBondContact O-N 2.78Å
14	L	82.9	Confident	74	Confident	106 Å²	106	106.8 Å²	106.8	56%	0.555	56%	0.561	S	S	*	*	H	α-helix	trans	-60.5	-43.5	177.6	-170.6	65.6	0	0	0	111.5	M10 L16 F17 L18	M10-L14 WeakPolarHBondContact O-CB 3.27Å; M10-L14 PolarHBondContact O-N 3.44Å; L14-L16 PolarHBondContact O-N 3.32Å; L14-F17 CarbonylContact O-C 3.57Å; L14-F17 WeakPolarHBondContact O-CB 2.98Å; L14-F17 PolarHBondContact O-N 3Å; L14-L18 HydrophobicContact CD1-CD1 3.82Å; L14-L18 HydrophobicContact CG-CD1 3.64Å; L14-L18 WeakPolarHBondContact O-CD1 3.36Å; L14-L18 PolarHBondContact O-N 2.83Å
15	S	82.2	Confident	75.5	Confident	77 Å²	77	109.1 Å²	109.1	54%	0.538	56%	0.558	S	S	.	*	H	α-helix	trans	-64.1	-38.7	175.3	-177.4	0	0	0	0	112.5	S11 Q12 K13 L18 L19	S11-S15 WeakPolarHBondContact O-CB 3.13Å; S11-S15 PolarHBondContact O-N 3.25Å; Q12-S15 PolarHBondContact O-N 3.16Å; K13-S15 PolarHBondContact O-N 2.76Å; S15-L18 PolarHBondContact O-N 2.97Å; S15-L19 WeakPolarHBondContact O-CB 3.36Å; S15-L19 PolarHBondContact O-N 3.43Å
16	L	83.1	Confident	77.3	Confident	103 Å²	103	103.5 Å²	103.5	54%	0.539	54%	0.544	S	S	.	.	H	α-helix	trans	-65.1	-43.6	172.6	-118.5	92.2	0	0	0	110.4	Q12 K13 L14 L19 V20	Q12-L16 HydrophobicContact CG-CD1 4.41Å; Q12-L16 WeakPolarHBondContact O-CB 3.2Å; Q12-L16 PolarHBondContact O-N 3.35Å; K13-L16 WeakPolarHBondContact O-CB 3.2Å; K13-L16 PolarHBondContact O-N 2.9Å; L14-L16 PolarHBondContact O-N 3.32Å; L16-L19 PolarHBondContact O-N 3.3Å; L16-V20 WeakPolarHBondContact O-CB 2.78Å; L16-V20 VanDerWaalsContact O-CG2 3.25Å; L16-V20 WeakPolarHBondContact O-CG2 3.32Å; L16-V20 PolarHBondContact O-N 2.91Å
17	F	88.6	Confident	79	Confident	143 Å²	143	102.5 Å²	102.5	63%	0.627	53%	0.529	S	S	*	.	H	α-helix	trans	-61.6	-43.1	176.7	-81.2	-65.4	0	0	0	111.2	K13 L14 V20 F21	K13-F17 HydrophobicContact CB-CD2 4.3Å; K13-F17 HydrophobicContact CB-CE2 4.23Å; K13-F17 WeakPolarHBondContact O-CB 3.49Å; K13-F17 WeakPolarHBondContact O-CD2 3.25Å; K13-F17 WeakPolarHBondContact O-CG 3.4Å; K13-F17 PolarHBondContact O-N 2.78Å; L14-F17 CarbonylContact O-C 3.57Å; L14-F17 WeakPolarHBondContact O-CB 2.98Å; L14-F17 PolarHBondContact O-N 3Å; F17-V20 PolarHBondContact O-N 3.44Å; F17-F21 WeakPolarHBondContact O-CB 2.98Å; F17-F21 PolarHBondContact O-N 3.4Å
18	L	87.4	Confident	80.5	Confident	111 Å²	111	96.3 Å²	96.3	58%	0.581	51%	0.512	S	S	*	.	H	α-helix	trans	-66.3	-39.6	175.3	-90.8	94.6	0	0	0	112.1	L14 S15 G22	L14-L18 HydrophobicContact CD1-CD1 3.82Å; L14-L18 HydrophobicContact CG-CD1 3.64Å; L14-L18 WeakPolarHBondContact O-CD1 3.36Å; L14-L18 PolarHBondContact O-N 2.83Å; S15-L18 PolarHBondContact O-N 2.97Å; L18-G22 PolarHBondContact O-N 2.75Å
19	L	90.1	Very high	81.7	Confident	116 Å²	116	99.4 Å²	99.4	61%	0.607	53%	0.53	S	S	*	.	H	α-helix	trans	-62.7	-48.5	176.1	-169.7	87.3	0	0	0	110.7	S15 L16 G22 I23	S15-L19 WeakPolarHBondContact O-CB 3.36Å; S15-L19 PolarHBondContact O-N 3.43Å; L16-L19 PolarHBondContact O-N 3.3Å; L19-G22 PolarHBondContact O-N 3.26Å; L19-I23 HydrophobicContact CG-CD1 4.23Å; L19-I23 VanDerWaalsContact O-CG1 3.25Å; L19-I23 WeakPolarHBondContact O-CG1 3.49Å; L19-I23 PolarHBondContact O-N 3.29Å
20	V	88.9	Confident	82.6	Confident	73 Å²	73	99.6 Å²	99.6	44%	0.442	52%	0.524	S	S	.	.	H	α-helix	trans	-64.8	-45	178.5	171.5	0	0	0	0	110.7	L16 F17 G22 I23 I24	L16-V20 WeakPolarHBondContact O-CB 2.78Å; L16-V20 VanDerWaalsContact O-CG2 3.25Å; L16-V20 WeakPolarHBondContact O-CG2 3.32Å; L16-V20 PolarHBondContact O-N 2.91Å; F17-V20 PolarHBondContact O-N 3.44Å; V20-G22 VanDerWaalsContact C-N 3.34Å; V20-G22 PolarHBondContact O-N 3.4Å; V20-I23 PolarHBondContact O-N 2.8Å; V20-I24 HydrophobicContact CG1-CD1 3.67Å; V20-I24 WeakPolarHBondContact O-CD1 3.48Å; V20-I24 PolarHBondContact O-N 2.91Å
21	F	90.8	Very high	83	Confident	126 Å²	126	98.8 Å²	98.8	55%	0.553	51%	0.513	S	S	*	.	H	α-helix	trans	-63	-41.1	177.1	-173	-99.6	0	0	0	111.5	F17 I23 I24 W25	F17-F21 WeakPolarHBondContact O-CB 2.98Å; F17-F21 PolarHBondContact O-N 3.4Å; F21-I23 VanDerWaalsContact C-N 3.34Å; F21-I24 PolarHBondContact O-N 3.42Å; F21-W25 AromaticContact CD1-CD1 3.5Å; F21-W25 VanDerWaalsContact CD1-CD1 3.5Å; F21-W25 HydrophobicContact CD1-CG 4.4Å; F21-W25 AromaticContact CD1-NE1 3.89Å; F21-W25 AromaticContact CD2-CD1 3.86Å; F21-W25 AromaticContact CD2-NE1 3.95Å; F21-W25 AromaticContact CE1-CD1 3.27Å; F21-W25 HydrophobicContact CE1-CG 4.16Å; F21-W25 AromaticContact CE1-NE1 3.18Å; F21-W25 AromaticContact CE2-CD1 3.66Å; F21-W25 AromaticContact CE2-NE1 3.26Å; F21-W25 VanDerWaalsContact CE2-NE1 3.26Å; F21-W25 AromaticContact CG-CD1 3.82Å; F21-W25 AromaticContact CZ-CD1 3.4Å; F21-W25 VanDerWaalsContact CZ-CD1 3.4Å; F21-W25 AromaticContact CZ-CE2 3.8Å; F21-W25 HydrophobicContact CZ-CZ2 4.4Å; F21-W25 AromaticContact CZ-NE1 2.85Å; F21-W25 WeakPolarHBondContact O-CB 3.45Å; F21-W25 VanDerWaalsContact O-CD1 3.28Å; F21-W25 PolarHBondContact O-N 3.08Å
22	G	89.6	Confident	83	Confident	42 Å²	42	100.4 Å²	100.4	43%	0.433	51%	0.508	S	S	.	.	H	α-helix	trans	-64.3	-37.3	174.3	0	0	0	0	0	112.6	L18 L19 V20 G26	L18-G22 PolarHBondContact O-N 2.75Å; L19-G22 PolarHBondContact O-N 3.26Å; V20-G22 VanDerWaalsContact C-N 3.34Å; V20-G22 PolarHBondContact O-N 3.4Å; G22-G26 WeakPolarHBondContact O-CA 3.3Å; G22-G26 PolarHBondContact O-N 3.28Å
23	I	89.6	Confident	82.7	Confident	91 Å²	91	101.3 Å²	101.3	47%	0.467	52%	0.518	S	S	.	.	H	α-helix	trans	-69.7	-42.1	173.3	-68.1	166.9	0	0	0	110.9	L19 V20 F21 G26 L27	L19-I23 HydrophobicContact CG-CD1 4.23Å; L19-I23 VanDerWaalsContact O-CG1 3.25Å; L19-I23 WeakPolarHBondContact O-CG1 3.49Å; L19-I23 PolarHBondContact O-N 3.29Å; V20-I23 PolarHBondContact O-N 2.8Å; F21-I23 VanDerWaalsContact C-N 3.34Å; I23-G26 PolarHBondContact O-N 2.92Å; I23-L27 HydrophobicContact CG2-CD1 3.76Å; I23-L27 HydrophobicContact CG2-CG 4.35Å; I23-L27 WeakPolarHBondContact O-CB 3.49Å; I23-L27 WeakPolarHBondContact O-CG 3.44Å; I23-L27 PolarHBondContact O-N 3.5Å
24	I	88.2	Confident	81.7	Confident	91 Å²	91	102.8 Å²	102.8	47%	0.467	53%	0.525	S	S	.	.	H	α-helix	trans	-61.8	-47.5	174.8	-92.2	76.2	0	0	0	109.8	V20 F21 L27 M28	V20-I24 HydrophobicContact CG1-CD1 3.67Å; V20-I24 WeakPolarHBondContact O-CD1 3.48Å; V20-I24 PolarHBondContact O-N 2.91Å; F21-I24 PolarHBondContact O-N 3.42Å; I24-L27 PolarHBondContact O-N 2.79Å; I24-M28 WeakPolarHBondContact O-CA 3.33Å; I24-M28 WeakPolarHBondContact O-CB 3.08Å; I24-M28 PolarHBondContact O-N 2.79Å
25	W	85.1	Confident	80.3	Confident	151 Å²	151	100.5 Å²	100.5	57%	0.572	51%	0.512	S	S	*	.	H	α-helix	trans	-66.6	-41.9	178.5	-91	81.9	0	0	0	112	F21 M28 L29	F21-W25 AromaticContact CD1-CD1 3.5Å; F21-W25 VanDerWaalsContact CD1-CD1 3.5Å; F21-W25 HydrophobicContact CD1-CG 4.4Å; F21-W25 AromaticContact CD1-NE1 3.89Å; F21-W25 AromaticContact CD2-CD1 3.86Å; F21-W25 AromaticContact CD2-NE1 3.95Å; F21-W25 AromaticContact CE1-CD1 3.27Å; F21-W25 HydrophobicContact CE1-CG 4.16Å; F21-W25 AromaticContact CE1-NE1 3.18Å; F21-W25 AromaticContact CE2-CD1 3.66Å; F21-W25 AromaticContact CE2-NE1 3.26Å; F21-W25 VanDerWaalsContact CE2-NE1 3.26Å; F21-W25 AromaticContact CG-CD1 3.82Å; F21-W25 AromaticContact CZ-CD1 3.4Å; F21-W25 VanDerWaalsContact CZ-CD1 3.4Å; F21-W25 AromaticContact CZ-CE2 3.8Å; F21-W25 HydrophobicContact CZ-CZ2 4.4Å; F21-W25 AromaticContact CZ-NE1 2.85Å; F21-W25 WeakPolarHBondContact O-CB 3.45Å; F21-W25 VanDerWaalsContact O-CD1 3.28Å; F21-W25 PolarHBondContact O-N 3.08Å; W25-M28 PolarHBondContact O-N 3.49Å; W25-L29 WeakPolarHBondContact O-CB 3.42Å; W25-L29 PolarHBondContact O-N 3.21Å
26	G	89.2	Confident	78.7	Confident	38 Å²	38	104.5 Å²	104.5	39%	0.392	52%	0.516	S	S	.	.	H	α-helix	trans	-60.9	-48.8	174.7	0	0	0	0	0	111.1	G22 I23 M28 L29 L30	G22-G26 WeakPolarHBondContact O-CA 3.3Å; G22-G26 PolarHBondContact O-N 3.28Å; I23-G26 PolarHBondContact O-N 2.92Å; G26-M28 VanDerWaalsContact C-N 3.35Å; G26-M28 PolarHBondContact O-N 2.86Å; G26-L29 PolarHBondContact O-N 3.48Å; G26-L30 WeakPolarHBondContact O-CA 3.25Å; G26-L30 WeakPolarHBondContact O-CB 3.33Å; G26-L30 PolarHBondContact O-N 2.79Å
27	L	85.2	Confident	77.2	Confident	101 Å²	101	104.7 Å²	104.7	53%	0.529	52%	0.524	S	S	.	.	H	α-helix	trans	-66.1	-34.7	175	-79.5	168.1	0	0	0	112.4	I23 I24 R31	I23-L27 HydrophobicContact CG2-CD1 3.76Å; I23-L27 HydrophobicContact CG2-CG 4.35Å; I23-L27 WeakPolarHBondContact O-CB 3.49Å; I23-L27 WeakPolarHBondContact O-CG 3.44Å; I23-L27 PolarHBondContact O-N 3.5Å; I24-L27 PolarHBondContact O-N 2.79Å; L27-R31 WeakPolarHBondContact O-CA 3.46Å; L27-R31 WeakPolarHBondContact O-CB 3.4Å; L27-R31 PolarHBondContact O-N 3Å
28	M	81	Confident	75	Confident	112 Å²	112	105.9 Å²	105.9	55%	0.552	52%	0.524	S	S	*	.	H	α-helix	trans	-72.9	-39.3	179.5	-157.4	-85	146	0	0	110.4	I24 W25 G26 R31 Y32	I24-M28 WeakPolarHBondContact O-CA 3.33Å; I24-M28 WeakPolarHBondContact O-CB 3.08Å; I24-M28 PolarHBondContact O-N 2.79Å; W25-M28 PolarHBondContact O-N 3.49Å; G26-M28 VanDerWaalsContact C-N 3.35Å; G26-M28 PolarHBondContact O-N 2.86Å; M28-R31 CarbonylContact O-C 3.48Å; M28-Y32 WeakPolarHBondContact O-CB 3.2Å; M28-Y32 PolarHBondContact O-N 3.21Å
29	L	81.3	Confident	73	Confident	106 Å²	106	110.4 Å²	110.4	56%	0.555	53%	0.533	S	S	*	.	H	α-helix	trans	-72.5	-35.4	173.2	-162.3	74.3	0	0	0	112.2	W25 G26 Y32 T33	W25-L29 WeakPolarHBondContact O-CB 3.42Å; W25-L29 PolarHBondContact O-N 3.21Å; G26-L29 PolarHBondContact O-N 3.48Å; L29-Y32 WeakPolarHBondContact O-CB 3.49Å; L29-Y32 PolarHBondContact O-N 2.77Å; L29-T33 WeakPolarHBondContact O-CB 3.12Å; L29-T33 PolarHBondContact O-N 3.19Å; L29-T33 PolarHBondContact O-OG1 2.92Å
30	L	80.9	Confident	70.7	Confident	87 Å²	87	111.6 Å²	111.6	46%	0.455	54%	0.536	S	S	.	.	H	α-helix	trans	-70.1	-45.2	173.5	-167.9	65.2	0	0	0	110	G26 Y32 T33 F34	G26-L30 WeakPolarHBondContact O-CA 3.25Å; G26-L30 WeakPolarHBondContact O-CB 3.33Å; G26-L30 PolarHBondContact O-N 2.79Å; L30-Y32 PolarHBondContact O-N 3.07Å; L30-T33 PolarHBondContact O-N 2.76Å; L30-F34 HydrophobicContact CD1-CD2 3.79Å; L30-F34 HydrophobicContact CD1-CE2 3.42Å; L30-F34 VanDerWaalsContact CD1-CE2 3.42Å; L30-F34 HydrophobicContact CD2-CE2 4.49Å; L30-F34 HydrophobicContact CG-CD2 3.75Å; L30-F34 HydrophobicContact CG-CE2 3.76Å; L30-F34 WeakPolarHBondContact O-CB 3.5Å; L30-F34 WeakPolarHBondContact O-CD2 3.49Å; L30-F34 PolarHBondContact O-N 3.21Å
31	R	66.1	Low	68.6	Low	124 Å²	124	112.1 Å²	112.1	47%	0.468	54%	0.543	S	S	.	.	H	α-helix	trans	-59.6	-36.7	168.6	-101.7	-73.9	-117.7	164	6	110.3	L27 M28 Q35 Q40	L27-R31 WeakPolarHBondContact O-CA 3.46Å; L27-R31 WeakPolarHBondContact O-CB 3.4Å; L27-R31 PolarHBondContact O-N 3Å; M28-R31 CarbonylContact O-C 3.48Å; R31-Q35 VanDerWaalsContact CD-NE2 3.3Å; R31-Q35 VanDerWaalsContact CZ-OE1 3.25Å; R31-Q35 WeakPolarHBondContact O-CA 3.08Å; R31-Q35 WeakPolarHBondContact O-CB 3.48Å; R31-Q35 WeakPolarHBondContact O-CG 3.35Å; R31-Q35 PolarHBondContact O-N 3Å; R31-Q35 PolarHBondContact O-NE2 3.24Å; R31-Q40 VanDerWaalsContact NH2-NE2 3.14Å
32	Y	64.2	Low	66.4	Low	115 Å²	115	108 Å²	108	45%	0.451	53%	0.529	S	S	.	.	H	α-helix	trans	-67.4	-50.3	177.7	-173.6	-98.2	0	0	0	109.4	M28 L29 L30 F34 Q35 Y36	M28-Y32 WeakPolarHBondContact O-CB 3.2Å; M28-Y32 PolarHBondContact O-N 3.21Å; L29-Y32 WeakPolarHBondContact O-CB 3.49Å; L29-Y32 PolarHBondContact O-N 2.77Å; L30-Y32 PolarHBondContact O-N 3.07Å; Y32-F34 VanDerWaalsContact C-N 3.33Å; Y32-F34 PolarHBondContact O-N 3.38Å; Y32-Q35 PolarHBondContact O-N 2.91Å; Y32-Q35 VanDerWaalsContact O-N 3.11Å; Y32-Y36 HydrophobicContact CD1-CD2 4.36Å; Y32-Y36 HydrophobicContact CD1-CE2 4.14Å; Y32-Y36 AromaticContact CD2-CE2 3.92Å; Y32-Y36 HydrophobicContact CD2-CE2 3.92Å; Y32-Y36 HydrophobicContact CE1-CD2 4.23Å; Y32-Y36 AromaticContact CE1-CE2 3.68Å; Y32-Y36 HydrophobicContact CE1-CE2 3.68Å; Y32-Y36 HydrophobicContact CE2-CD2 4.43Å; Y32-Y36 AromaticContact CE2-CE2 3.45Å; Y32-Y36 HydrophobicContact CE2-CE2 3.45Å; Y32-Y36 VanDerWaalsContact CE2-CE2 3.45Å; Y32-Y36 HydrophobicContact CG-CE2 4.24Å; Y32-Y36 AromaticContact CZ-CE2 3.3Å; Y32-Y36 AromaticContact CZ-CZ 3.85Å; Y32-Y36 WeakPolarHBondContact O-CD2 3.01Å; Y32-Y36 PolarHBondContact O-N 3.46Å; Y32-Y36 VanDerWaalsContact O-N 3.11Å; Y32-Y36 PolarHBondContact OH-OH 2.78Å
33	T	66.6	Low	64.4	Low	95 Å²	95	109.4 Å²	109.4	58%	0.583	54%	0.537	S	S	*	.	H	α-helix	trans	-58.9	-39.9	176.7	-55.7	0	0	0	0	112.4	L29 L30	L29-T33 WeakPolarHBondContact O-CB 3.12Å; L29-T33 PolarHBondContact O-N 3.19Å; L29-T33 PolarHBondContact O-OG1 2.92Å; L30-T33 PolarHBondContact O-N 2.76Å
34	F	55.6	Low	62.1	Low	150 Å²	150	112.6 Å²	112.6	66%	0.658	55%	0.55	S	S	*	.	H	α-helix	trans	-85.5	-17.4	176.2	-76.1	-69.1	0	0	0	114.3	L30 Y32	L30-F34 HydrophobicContact CD1-CD2 3.79Å; L30-F34 HydrophobicContact CD1-CE2 3.42Å; L30-F34 VanDerWaalsContact CD1-CE2 3.42Å; L30-F34 HydrophobicContact CD2-CE2 4.49Å; L30-F34 HydrophobicContact CG-CD2 3.75Å; L30-F34 HydrophobicContact CG-CE2 3.76Å; L30-F34 WeakPolarHBondContact O-CB 3.5Å; L30-F34 WeakPolarHBondContact O-CD2 3.49Å; L30-F34 PolarHBondContact O-N 3.21Å; Y32-F34 VanDerWaalsContact C-N 3.33Å; Y32-F34 PolarHBondContact O-N 3.38Å
35	Q	52.7	Low	60.2	Low	59 Å²	59	112.5 Å²	112.5	28%	0.276	55%	0.55	S	S	.	.	H	α-helix	trans	-90.4	-8.7	177.1	-78.8	-176	101.3	0	0	114.4	R31 Y32 P37 R38	R31-Q35 VanDerWaalsContact CD-NE2 3.3Å; R31-Q35 VanDerWaalsContact CZ-OE1 3.25Å; R31-Q35 WeakPolarHBondContact O-CA 3.08Å; R31-Q35 WeakPolarHBondContact O-CB 3.48Å; R31-Q35 WeakPolarHBondContact O-CG 3.35Å; R31-Q35 PolarHBondContact O-N 3Å; R31-Q35 PolarHBondContact O-NE2 3.24Å; Y32-Q35 PolarHBondContact O-N 2.91Å; Y32-Q35 VanDerWaalsContact O-N 3.11Å; Q35-P37 CarbonylContact O-C 3.58Å; Q35-P37 VanDerWaalsContact O-CA 3.29Å; Q35-P37 WeakPolarHBondContact O-CA 3.36Å; Q35-R38 PolarHBondContact O-N 3.47Å
36	Y	49	Very low	58.4	Low	160 Å²	160	111.7 Å²	111.7	63%	0.627	55%	0.547	S	S	*	.	T	Hydrogen-bonded Turn	trans	-81.5	68	153.9	-79	-98.1	0	0	0	107.9	Y32	Y32-Y36 HydrophobicContact CD1-CD2 4.36Å; Y32-Y36 HydrophobicContact CD1-CE2 4.14Å; Y32-Y36 AromaticContact CD2-CE2 3.92Å; Y32-Y36 HydrophobicContact CD2-CE2 3.92Å; Y32-Y36 HydrophobicContact CE1-CD2 4.23Å; Y32-Y36 AromaticContact CE1-CE2 3.68Å; Y32-Y36 HydrophobicContact CE1-CE2 3.68Å; Y32-Y36 HydrophobicContact CE2-CD2 4.43Å; Y32-Y36 AromaticContact CE2-CE2 3.45Å; Y32-Y36 HydrophobicContact CE2-CE2 3.45Å; Y32-Y36 VanDerWaalsContact CE2-CE2 3.45Å; Y32-Y36 HydrophobicContact CG-CE2 4.24Å; Y32-Y36 AromaticContact CZ-CE2 3.3Å; Y32-Y36 AromaticContact CZ-CZ 3.85Å; Y32-Y36 WeakPolarHBondContact O-CD2 3.01Å; Y32-Y36 PolarHBondContact O-N 3.46Å; Y32-Y36 VanDerWaalsContact O-N 3.11Å; Y32-Y36 PolarHBondContact OH-OH 2.78Å
37	P	50.2	Low	56.5	Low	108 Å²	108	117 Å²	117	70%	0.701	56%	0.561	S	S	*	*	T	Hydrogen-bonded Turn		-155.8	92.8	65.2	36.8	-12.5	0	0	0	114	Q35	Q35-P37 CarbonylContact O-C 3.58Å; Q35-P37 VanDerWaalsContact O-CA 3.29Å; Q35-P37 WeakPolarHBondContact O-CA 3.36Å
38	R	43.6	Very low	54.6	Low	167 Å²	167	119 Å²	119	63%	0.63	57%	0.568	S	S	*	*			trans	-155.4	84.5	165.9	-147.6	78.9	174.7	-165.1	-5.6	112.7	Q35 Q40	Q35-R38 PolarHBondContact O-N 3.47Å; R38-Q40 PolarHBondContact O-N 3.3Å
39	R	45.9	Very low	53.2	Low	206 Å²	206	118.6 Å²	118.6	78%	0.777	57%	0.567	S	S	*	*			trans	-37.8	104.3	163.9	-64.5	-89	-171.5	178	0.6	110.7	S41 S42	R39-S41 PolarHBondContact O-N 3.03Å; R39-S42 VanDerWaalsContact O-CB 3.25Å; R39-S42 WeakPolarHBondContact O-CB 3.34Å; R39-S42 PolarHBondContact O-N 3.39Å; R39-S42 PolarHBondContact O-OG 3.28Å
40	Q	41.2	Very low	51.9	Low	142 Å²	142	118.2 Å²	118.2	66%	0.664	57%	0.565	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.5	-15.9	170.3	-84.2	-177.8	-18.3	0	0	112.8	R31 R38 S42 A43	R31-Q40 VanDerWaalsContact NH2-NE2 3.14Å; R38-Q40 PolarHBondContact O-N 3.3Å; Q40-S42 PolarHBondContact O-N 2.98Å; Q40-S42 VanDerWaalsContact O-N 3.1Å; Q40-A43 PolarHBondContact O-N 2.79Å
41	S	44.6	Very low	50.5	Low	84 Å²	84	118.1 Å²	118.1	59%	0.587	57%	0.565	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.3	-15.6	165.2	160.8	0	0	0	0	113.1	R39 L45	R39-S41 PolarHBondContact O-N 3.03Å; S41-L45 WeakPolarHBondContact O-CD1 3.21Å
42	S	45.3	Very low	49.8	Very low	39 Å²	39	117.4 Å²	117.4	27%	0.273	57%	0.57	S	S	.	*	H	α-helix	trans	-83.6	-8.8	-177.5	-59.1	0	0	0	0	115.4	R39 Q40 R46	R39-S42 VanDerWaalsContact O-CB 3.25Å; R39-S42 WeakPolarHBondContact O-CB 3.34Å; R39-S42 PolarHBondContact O-N 3.39Å; R39-S42 PolarHBondContact O-OG 3.28Å; Q40-S42 PolarHBondContact O-N 2.98Å; Q40-S42 VanDerWaalsContact O-N 3.1Å; S42-R46 WeakPolarHBondContact O-CA 3.03Å; S42-R46 WeakPolarHBondContact O-CB 3.47Å; S42-R46 WeakPolarHBondContact O-CD 3.49Å; S42-R46 WeakPolarHBondContact O-CG 3.48Å; S42-R46 PolarHBondContact O-N 3.37Å
43	A	47	Very low	49.4	Very low	71 Å²	71	114.1 Å²	114.1	59%	0.587	56%	0.563	S	S	*	*	H	α-helix	trans	-71.3	-47.7	-179.5	0	0	0	0	0	111.8	Q40 R46 E47	Q40-A43 PolarHBondContact O-N 2.79Å; A43-R46 PolarHBondContact O-N 3.44Å; A43-E47 PolarHBondContact O-N 3.42Å
44	E	42.3	Very low	48.8	Very low	158 Å²	158	116.4 Å²	116.4	74%	0.738	57%	0.565	S	S	*	*	H	α-helix	trans	-74.6	-37	177	-68.3	-172	160.5	0	0	112.5	R46 E47 Q48	E44-R46 VanDerWaalsContact C-N 3.3Å; E44-R46 PolarHBondContact O-N 3.01Å; E44-E47 PolarHBondContact O-N 2.87Å; E44-Q48 PolarHBondContact O-N 2.88Å
45	L	48	Very low	48.8	Very low	90 Å²	90	117.3 Å²	117.3	47%	0.471	56%	0.564	S	S	.	*	H	α-helix	trans	-69.8	-25.6	170.6	-80.6	98.5	0	0	0	112.4	S41 I49	S41-L45 WeakPolarHBondContact O-CD1 3.21Å; L45-I49 HydrophobicContact CB-CD1 4.39Å; L45-I49 WeakPolarHBondContact O-CB 3.29Å; L45-I49 WeakPolarHBondContact O-CD1 3.15Å; L45-I49 PolarHBondContact O-N 2.77Å
46	R	47.3	Very low	48.7	Very low	134 Å²	134	122 Å²	122	51%	0.506	58%	0.581	S	S	.	*	H	α-helix	trans	-71.8	-34.9	173.9	-84.4	163.1	-177.7	-97.4	-8.6	111.7	S42 A43 E44 L50	S42-R46 WeakPolarHBondContact O-CA 3.03Å; S42-R46 WeakPolarHBondContact O-CB 3.47Å; S42-R46 WeakPolarHBondContact O-CD 3.49Å; S42-R46 WeakPolarHBondContact O-CG 3.48Å; S42-R46 PolarHBondContact O-N 3.37Å; A43-R46 PolarHBondContact O-N 3.44Å; E44-R46 VanDerWaalsContact C-N 3.3Å; E44-R46 PolarHBondContact O-N 3.01Å; R46-L50 WeakPolarHBondContact O-CA 3.44Å; R46-L50 WeakPolarHBondContact O-CB 3.39Å; R46-L50 PolarHBondContact O-N 2.76Å
47	E	48.1	Very low	49.1	Very low	149 Å²	149	118.8 Å²	118.8	70%	0.696	58%	0.577	S	S	*	*	H	α-helix	trans	-66.4	-41.6	172.9	-88.9	-169	148.5	0	0	111.5	A43 E44 L50 D51	A43-E47 PolarHBondContact O-N 3.42Å; E44-E47 PolarHBondContact O-N 2.87Å; E47-L50 PolarHBondContact O-N 3.47Å; E47-D51 PolarHBondContact O-N 3.18Å
48	Q	45.3	Very low	49.3	Very low	143 Å²	143	120.8 Å²	120.8	67%	0.668	58%	0.575	S	S	*	*	H	α-helix	trans	-67.5	-38.4	175.4	-69.5	-176.6	9.7	0	0	112.6	E44 L52	E44-Q48 PolarHBondContact O-N 2.88Å; Q48-L52 WeakPolarHBondContact O-CB 2.91Å; Q48-L52 PolarHBondContact O-N 3.49Å
49	I	52.9	Low	49.9	Very low	103 Å²	103	115.2 Å²	115.2	53%	0.528	57%	0.565	S	S	.	*	H	α-helix	trans	-71.6	-29.4	172.2	-86.4	83.9	0	0	0	111.7	L45 S53	L45-I49 HydrophobicContact CB-CD1 4.39Å; L45-I49 WeakPolarHBondContact O-CB 3.29Å; L45-I49 WeakPolarHBondContact O-CD1 3.15Å; L45-I49 PolarHBondContact O-N 2.77Å; I49-S53 WeakPolarHBondContact O-CA 3.34Å; I49-S53 WeakPolarHBondContact O-CB 3.44Å; I49-S53 PolarHBondContact O-N 2.78Å; I49-S53 PolarHBondContact O-OG 3.29Å
50	L	53.2	Low	50.2	Low	99 Å²	99	109.8 Å²	109.8	52%	0.518	55%	0.551	S	S	.	*	H	α-helix	trans	-77	-39.1	-179.6	-165	82.6	0	0	0	111.9	R46 E47 S53 K54	R46-L50 WeakPolarHBondContact O-CA 3.44Å; R46-L50 WeakPolarHBondContact O-CB 3.39Å; R46-L50 PolarHBondContact O-N 2.76Å; E47-L50 PolarHBondContact O-N 3.47Å; L50-S53 WeakPolarHBondContact CA-OG 3.03Å; L50-S53 PolarHBondContact O-OG 2.77Å; L50-K54 VanDerWaalsContact O-CB 3.3Å; L50-K54 WeakPolarHBondContact O-CB 3.22Å; L50-K54 WeakPolarHBondContact O-CG 3.39Å; L50-K54 PolarHBondContact O-N 3.09Å
51	D	51.4	Low	50.8	Low	85 Å²	85	105.9 Å²	105.9	46%	0.455	54%	0.543	S	S	.	.	H	α-helix	trans	-72.5	-41.1	173.1	-172.2	36.9	0	0	0	111.1	E47 K54 R55	E47-D51 PolarHBondContact O-N 3.18Å; D51-K54 PolarHBondContact O-N 3.48Å; D51-R55 PolarHBondContact O-N 2.78Å; D51-R55 IonicContact OD1-NE 3.92Å; D51-R55 IonicContact OD2-CZ 3.72Å; D51-R55 IonicContact OD2-NE 3.54Å; D51-R55 IonicContact OD2-NH2 3.71Å
52	L	51.8	Low	51.2	Low	108 Å²	108	108.9 Å²	108.9	57%	0.565	55%	0.547	S	S	*	.	H	α-helix	trans	-67.6	-38.4	176.4	-159.2	69.1	0	0	0	111.9	Q48 R55 Y56	Q48-L52 WeakPolarHBondContact O-CB 2.91Å; Q48-L52 PolarHBondContact O-N 3.49Å; L52-R55 PolarHBondContact O-N 3.29Å; L52-Y56 HydrophobicContact CG-CD2 4.45Å; L52-Y56 WeakPolarHBondContact O-CB 3.34Å; L52-Y56 PolarHBondContact O-N 2.74Å
53	S	55	Low	51.4	Low	46 Å²	46	111.6 Å²	111.6	32%	0.322	56%	0.556	S	S	.	*	H	α-helix	trans	-73.5	-30.4	173.4	64.7	0	0	0	0	113.3	I49 L50 Y56 V57	I49-S53 WeakPolarHBondContact O-CA 3.34Å; I49-S53 WeakPolarHBondContact O-CB 3.44Å; I49-S53 PolarHBondContact O-N 2.78Å; I49-S53 PolarHBondContact O-OG 3.29Å; L50-S53 WeakPolarHBondContact CA-OG 3.03Å; L50-S53 PolarHBondContact O-OG 2.77Å; S53-Y56 PolarHBondContact O-N 3.41Å; S53-V57 WeakPolarHBondContact O-CB 3.42Å; S53-V57 WeakPolarHBondContact O-CG2 3.18Å; S53-V57 PolarHBondContact O-N 3.45Å
54	K	53.9	Low	51.4	Low	143 Å²	143	112 Å²	112	62%	0.622	55%	0.548	S	S	*	.	H	α-helix	trans	-67	-40.4	171.2	-90	-177.4	176.5	-178.8	0	111.4	L50 D51 K58	L50-K54 VanDerWaalsContact O-CB 3.3Å; L50-K54 WeakPolarHBondContact O-CB 3.22Å; L50-K54 WeakPolarHBondContact O-CG 3.39Å; L50-K54 PolarHBondContact O-N 3.09Å; D51-K54 PolarHBondContact O-N 3.48Å; K54-K58 WeakPolarHBondContact O-CB 3.32Å; K54-K58 PolarHBondContact O-N 2.96Å
55	R	56.9	Low	51.7	Low	170 Å²	170	113.1 Å²	113.1	64%	0.642	55%	0.55	S	S	*	*	H	α-helix	trans	-69.7	-37.9	174.4	-70.2	179.4	-168.3	-155.8	1	111.9	D51 L52 A59	D51-R55 PolarHBondContact O-N 2.78Å; D51-R55 IonicContact OD1-NE 3.92Å; D51-R55 IonicContact OD2-CZ 3.72Å; D51-R55 IonicContact OD2-NE 3.54Å; D51-R55 IonicContact OD2-NH2 3.71Å; L52-R55 PolarHBondContact O-N 3.29Å; R55-A59 WeakPolarHBondContact O-CB 3.1Å; R55-A59 PolarHBondContact O-N 3.04Å
56	Y	49.5	Very low	51.6	Low	158 Å²	158	115.1 Å²	115.1	62%	0.62	56%	0.562	S	S	*	*	H	α-helix	trans	-68.6	-42.4	174	-107.9	-86	0	0	0	113	L52 S53 A59 L60	L52-Y56 HydrophobicContact CG-CD2 4.45Å; L52-Y56 WeakPolarHBondContact O-CB 3.34Å; L52-Y56 PolarHBondContact O-N 2.74Å; S53-Y56 PolarHBondContact O-N 3.41Å; Y56-A59 PolarHBondContact O-N 2.89Å; Y56-L60 VanDerWaalsContact O-CB 3.25Å; Y56-L60 WeakPolarHBondContact O-CB 3.35Å; Y56-L60 PolarHBondContact O-N 2.8Å
57	V	56.9	Low	51.3	Low	91 Å²	91	114.4 Å²	114.4	55%	0.552	57%	0.567	S	S	*	*	H	α-helix	trans	-72.4	-30.3	177.2	170.6	0	0	0	0	111.3	S53 L60 A61	S53-V57 WeakPolarHBondContact O-CB 3.42Å; S53-V57 WeakPolarHBondContact O-CG2 3.18Å; S53-V57 PolarHBondContact O-N 3.45Å; V57-L60 PolarHBondContact O-N 3.3Å; V57-A61 WeakPolarHBondContact O-CB 3.42Å; V57-A61 PolarHBondContact O-N 3.38Å
58	K	56.2	Low	51.1	Low	151 Å²	151	113.7 Å²	113.7	66%	0.657	57%	0.566	S	S	*	*	H	α-helix	trans	-70.2	-41	172.2	-168.3	173.9	-177.8	-179	0	111.1	K54 E62	K54-K58 WeakPolarHBondContact O-CB 3.32Å; K54-K58 PolarHBondContact O-N 2.96Å; K58-E62 VanDerWaalsContact O-CB 3.27Å; K58-E62 WeakPolarHBondContact O-CB 3.29Å; K58-E62 PolarHBondContact O-N 3.26Å; K58-E62 VanDerWaalsContact O-N 3.14Å
59	A	55.1	Low	51	Low	50 Å²	50	114.5 Å²	114.5	41%	0.413	58%	0.575	S	S	.	*	H	α-helix	trans	-62.1	-44.4	167.9	0	0	0	0	0	111.3	R55 Y56 A61 E62 E63	R55-A59 WeakPolarHBondContact O-CB 3.1Å; R55-A59 PolarHBondContact O-N 3.04Å; Y56-A59 PolarHBondContact O-N 2.89Å; A59-A61 PolarHBondContact O-N 2.73Å; A59-E62 PolarHBondContact O-N 3.32Å; A59-E63 WeakPolarHBondContact O-CG 3.06Å; A59-E63 PolarHBondContact O-N 2.74Å
60	L	51.7	Low	50.5	Low	92 Å²	92	112.6 Å²	112.6	48%	0.482	58%	0.58	S	S	.	*	H	α-helix	trans	-64.2	-37.7	179.7	-127.9	85.5	0	0	0	113.5	Y56 V57 E63 N64	Y56-L60 VanDerWaalsContact O-CB 3.25Å; Y56-L60 WeakPolarHBondContact O-CB 3.35Å; Y56-L60 PolarHBondContact O-N 2.8Å; V57-L60 PolarHBondContact O-N 3.3Å; L60-E63 WeakPolarHBondContact CA-OE1 3.34Å; L60-E63 WeakPolarHBondContact CD1-OE1 3.31Å; L60-E63 PolarHBondContact N-OE1 3.11Å; L60-E63 WeakPolarHBondContact O-CG 3.07Å; L60-N64 WeakPolarHBondContact O-CB 3.49Å; L60-N64 PolarHBondContact O-N 3.11Å
61	A	54.3	Low	50.3	Low	60 Å²	60	111.6 Å²	111.6	50%	0.496	59%	0.593	S	S	.	*	H	α-helix	trans	-78.2	-32.6	179	0	0	0	0	0	111.7	V57 A59 K65	V57-A61 WeakPolarHBondContact O-CB 3.42Å; V57-A61 PolarHBondContact O-N 3.38Å; A59-A61 PolarHBondContact O-N 2.73Å; A61-K65 PolarHBondContact O-N 3.4Å; A61-K65 VanDerWaalsContact O-N 3.15Å
62	E	53	Low	50	Low	146 Å²	146	113.1 Å²	113.1	68%	0.682	61%	0.611	S	S	*	*	H	α-helix	trans	-69.1	-35.8	174.4	-163.1	116.4	-150.3	0	0	111.2	K58 A59	K58-E62 VanDerWaalsContact O-CB 3.27Å; K58-E62 WeakPolarHBondContact O-CB 3.29Å; K58-E62 PolarHBondContact O-N 3.26Å; K58-E62 VanDerWaalsContact O-N 3.14Å; A59-E62 PolarHBondContact O-N 3.32Å
63	E	49.6	Very low	49.7	Very low	96 Å²	96	111.5 Å²	111.5	45%	0.449	62%	0.62	S	S	.	*	H	α-helix	trans	-81.1	-34.3	172.8	65.1	-159.1	132.8	0	0	113.8	A59 L60 K65 N66 L67	A59-E63 WeakPolarHBondContact O-CG 3.06Å; A59-E63 PolarHBondContact O-N 2.74Å; L60-E63 WeakPolarHBondContact CA-OE1 3.34Å; L60-E63 WeakPolarHBondContact CD1-OE1 3.31Å; L60-E63 PolarHBondContact N-OE1 3.11Å; L60-E63 WeakPolarHBondContact O-CG 3.07Å; E63-K65 VanDerWaalsContact C-N 3.35Å; E63-K65 PolarHBondContact O-N 3.33Å; E63-N66 WeakPolarHBondContact O-CA 3.25Å; E63-N66 WeakPolarHBondContact O-CB 3.43Å; E63-N66 PolarHBondContact O-N 2.7Å; E63-L67 WeakPolarHBondContact O-CG 2.86Å; E63-L67 PolarHBondContact O-N 3.17Å
64	N	47.5	Very low	49.5	Very low	81 Å²	81	113.3 Å²	113.3	43%	0.433	64%	0.638	S	S	.	*	H	α-helix	trans	-69.4	-29.3	176.8	-155.2	-58.4	0	0	0	112.6	L60 N66 L67 M68	L60-N64 WeakPolarHBondContact O-CB 3.49Å; L60-N64 PolarHBondContact O-N 3.11Å; N64-N66 PolarHBondContact O-N 3.15Å; N64-L67 PolarHBondContact O-N 2.96Å; N64-M68 VanDerWaalsContact O-CB 3.24Å; N64-M68 WeakPolarHBondContact O-CB 2.91Å; N64-M68 PolarHBondContact O-N 2.96Å
65	K	47.7	Very low	49.4	Very low	180 Å²	180	112 Å²	112	78%	0.783	65%	0.647	S	S	*	*	H	α-helix	trans	-65.2	-26.5	169.7	-157.7	-175.2	81.8	162.8	0	112.5	A61 E63	A61-K65 PolarHBondContact O-N 3.4Å; A61-K65 VanDerWaalsContact O-N 3.15Å; E63-K65 VanDerWaalsContact C-N 3.35Å; E63-K65 PolarHBondContact O-N 3.33Å
66	N	45.6	Very low	49.2	Very low	133 Å²	133	111.4 Å²	111.4	71%	0.711	65%	0.654	S	S	*	*	H	α-helix	trans	-79.9	-36.6	175.4	-157.2	-62.2	0	0	0	111.3	E63 N64	E63-N66 WeakPolarHBondContact O-CA 3.25Å; E63-N66 WeakPolarHBondContact O-CB 3.43Å; E63-N66 PolarHBondContact O-N 2.7Å; N64-N66 PolarHBondContact O-N 3.15Å
67	L	41.7	Very low	49.5	Very low	118 Å²	118	107.3 Å²	107.3	62%	0.618	65%	0.652	S	S	*	*	H	α-helix	trans	-84.5	-28.4	-178	-62	174.5	0	0	0	114.7	E63 N64 N69 G70	E63-L67 WeakPolarHBondContact O-CG 2.86Å; E63-L67 PolarHBondContact O-N 3.17Å; N64-L67 PolarHBondContact O-N 2.96Å; L67-N69 PolarHBondContact O-N 3.25Å; L67-N69 VanDerWaalsContact O-N 3.12Å; L67-G70 PolarHBondContact O-N 3.38Å
68	M	43.1	Very low	49.4	Very low	135 Å²	135	105.5 Å²	105.5	67%	0.665	65%	0.652	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.5	8.7	178.5	-169.1	152.2	62.2	0	0	113.8	N64 G70	N64-M68 VanDerWaalsContact O-CB 3.24Å; N64-M68 WeakPolarHBondContact O-CB 2.91Å; N64-M68 PolarHBondContact O-N 2.96Å; M68-G70 VanDerWaalsContact C-N 3.34Å
69	N	43.4	Very low	49.3	Very low	160 Å²	160	106.6 Å²	106.6	86%	0.856	65%	0.653	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.8	-5	162.2	-158.7	42.8	0	0	0	112.6	L67	L67-N69 PolarHBondContact O-N 3.25Å; L67-N69 VanDerWaalsContact O-N 3.12Å
70	G	43	Very low	49.4	Very low	62 Å²	62	107.3 Å²	107.3	64%	0.639	66%	0.659	S	S	*	*	S	Bend	trans	-152	87	-175.8	0	0	0	0	0	115.1	L67 M68	L67-G70 PolarHBondContact O-N 3.38Å; M68-G70 VanDerWaalsContact C-N 3.34Å
71	G	47.9	Very low	49.5	Very low	78 Å²	78	107.5 Å²	107.5	80%	0.804	66%	0.661	S	S	*	*			trans	95.1	81.3	149.9	0	0	0	0	0	117.6
72	S	45.9	Very low	50.1	Low	117 Å²	117	109 Å²	109	82%	0.818	66%	0.66	S	S	*	*			trans	-88.3	105.7	171	-65.5	0	0	0	0	111.9
73	G	46.7	Very low	50.4	Low	74 Å²	74	109.9 Å²	109.9	76%	0.763	66%	0.661	S	S	*	*			trans	-146.2	-13.1	172.8	0	0	0	0	0	116.4
74	A	48.8	Very low	51.2	Low	85 Å²	85	114 Å²	114	70%	0.702	67%	0.673	S	S	*	*	S	Bend	trans	-97.6	-17.6	-168	0	0	0	0	0	115.8	M76	A74-M76 PolarHBondContact O-N 3.41Å
75	S	53.5	Low	52.2	Low	116 Å²	116	113.5 Å²	113.5	81%	0.811	67%	0.673	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.5	-9.7	-170	-55.9	0	0	0	0	115.7
76	M	52.7	Low	53.2	Low	157 Å²	157	109.4 Å²	109.4	77%	0.773	66%	0.659	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.6	-22.9	178.7	-116.9	-69.1	148.3	0	0	113.3	A74	A74-M76 PolarHBondContact O-N 3.41Å
77	A	54.6	Low	54.6	Low	72 Å²	72	106 Å²	106	60%	0.595	65%	0.649	S	S	*	*	H	α-helix	trans	-76.8	-37.4	-175.7	0	0	0	0	0	113.5	Y79 A80	A77-Y79 VanDerWaalsContact C-N 3.3Å; A77-Y79 PolarHBondContact O-N 3.15Å; A77-A80 PolarHBondContact O-N 3.32Å
78	G	56.2	Low	56.2	Low	52 Å²	52	104.9 Å²	104.9	54%	0.536	65%	0.647	S	S	.	*	H	α-helix	trans	-69.4	-25.1	-178.8	0	0	0	0	0	114.2	L82	G78-L82 PolarHBondContact O-N 3.39Å
79	Y	52.3	Low	58.2	Low	174 Å²	174	103.3 Å²	103.3	68%	0.682	64%	0.641	S	S	*	*	H	α-helix	trans	-72.6	-30.7	177.5	-125.8	-92	0	0	0	112.4	A77 K83	A77-Y79 VanDerWaalsContact C-N 3.3Å; A77-Y79 PolarHBondContact O-N 3.15Å; Y79-K83 PolarHBondContact O-N 3.16Å; Y79-K83 VanDerWaalsContact O-N 3.15Å
80	A	59.1	Low	59.7	Low	65 Å²	65	100.9 Å²	100.9	54%	0.537	63%	0.627	S	S	.	*	H	α-helix	trans	-70.5	-39.3	177.6	0	0	0	0	0	112.1	A77 K83 R84	A77-A80 PolarHBondContact O-N 3.32Å; A80-K83 WeakPolarHBondContact O-CB 3.37Å; A80-K83 PolarHBondContact O-N 2.99Å; A80-R84 PolarHBondContact O-N 3.06Å
81	D	53.3	Low	61.2	Low	97 Å²	97	102.1 Å²	102.1	52%	0.519	62%	0.619	S	S	.	*	H	α-helix	trans	-72.8	-35.1	-179.8	-159.4	33.9	0	0	0	112.3	K83 R84 T85	D81-K83 VanDerWaalsContact C-N 3.34Å; D81-K83 PolarHBondContact O-N 2.94Å; D81-R84 WeakPolarHBondContact O-CB 3.01Å; D81-R84 PolarHBondContact O-N 3.39Å; D81-T85 PolarHBondContact O-N 3.46Å; D81-T85 PolarHBondContact O-OG1 3.06Å
82	L	66	Low	62.5	Low	92 Å²	92	101.4 Å²	101.4	48%	0.482	60%	0.597	S	S	.	*	H	α-helix	trans	-61	-44.6	169.3	-177.7	61.6	0	0	0	111.2	G78 R84 T85 I86	G78-L82 PolarHBondContact O-N 3.39Å; L82-R84 VanDerWaalsContact C-N 3.27Å; L82-R84 PolarHBondContact O-N 3.45Å; L82-T85 PolarHBondContact O-N 3.38Å; L82-I86 HydrophobicContact CD1-CD1 4.23Å; L82-I86 HydrophobicContact CG-CD1 4.02Å; L82-I86 VanDerWaalsContact O-CG1 3.31Å; L82-I86 WeakPolarHBondContact O-CG1 3.02Å; L82-I86 PolarHBondContact O-N 2.98Å
83	K	59.8	Low	63.9	Low	163 Å²	163	100.8 Å²	100.8	71%	0.709	58%	0.583	S	S	*	*	H	α-helix	trans	-61.4	-38.7	177.4	-140	-174.9	-176.8	-162.2	0	111.6	Y79 A80 D81 A87	Y79-K83 PolarHBondContact O-N 3.16Å; Y79-K83 VanDerWaalsContact O-N 3.15Å; A80-K83 WeakPolarHBondContact O-CB 3.37Å; A80-K83 PolarHBondContact O-N 2.99Å; D81-K83 VanDerWaalsContact C-N 3.34Å; D81-K83 PolarHBondContact O-N 2.94Å; K83-A87 PolarHBondContact O-N 3.16Å; K83-A87 VanDerWaalsContact O-N 3.16Å
84	R	66.1	Low	65.1	Low	182 Å²	182	101.7 Å²	101.7	69%	0.687	57%	0.57	S	S	*	*	H	α-helix	trans	-66.3	-44	175.9	-168.3	179.1	-175.9	-163.7	1.3	111.9	A80 D81 L82 I86 A87 V88	A80-R84 PolarHBondContact O-N 3.06Å; D81-R84 WeakPolarHBondContact O-CB 3.01Å; D81-R84 PolarHBondContact O-N 3.39Å; L82-R84 VanDerWaalsContact C-N 3.27Å; L82-R84 PolarHBondContact O-N 3.45Å; R84-I86 VanDerWaalsContact C-N 3.34Å; R84-I86 PolarHBondContact O-N 3.4Å; R84-A87 PolarHBondContact O-N 3.09Å; R84-V88 WeakPolarHBondContact O-CG2 3.34Å; R84-V88 PolarHBondContact O-N 3.26Å; R84-V88 VanDerWaalsContact O-N 3.09Å
85	T	68.3	Low	66	Low	71 Å²	71	103 Å²	103	44%	0.436	56%	0.562	S	S	.	*	H	α-helix	trans	-63.3	-40.4	178.5	-57.2	0	0	0	0	111.8	D81 L82 V88 L89	D81-T85 PolarHBondContact O-N 3.46Å; D81-T85 PolarHBondContact O-OG1 3.06Å; L82-T85 PolarHBondContact O-N 3.38Å; T85-V88 PolarHBondContact O-N 3.3Å; T85-L89 HydrophobicContact CG2-CD1 4.2Å; T85-L89 WeakPolarHBondContact O-CG 3.44Å; T85-L89 PolarHBondContact O-N 3.04Å
86	I	70.1	Confident	66.7	Low	95 Å²	95	104.7 Å²	104.7	49%	0.487	55%	0.55	S	S	.	*	H	α-helix	trans	-64.6	-43	176.7	-68.4	166.7	0	0	0	111.3	L82 R84 V88 L89 L90	L82-I86 HydrophobicContact CD1-CD1 4.23Å; L82-I86 HydrophobicContact CG-CD1 4.02Å; L82-I86 VanDerWaalsContact O-CG1 3.31Å; L82-I86 WeakPolarHBondContact O-CG1 3.02Å; L82-I86 PolarHBondContact O-N 2.98Å; R84-I86 VanDerWaalsContact C-N 3.34Å; R84-I86 PolarHBondContact O-N 3.4Å; I86-V88 VanDerWaalsContact C-N 3.33Å; I86-V88 PolarHBondContact O-N 3.46Å; I86-L89 PolarHBondContact O-N 3.31Å; I86-L90 PolarHBondContact O-N 3.48Å
87	A	75.2	Confident	67.2	Low	62 Å²	62	102.2 Å²	102.2	51%	0.512	54%	0.54	S	S	.	.	H	α-helix	trans	-62.8	-40.4	178.3	0	0	0	0	0	112.1	K83 R84 L90 D91	K83-A87 PolarHBondContact O-N 3.16Å; K83-A87 VanDerWaalsContact O-N 3.16Å; R84-A87 PolarHBondContact O-N 3.09Å; A87-L90 PolarHBondContact O-N 2.9Å; A87-D91 PolarHBondContact O-N 3.27Å; A87-D91 VanDerWaalsContact O-N 3.16Å
88	V	75.3	Confident	67.6	Low	94 Å²	94	103.1 Å²	103.1	57%	0.57	54%	0.538	S	S	*	.	H	α-helix	trans	-67	-41.2	178.2	172.5	0	0	0	0	111.8	R84 T85 I86 L90 D91 D92	R84-V88 WeakPolarHBondContact O-CG2 3.34Å; R84-V88 PolarHBondContact O-N 3.26Å; R84-V88 VanDerWaalsContact O-N 3.09Å; T85-V88 PolarHBondContact O-N 3.3Å; I86-V88 VanDerWaalsContact C-N 3.33Å; I86-V88 PolarHBondContact O-N 3.46Å; V88-L90 VanDerWaalsContact C-N 3.3Å; V88-L90 PolarHBondContact O-N 3.1Å; V88-D91 PolarHBondContact O-N 3Å; V88-D92 PolarHBondContact O-N 3Å; V88-D92 VanDerWaalsContact O-N 3.15Å
89	L	83.1	Confident	67.8	Low	102 Å²	102	107.8 Å²	107.8	53%	0.534	54%	0.543	S	S	.	.	H	α-helix	trans	-66.4	-34.1	176.9	-71.3	171.3	0	0	0	112.4	T85 I86 I93	T85-L89 HydrophobicContact CG2-CD1 4.2Å; T85-L89 WeakPolarHBondContact O-CG 3.44Å; T85-L89 PolarHBondContact O-N 3.04Å; I86-L89 PolarHBondContact O-N 3.31Å; L89-I93 WeakPolarHBondContact O-CG1 3.42Å; L89-I93 PolarHBondContact O-N 3.23Å
90	L	75.4	Confident	68.2	Low	109 Å²	109	104.7 Å²	104.7	57%	0.571	54%	0.538	S	S	*	.	H	α-helix	trans	-66.8	-42.4	176.8	-146.6	87.5	0	0	0	111.5	I86 A87 V88 I93 L94	I86-L90 PolarHBondContact O-N 3.48Å; A87-L90 PolarHBondContact O-N 2.9Å; V88-L90 VanDerWaalsContact C-N 3.3Å; V88-L90 PolarHBondContact O-N 3.1Å; L90-I93 PolarHBondContact O-N 2.93Å; L90-L94 HydrophobicContact CD2-CD1 4.4Å; L90-L94 WeakPolarHBondContact O-CB 3.34Å; L90-L94 VanDerWaalsContact O-CG 3.29Å; L90-L94 WeakPolarHBondContact O-CG 3.17Å; L90-L94 PolarHBondContact O-N 3.29Å
91	D	75.6	Confident	68.1	Low	87 Å²	87	107.3 Å²	107.3	47%	0.465	54%	0.539	S	S	.	.	H	α-helix	trans	-65.4	-41.6	178.8	-171.5	56.5	0	0	0	112.3	A87 V88 I93 L94 Q95	A87-D91 PolarHBondContact O-N 3.27Å; A87-D91 VanDerWaalsContact O-N 3.16Å; V88-D91 PolarHBondContact O-N 3Å; D91-I93 VanDerWaalsContact C-N 3.33Å; D91-I93 PolarHBondContact O-N 3.49Å; D91-L94 PolarHBondContact O-N 3.39Å; D91-Q95 WeakPolarHBondContact O-CB 3.19Å; D91-Q95 WeakPolarHBondContact O-CG 3.42Å; D91-Q95 PolarHBondContact O-N 3.15Å; D91-Q95 PolarHBondContact OD2-NE2 3.26Å
92	D	75	Confident	68.4	Low	64 Å²	64	106 Å²	106	34%	0.342	54%	0.537	S	S	.	.	H	α-helix	trans	-63.6	-37.1	176	-175.9	45.2	0	0	0	112	V88 R96	V88-D92 PolarHBondContact O-N 3Å; V88-D92 VanDerWaalsContact O-N 3.15Å; D92-R96 WeakPolarHBondContact O-CB 3.3Å; D92-R96 WeakPolarHBondContact O-CD 3.47Å; D92-R96 WeakPolarHBondContact O-CG 3.04Å; D92-R96 PolarHBondContact O-N 3.34Å; D92-R96 VanDerWaalsContact O-N 3.09Å; D92-R96 IonicContact OD1-CZ 3.65Å; D92-R96 IonicContact OD1-NE 2.96Å; D92-R96 PolarHBondContact OD1-NE 3.2Å; D92-R96 IonicContact OD1-NH2 3.4Å; D92-R96 PolarHBondContact OD1-NH2 3.32Å; D92-R96 IonicContact OD2-CZ 3.49Å; D92-R96 IonicContact OD2-NE 3.15Å; D92-R96 PolarHBondContact OD2-NE 3.37Å; D92-R96 VanDerWaalsContact OD2-NE 3.15Å; D92-R96 IonicContact OD2-NH2 3.17Å; D92-R96 PolarHBondContact OD2-NH2 2.76Å
93	I	74.7	Confident	68.1	Low	103 Å²	103	108.2 Å²	108.2	53%	0.528	54%	0.543	S	S	.	.	H	α-helix	trans	-71.2	-41.6	176.8	-67.7	169.4	0	0	0	111.2	L89 L90 D91 R96 L97	L89-I93 WeakPolarHBondContact O-CG1 3.42Å; L89-I93 PolarHBondContact O-N 3.23Å; L90-I93 PolarHBondContact O-N 2.93Å; D91-I93 VanDerWaalsContact C-N 3.33Å; D91-I93 PolarHBondContact O-N 3.49Å; I93-R96 PolarHBondContact O-N 2.81Å; I93-L97 HydrophobicContact CG2-CD1 4.11Å; I93-L97 PolarHBondContact O-N 3.24Å
94	L	72.4	Confident	68	Low	94 Å²	94	104.4 Å²	104.4	49%	0.492	53%	0.533	S	S	.	.	H	α-helix	trans	-66.6	-42.1	178.1	-72.5	171	0	0	0	111.9	L90 D91 R96 L97 V98	L90-L94 HydrophobicContact CD2-CD1 4.4Å; L90-L94 WeakPolarHBondContact O-CB 3.34Å; L90-L94 VanDerWaalsContact O-CG 3.29Å; L90-L94 WeakPolarHBondContact O-CG 3.17Å; L90-L94 PolarHBondContact O-N 3.29Å; D91-L94 PolarHBondContact O-N 3.39Å; L94-R96 VanDerWaalsContact C-N 3.35Å; L94-R96 PolarHBondContact O-N 3.46Å; L94-L97 WeakPolarHBondContact O-CB 3.11Å; L94-L97 PolarHBondContact O-N 2.81Å; L94-V98 WeakPolarHBondContact O-CG2 3.36Å; L94-V98 PolarHBondContact O-N 2.66Å
95	Q	66.9	Low	67.6	Low	113 Å²	113	100.1 Å²	100.1	53%	0.528	52%	0.524	S	S	.	.	H	α-helix	trans	-64.4	-39.5	175.1	-78.6	179.3	24.1	0	0	112.3	D91 V98 K99	D91-Q95 WeakPolarHBondContact O-CB 3.19Å; D91-Q95 WeakPolarHBondContact O-CG 3.42Å; D91-Q95 PolarHBondContact O-N 3.15Å; D91-Q95 PolarHBondContact OD2-NE2 3.26Å; Q95-V98 PolarHBondContact O-N 2.86Å; Q95-K99 WeakPolarHBondContact O-CB 3.1Å; Q95-K99 PolarHBondContact O-N 2.95Å
96	R	67.7	Low	67	Low	150 Å²	150	104.4 Å²	104.4	57%	0.566	53%	0.533	S	S	*	.	H	α-helix	trans	-64.1	-41.9	174.6	-73.5	170.9	-169.5	-125.4	9.3	111.1	D92 I93 L94 K99 L100	D92-R96 WeakPolarHBondContact O-CB 3.3Å; D92-R96 WeakPolarHBondContact O-CD 3.47Å; D92-R96 WeakPolarHBondContact O-CG 3.04Å; D92-R96 PolarHBondContact O-N 3.34Å; D92-R96 VanDerWaalsContact O-N 3.09Å; D92-R96 IonicContact OD1-CZ 3.65Å; D92-R96 IonicContact OD1-NE 2.96Å; D92-R96 PolarHBondContact OD1-NE 3.2Å; D92-R96 IonicContact OD1-NH2 3.4Å; D92-R96 PolarHBondContact OD1-NH2 3.32Å; D92-R96 IonicContact OD2-CZ 3.49Å; D92-R96 IonicContact OD2-NE 3.15Å; D92-R96 PolarHBondContact OD2-NE 3.37Å; D92-R96 VanDerWaalsContact OD2-NE 3.15Å; D92-R96 IonicContact OD2-NH2 3.17Å; D92-R96 PolarHBondContact OD2-NH2 2.76Å; I93-R96 PolarHBondContact O-N 2.81Å; L94-R96 VanDerWaalsContact C-N 3.35Å; L94-R96 PolarHBondContact O-N 3.46Å; R96-K99 PolarHBondContact O-N 3.4Å; R96-L100 HydrophobicContact CB-CD1 4.43Å; R96-L100 WeakPolarHBondContact O-CB 3.25Å; R96-L100 WeakPolarHBondContact O-CD1 3.07Å; R96-L100 PolarHBondContact O-N 3.5Å
97	L	64.3	Low	66.4	Low	106 Å²	106	105.4 Å²	105.4	56%	0.555	54%	0.538	S	S	*	.	H	α-helix	trans	-58.7	-47	174.9	-88.2	159.2	0	0	0	112.7	I93 L94 K99 L100 E101	I93-L97 HydrophobicContact CG2-CD1 4.11Å; I93-L97 PolarHBondContact O-N 3.24Å; L94-L97 WeakPolarHBondContact O-CB 3.11Å; L94-L97 PolarHBondContact O-N 2.81Å; L97-K99 VanDerWaalsContact C-N 3.32Å; L97-K99 PolarHBondContact O-N 3.23Å; L97-L100 WeakPolarHBondContact O-CB 3.13Å; L97-L100 PolarHBondContact O-N 2.86Å; L97-E101 PolarHBondContact O-N 3.07Å
98	V	63	Low	65.6	Low	91 Å²	91	107 Å²	107	55%	0.552	54%	0.541	S	S	*	.	H	α-helix	trans	-65	-36.1	177.7	172.7	0	0	0	0	111.9	L94 Q95 L100 E101 S102	L94-V98 WeakPolarHBondContact O-CG2 3.36Å; L94-V98 PolarHBondContact O-N 2.66Å; Q95-V98 PolarHBondContact O-N 2.86Å; V98-L100 VanDerWaalsContact C-N 3.34Å; V98-E101 WeakPolarHBondContact O-CB 3.47Å; V98-E101 PolarHBondContact O-N 3.29Å; V98-S102 PolarHBondContact O-N 3.42Å; V98-S102 VanDerWaalsContact O-N 3.07Å; V98-S102 PolarHBondContact O-OG 2.74Å
99	K	59.7	Low	64.8	Low	150 Å²	150	108 Å²	108	65%	0.652	55%	0.548	S	S	*	.	H	α-helix	trans	-72.6	-28.1	176	-157	172.5	-172.9	171.7	0	112.6	Q95 R96 L97 S102	Q95-K99 WeakPolarHBondContact O-CB 3.1Å; Q95-K99 PolarHBondContact O-N 2.95Å; R96-K99 PolarHBondContact O-N 3.4Å; L97-K99 VanDerWaalsContact C-N 3.32Å; L97-K99 PolarHBondContact O-N 3.23Å; K99-S102 PolarHBondContact O-OG 3.34Å
100	L	60.3	Low	63.4	Low	109 Å²	109	107.2 Å²	107.2	57%	0.571	54%	0.544	S	S	*	.	H	α-helix	trans	-73.9	-39.1	170.1	-89.4	115.2	0	0	0	111.4	R96 L97 V98 K103 V104	R96-L100 HydrophobicContact CB-CD1 4.43Å; R96-L100 WeakPolarHBondContact O-CB 3.25Å; R96-L100 WeakPolarHBondContact O-CD1 3.07Å; R96-L100 PolarHBondContact O-N 3.5Å; L97-L100 WeakPolarHBondContact O-CB 3.13Å; L97-L100 PolarHBondContact O-N 2.86Å; V98-L100 VanDerWaalsContact C-N 3.34Å; L100-K103 PolarHBondContact O-N 2.91Å; L100-V104 WeakPolarHBondContact O-CG2 3.37Å; L100-V104 PolarHBondContact O-N 3.47Å
101	E	58.4	Low	62.1	Low	120 Å²	120	104.5 Å²	104.5	56%	0.561	54%	0.542	S	S	*	.	H	α-helix	trans	-59.1	-49.9	175.3	-173.9	176.8	-170.7	0	0	111.7	L97 V98 K103 V104 D105	L97-E101 PolarHBondContact O-N 3.07Å; V98-E101 WeakPolarHBondContact O-CB 3.47Å; V98-E101 PolarHBondContact O-N 3.29Å; E101-K103 VanDerWaalsContact C-N 3.26Å; E101-K103 PolarHBondContact O-N 3Å; E101-V104 PolarHBondContact O-N 3.46Å; E101-D105 PolarHBondContact O-N 2.76Å
102	S	58.8	Low	61.2	Low	69 Å²	69	105.8 Å²	105.8	48%	0.483	56%	0.558	S	S	.	*	H	α-helix	trans	-61.1	-29.6	176.5	60.7	0	0	0	0	114.5	V98 K99 Y106	V98-S102 PolarHBondContact O-N 3.42Å; V98-S102 VanDerWaalsContact O-N 3.07Å; V98-S102 PolarHBondContact O-OG 2.74Å; K99-S102 PolarHBondContact O-OG 3.34Å; S102-Y106 PolarHBondContact O-N 2.87Å
103	K	59.1	Low	60.1	Low	139 Å²	139	106.6 Å²	106.6	60%	0.604	57%	0.574	S	S	*	*	H	α-helix	trans	-75.3	-34	173.1	-81	177.5	174.3	-74.2	0	112.2	L100 E101 I107	L100-K103 PolarHBondContact O-N 2.91Å; E101-K103 VanDerWaalsContact C-N 3.26Å; E101-K103 PolarHBondContact O-N 3Å; K103-I107 WeakPolarHBondContact O-CD1 3.33Å; K103-I107 VanDerWaalsContact O-CG1 3.3Å; K103-I107 WeakPolarHBondContact O-CG1 3.4Å; K103-I107 PolarHBondContact O-N 3.4Å
104	V	58.1	Low	58.8	Low	82 Å²	82	105.8 Å²	105.8	50%	0.497	58%	0.582	S	S	.	*	H	α-helix	trans	-71	-43.1	176.9	170.6	0	0	0	0	110.6	L100 E101 Y106 I107 V108	L100-V104 WeakPolarHBondContact O-CG2 3.37Å; L100-V104 PolarHBondContact O-N 3.47Å; E101-V104 PolarHBondContact O-N 3.46Å; V104-Y106 VanDerWaalsContact C-N 3.31Å; V104-Y106 PolarHBondContact O-N 3.21Å; V104-I107 PolarHBondContact O-N 2.74Å; V104-I107 VanDerWaalsContact O-N 3.08Å; V104-V108 HydrophobicContact CG1-CG2 4.49Å; V104-V108 WeakPolarHBondContact O-CG2 3.2Å; V104-V108 PolarHBondContact O-N 2.94Å
105	D	57.6	Low	58	Low	92 Å²	92	108.5 Å²	108.5	49%	0.492	60%	0.597	S	S	.	*	H	α-helix	trans	-62.5	-38.1	175.8	-77.9	-22.8	0	0	0	112.3	E101 I107 V108 V109	E101-D105 PolarHBondContact O-N 2.76Å; D105-I107 VanDerWaalsContact C-N 3.31Å; D105-I107 PolarHBondContact O-N 3.4Å; D105-V108 PolarHBondContact O-N 2.89Å; D105-V109 WeakPolarHBondContact O-CB 3.5Å; D105-V109 WeakPolarHBondContact O-CG2 3.2Å; D105-V109 PolarHBondContact O-N 3.04Å
106	Y	56	Low	57.1	Low	162 Å²	162	109.4 Å²	109.4	64%	0.635	61%	0.611	S	S	*	*	H	α-helix	trans	-62	-37.4	173.2	-177.5	-98.6	0	0	0	112.5	S102 V104 N110	S102-Y106 PolarHBondContact O-N 2.87Å; V104-Y106 VanDerWaalsContact C-N 3.31Å; V104-Y106 PolarHBondContact O-N 3.21Å; Y106-N110 WeakPolarHBondContact O-CB 3.27Å; Y106-N110 PolarHBondContact O-N 3.05Å
107	I	58.3	Low	56.2	Low	115 Å²	115	108 Å²	108	59%	0.59	62%	0.619	S	S	*	*	H	α-helix	trans	-74.1	-35.5	177.1	-66.2	165.2	0	0	0	111.2	K103 V104 D105 G111	K103-I107 WeakPolarHBondContact O-CD1 3.33Å; K103-I107 VanDerWaalsContact O-CG1 3.3Å; K103-I107 WeakPolarHBondContact O-CG1 3.4Å; K103-I107 PolarHBondContact O-N 3.4Å; V104-I107 PolarHBondContact O-N 2.74Å; V104-I107 VanDerWaalsContact O-N 3.08Å; D105-I107 VanDerWaalsContact C-N 3.31Å; D105-I107 PolarHBondContact O-N 3.4Å; I107-G111 WeakPolarHBondContact O-CA 3.24Å; I107-G111 PolarHBondContact O-N 2.96Å
108	V	58.8	Low	55.3	Low	95 Å²	95	111.2 Å²	111.2	58%	0.576	64%	0.637	S	S	*	*	H	α-helix	trans	-68.4	-40.7	175.9	167.9	0	0	0	0	111.2	V104 D105	V104-V108 HydrophobicContact CG1-CG2 4.49Å; V104-V108 WeakPolarHBondContact O-CG2 3.2Å; V104-V108 PolarHBondContact O-N 2.94Å; D105-V108 PolarHBondContact O-N 2.89Å
109	V	58	Low	54.2	Low	117 Å²	117	110.3 Å²	110.3	71%	0.709	65%	0.645	S	S	*	*	H	α-helix	trans	-74.9	-41.1	178.4	167.4	0	0	0	0	112.3	D105	D105-V109 WeakPolarHBondContact O-CB 3.5Å; D105-V109 WeakPolarHBondContact O-CG2 3.2Å; D105-V109 PolarHBondContact O-N 3.04Å
110	N	52.5	Low	53.6	Low	84 Å²	84	109.6 Å²	109.6	45%	0.449	65%	0.654	S	S	.	*	H	α-helix	trans	-85.8	-23	-179.5	-167.8	41.3	0	0	0	113.4	Y106 S112 A113	Y106-N110 WeakPolarHBondContact O-CB 3.27Å; Y106-N110 PolarHBondContact O-N 3.05Å; N110-S112 PolarHBondContact O-N 3.44Å; N110-A113 PolarHBondContact O-N 3.31Å
111	G	49.8	Very low	52.7	Low	52 Å²	52	109.9 Å²	109.9	54%	0.536	67%	0.665	S	S	.	*	T	Hydrogen-bonded Turn	trans	-69.7	-17.9	178.4	0	0	0	0	0	114	I107 A113	I107-G111 WeakPolarHBondContact O-CA 3.24Å; I107-G111 PolarHBondContact O-N 2.96Å; G111-A113 VanDerWaalsContact C-N 3.33Å
112	S	55.1	Low	52.2	Low	114 Å²	114	110.7 Å²	110.7	80%	0.797	67%	0.673	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.2	-11.1	173	-77	0	0	0	0	114.2	N110	N110-S112 PolarHBondContact O-N 3.44Å
113	A	52.9	Low	51.4	Low	82 Å²	82	116 Å²	116	68%	0.678	69%	0.691	S	S	*	*	S	Bend	trans	-101.5	-8.7	-177.4	0	0	0	0	0	114.8	N110 G111	N110-A113 PolarHBondContact O-N 3.31Å; G111-A113 VanDerWaalsContact C-N 3.33Å
114	A	47.2	Very low	50.6	Low	85 Å²	85	116 Å²	116	70%	0.702	70%	0.701	S	S	*	*			trans	-105.2	35.2	-169.2	0	0	0	0	0	114.7
115	N	55.4	Low	49.8	Very low	152 Å²	152	117.1 Å²	117.1	81%	0.813	71%	0.711	S	S	*	*			trans	-126.7	86.5	168.1	-158.4	22	0	0	0	111.6
116	T	47.3	Very low	49.1	Very low	131 Å²	131	120.3 Å²	120.3	80%	0.804	73%	0.727	S	S	*	*			trans	-157.6	136.4	152.4	-49.8	0	0	0	0	111.3
117	T	49.6	Very low	48.5	Very low	121 Å²	121	117.3 Å²	117.3	74%	0.742	74%	0.735	S	S	*	*			trans	91.3	90.5	161.9	-3.7	0	0	0	0	118.7
118	N	45.6	Very low	47.7	Very low	174 Å²	174	116.6 Å²	116.6	93%	0.93	74%	0.741	S	S	*	*			trans	-166.9	99.5	134.8	-81.4	-27.2	0	0	0	104.2
119	G	40.6	Very low	47.1	Very low	71 Å²	71	118 Å²	118	73%	0.732	76%	0.755	S	S	*	*			cis	117.6	92.8	48.2	0	0	0	0	0	106.5	S121	G119-S121 PolarHBondContact O-N 3.14Å
120	T	46.1	Very low	46.4	Very low	136 Å²	136	121.4 Å²	121.4	83%	0.834	76%	0.76	S	S	*	*			trans	-47.1	124	175.9	-59.7	0	0	0	0	113
121	S	42.2	Very low	46	Very low	114 Å²	114	127 Å²	127	80%	0.797	78%	0.775	S	S	*	*			trans	-146.7	109.3	150.8	63.8	0	0	0	0	110.5	G119	G119-S121 PolarHBondContact O-N 3.14Å
122	N	47.3	Very low	45.7	Very low	138 Å²	138	131.2 Å²	131.2	74%	0.738	79%	0.79	S	S	*	*			trans	-40.9	137	168.1	-55	-28.2	0	0	0	112.4
123	Q	41.3	Very low	45.1	Very low	181 Å²	181	131.4 Å²	131.4	85%	0.846	78%	0.782	S	S	*	*				179.7	101.7	129.2	-97.1	167.7	62.1	0	0	111
124	V	42.2	Very low	44.8	Very low	137 Å²	137	132.6 Å²	132.6	83%	0.83	79%	0.792	S	S	*	*			trans	-79.4	130.2	147.1	170	0	0	0	0	106.3
125	P	42.8	Very low	44.6	Very low	107 Å²	107	132.3 Å²	132.3	70%	0.695	79%	0.79	S	S	*	*				-126.9	119	129.5	7	14.1	0	0	0	111.1	A127	P125-A127 PolarHBondContact O-N 3.03Å
126	L	42.7	Very low	44	Very low	158 Å²	158	130.1 Å²	130.1	83%	0.827	79%	0.786	S	S	*	*			trans	-38	110	150	178.4	69	0	0	0	111.3
127	A	42.4	Very low	44	Very low	99 Å²	99	131.3 Å²	131.3	82%	0.818	79%	0.788	S	S	*	*			trans	-110.7	99	162.6	0	0	0	0	0	108.6	P125	P125-A127 PolarHBondContact O-N 3.03Å
128	S	41.4	Very low	43.8	Very low	100 Å²	100	133.1 Å²	133.1	70%	0.699	79%	0.791	S	S	*	*			trans	-58.4	138.7	179.6	-171.9	0	0	0	0	112.3	K130	S128-K130 PolarHBondContact O-N 3.12Å
129	S	47.4	Very low	43.5	Very low	125 Å²	125	139.4 Å²	139.4	87%	0.874	80%	0.802	S	S	*	*			trans	-56.7	115.1	167.6	-158.1	0	0	0	0	109.6
130	K	43.8	Very low	43.7	Very low	188 Å²	188	142.9 Å²	142.9	82%	0.817	81%	0.805	S	S	*	*			trans	-134	101.9	168	-158.4	176.3	-168.4	-169.5	0	110.9	S128 V132	S128-K130 PolarHBondContact O-N 3.12Å; K130-V132 PolarHBondContact O-N 2.84Å
131	R	43.1	Very low	43.5	Very low	203 Å²	203	143.2 Å²	143.2	77%	0.766	80%	0.804	S	S	*	*			trans	-33.6	122.8	156.5	-95.4	175.3	156.1	-115.7	9.9	110.8	N133	R131-N133 PolarHBondContact NH1-OD1 3.35Å
132	V	43.3	Very low	43.6	Very low	139 Å²	139	144.8 Å²	144.8	84%	0.842	80%	0.804	S	S	*	*			trans	-103.6	98.5	161.9	-166.3	0	0	0	0	106.9	K130 A134	K130-V132 PolarHBondContact O-N 2.84Å; V132-A134 PolarHBondContact O-N 3.15Å
133	N	42.4	Very low	43.4	Very low	118 Å²	118	145.2 Å²	145.2	63%	0.631	81%	0.808	S	S	*	*			trans	-70.7	115.8	164.5	-69.8	-29.3	0	0	0	107	R131 A135	R131-N133 PolarHBondContact NH1-OD1 3.35Å; N133-A135 PolarHBondContact O-N 3.28Å
134	A	47.4	Very low	43.5	Very low	108 Å²	108	143 Å²	143	89%	0.893	81%	0.806	S	S	*	*			trans	-79.6	101.4	166.5	0	0	0	0	0	108.3	V132	V132-A134 PolarHBondContact O-N 3.15Å
135	A	43	Very low	43.6	Very low	79 Å²	79	143.4 Å²	143.4	65%	0.653	80%	0.804	S	S	*	*			trans	-140	136.9	173.2	0	0	0	0	0	110.8	N133	N133-A135 PolarHBondContact O-N 3.28Å
136	S	43.3	Very low	43.7	Very low	106 Å²	106	146 Å²	146	74%	0.741	81%	0.812	S	S	*	*			trans	66.3	112.3	166.5	55.1	0	0	0	0	117.8
137	N	45.9	Very low	43.8	Very low	156 Å²	156	145.1 Å²	145.1	83%	0.834	81%	0.811	S	S	*	*				62.3	144.6	73.6	-105.2	-55	0	0	0	114.5
138	I	46.6	Very low	43.9	Very low	159 Å²	159	148.9 Å²	148.9	82%	0.815	81%	0.81	S	S	*	*			trans	91.9	123.7	169.5	-50.5	157.4	0	0	0	112.1
139	R	38.9	Very low	44.1	Very low	306 Å²	306	153.4 Å²	153.4	100%	1.155	82%	0.82	S	S	*	*			cis	-167.6	0	6.2	163.5	178.4	-173.9	-171.6	2.4	107.9

Retrieved 139 of 139 residues in 22.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).