A0A096LNI2_HUMAN Loading...

Protocadherin beta 2

AlphaFold DB , UniProt , Accession A0A096LNI2, Species HUMAN (Homo sapiens, Human), Gene PCDHB2, Length 39 aa.

						>A0A096LNI2_HUMAN|A0A096LNI2|PCDHB2
MEAGEGKERVPKQRTCPGLGCRNQQSPKLHNQSQFPLSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.9	Very low	57.4	Low	249 Å²	249	152.1 Å²	152.1	100%	1.227	83%	0.833	S	S	*	*				0	112.5	0	-74.8	171.6	175.5	0	0	106.3
2	E	47.3	Very low	57.8	Low	200 Å²	200	155.9 Å²	155.9	94%	0.935	84%	0.835	S	S	*	*			trans	-69.6	136.5	178.2	-83.3	-170.6	100.9	0	0	110.5	G4	E2-G4 PolarHBondContact O-N 2.87Å
3	A	54.4	Low	58.4	Low	104 Å²	104	155.9 Å²	155.9	86%	0.86	83%	0.827	S	S	*	*			trans	-66.6	97.9	173.2	0	0	0	0	0	108.8	E5	A3-E5 PolarHBondContact O-N 3.34Å; A3-E5 VanDerWaalsContact O-N 3.12Å
4	G	59	Low	58.7	Low	72 Å²	72	162.1 Å²	162.1	74%	0.742	83%	0.833	S	S	*	*			trans	-65.7	109.7	170	0	0	0	0	0	109	E2 G6	E2-G4 PolarHBondContact O-N 2.87Å; G4-G6 PolarHBondContact O-N 3.02Å
5	E	54.7	Low	59	Low	175 Å²	175	157 Å²	157	82%	0.818	81%	0.813	S	S	*	*			trans	-46.1	112.4	169.1	-89.8	-168.5	84.2	0	0	109.7	A3 K7	A3-E5 PolarHBondContact O-N 3.34Å; A3-E5 VanDerWaalsContact O-N 3.12Å; E5-K7 VanDerWaalsContact C-N 3.25Å; E5-K7 PolarHBondContact O-N 3.02Å
6	G	63.3	Low	59.1	Low	76 Å²	76	151.8 Å²	151.8	78%	0.784	79%	0.793	S	S	*	*			trans	-63.7	90.4	166.4	0	0	0	0	0	108.6	G4 E8	G4-G6 PolarHBondContact O-N 3.02Å; G6-E8 PolarHBondContact O-N 2.93Å
7	K	63.1	Low	59	Low	178 Å²	178	150.5 Å²	150.5	77%	0.774	80%	0.796	S	S	*	*			trans	-64.1	94.3	162.9	-70.2	-172.6	177.7	-169.1	0	106.6	E5 R9	E5-K7 VanDerWaalsContact C-N 3.25Å; E5-K7 PolarHBondContact O-N 3.02Å; K7-R9 PolarHBondContact O-N 2.87Å
8	E	59.8	Low	59.3	Low	172 Å²	172	146.8 Å²	146.8	80%	0.804	80%	0.8	S	S	*	*			trans	-43.7	108.5	164	-176	176.7	93	0	0	106.6	G6 V10	G6-E8 PolarHBondContact O-N 2.93Å; E8-V10 PolarHBondContact O-N 2.85Å
9	R	63.7	Low	59.7	Low	234 Å²	234	146 Å²	146	88%	0.883	79%	0.794	S	S	*	*			trans	-71.5	86.8	177.8	-71.7	-176.7	179.8	-174.1	0.4	105.7	K7 P11	K7-R9 PolarHBondContact O-N 2.87Å; R9-P11 WeakPolarHBondContact O-CD 3.23Å; R9-P11 VanDerWaalsContact O-N 3.08Å
10	V	63.1	Low	59.9	Low	107 Å²	107	142.5 Å²	142.5	65%	0.648	79%	0.793	S	S	*	*			trans	-50	119.5	167.7	-178.2	0	0	0	0	105.8	E8 K12	E8-V10 PolarHBondContact O-N 2.85Å; V10-K12 PolarHBondContact O-N 2.71Å
11	P	61.4	Low	60.2	Low	106 Å²	106	139.4 Å²	139.4	69%	0.688	78%	0.78	S	S	*	*			trans	-58.7	113.9	176	20.8	-27.8	0	0	0	106	R9 Q13	R9-P11 WeakPolarHBondContact O-CD 3.23Å; R9-P11 VanDerWaalsContact O-N 3.08Å; P11-Q13 PolarHBondContact O-N 3.18Å
12	K	62.3	Low	61.5	Low	198 Å²	198	137.9 Å²	137.9	86%	0.861	76%	0.761	S	S	*	*			trans	-61.5	92.9	178.6	-176.4	166.2	175.9	168.7	0	106.5	V10 R14	V10-K12 PolarHBondContact O-N 2.71Å; K12-R14 PolarHBondContact O-N 2.75Å
13	Q	64.9	Low	62.6	Low	156 Å²	156	135.8 Å²	135.8	73%	0.729	76%	0.756	S	S	*	*			trans	-54.8	112.1	174.5	-86.2	-173.4	-35.6	0	0	105.7	P11 T15	P11-Q13 PolarHBondContact O-N 3.18Å; Q13-T15 PolarHBondContact O-N 3.04Å; Q13-T15 PolarHBondContact O-OG1 3.13Å
14	R	62.8	Low	63.3	Low	242 Å²	242	138.7 Å²	138.7	91%	0.913	75%	0.752	S	S	*	*			trans	-64.7	81	164.8	-82.8	-174.8	174	175.4	-1.6	106.1	K12 C16	K12-R14 PolarHBondContact O-N 2.75Å; R14-C16 PolarHBondContact O-N 2.91Å
15	T	63.6	Low	64	Low	86 Å²	86	144.3 Å²	144.3	53%	0.528	76%	0.759	S	S	.	*			trans	-73.7	110.3	173.2	-54.4	0	0	0	0	105.2	Q13 P17	Q13-T15 PolarHBondContact O-N 3.04Å; Q13-T15 PolarHBondContact O-OG1 3.13Å; T15-P17 VanDerWaalsContact O-CD 3.26Å; T15-P17 WeakPolarHBondContact O-CD 3.39Å
16	C	60.7	Low	64.9	Low	73 Å²	73	140.6 Å²	140.6	49%	0.493	75%	0.752	S	S	.	*			trans	-68.5	113.3	174.4	-65.5	0	0	0	0	107.7	R14 G18 L19	R14-C16 PolarHBondContact O-N 2.91Å; C16-G18 PolarHBondContact O-N 2.75Å; C16-L19 HydrophobicContact CB-CB 4.35Å; C16-L19 PolarHBondContact O-N 2.88Å
17	P	56.9	Low	65.4	Low	130 Å²	130	142 Å²	142	84%	0.844	75%	0.748	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.4	126.5	179.6	26.5	-31.6	0	0	0	109.1	T15	T15-P17 VanDerWaalsContact O-CD 3.26Å; T15-P17 WeakPolarHBondContact O-CD 3.39Å
18	G	64	Low	66	Low	84 Å²	84	143.1 Å²	143.1	87%	0.866	75%	0.752	S	S	*	*	T	Hydrogen-bonded Turn	trans	92.4	-8.2	177.8	0	0	0	0	0	116.4	C16	C16-G18 PolarHBondContact O-N 2.75Å
19	L	66.8	Low	66.6	Low	132 Å²	132	142.1 Å²	142.1	69%	0.691	75%	0.752	S	S	*	*	S	Bend	trans	-119	104.7	169.8	-66.6	171.2	0	0	0	107.1	C16 C21	C16-L19 HydrophobicContact CB-CB 4.35Å; C16-L19 PolarHBondContact O-N 2.88Å; L19-C21 PolarHBondContact O-N 3.24Å
20	G	64.9	Low	66.9	Low	75 Å²	75	138.6 Å²	138.6	77%	0.773	75%	0.745	S	S	*	*			trans	-49.2	131	176.9	0	0	0	0	0	109.6	R22	G20-R22 PolarHBondContact O-N 2.72Å
21	C	64.7	Low	67.2	Low	78 Å²	78	140 Å²	140	53%	0.527	75%	0.749	S	S	.	*			trans	-60.6	92.8	175.6	-66.4	0	0	0	0	107.9	L19 N23	L19-C21 PolarHBondContact O-N 3.24Å; C21-N23 PolarHBondContact O-N 3.35Å; C21-N23 VanDerWaalsContact O-N 3.13Å
22	R	69.6	Low	67.5	Low	218 Å²	218	142.4 Å²	142.4	82%	0.823	75%	0.751	S	S	*	*			trans	-66.7	115.9	171.3	-166.6	174.4	178.4	-168.4	-1.8	104.8	G20 Q24	G20-R22 PolarHBondContact O-N 2.72Å; R22-Q24 VanDerWaalsContact C-N 3.26Å; R22-Q24 PolarHBondContact O-N 3.25Å
23	N	70.8	Confident	67.9	Low	155 Å²	155	136.9 Å²	136.9	83%	0.829	74%	0.737	S	S	*	*			trans	-55.1	100	170.2	-76	-41.9	0	0	0	106.4	C21 Q25	C21-N23 PolarHBondContact O-N 3.35Å; C21-N23 VanDerWaalsContact O-N 3.13Å; N23-Q25 PolarHBondContact O-N 3.25Å
24	Q	69.9	Low	68	Low	166 Å²	166	138 Å²	138	78%	0.776	74%	0.743	S	S	*	*			trans	-61.3	106.8	174.6	-75.1	-89.5	101.4	0	0	104.3	R22 S26	R22-Q24 VanDerWaalsContact C-N 3.26Å; R22-Q24 PolarHBondContact O-N 3.25Å; Q24-S26 VanDerWaalsContact C-N 3.29Å; Q24-S26 PolarHBondContact O-N 3.36Å
25	Q	73.9	Confident	68.2	Low	190 Å²	190	134.3 Å²	134.3	89%	0.888	73%	0.734	S	S	*	*			trans	-62.7	104.2	168.6	-168.9	164.6	78.2	0	0	104.5	N23	N23-Q25 PolarHBondContact O-N 3.25Å
26	S	72.3	Confident	68.3	Low	97 Å²	97	135.5 Å²	135.5	68%	0.678	74%	0.742	S	S	*	*			trans	-48.8	129.8	177.3	-63.5	0	0	0	0	107.1	Q24 K28	Q24-S26 VanDerWaalsContact C-N 3.29Å; Q24-S26 PolarHBondContact O-N 3.36Å; S26-K28 PolarHBondContact O-N 2.73Å
27	P	73.9	Confident	68.7	Low	106 Å²	106	139.6 Å²	139.6	69%	0.688	76%	0.759	S	S	*	*			trans	-52.9	125.4	179	19.9	-29.4	0	0	0	107	L29	P27-L29 PolarHBondContact O-N 2.71Å
28	K	75.6	Confident	69.3	Low	200 Å²	200	139 Å²	139	87%	0.87	76%	0.758	S	S	*	*			trans	-64.4	93.3	178.9	-173	167	-177.3	177.4	0	106.4	S26 H30	S26-K28 PolarHBondContact O-N 2.73Å; K28-H30 VanDerWaalsContact C-N 3.34Å; K28-H30 PolarHBondContact O-N 2.93Å
29	L	72.9	Confident	69.4	Low	152 Å²	152	144.2 Å²	144.2	80%	0.796	78%	0.781	S	S	*	*			trans	-65.4	101.4	173.3	-65.2	178.5	0	0	0	105.6	P27 N31	P27-L29 PolarHBondContact O-N 2.71Å; L29-N31 PolarHBondContact O-N 2.78Å
30	H	70.5	Confident	69.5	Low	159 Å²	159	144.8 Å²	144.8	74%	0.736	79%	0.785	S	S	*	*			trans	-71.3	85.1	168.2	68.8	85.2	0	0	0	106.6	K28 Q32	K28-H30 VanDerWaalsContact C-N 3.34Å; K28-H30 PolarHBondContact O-N 2.93Å; H30-Q32 PolarHBondContact O-N 2.89Å; H30-Q32 HydrophobicContact CB-CG 4.33Å
31	N	69.2	Low	69.7	Low	138 Å²	138	148.5 Å²	148.5	74%	0.738	79%	0.786	S	S	*	*			trans	-73.6	74	162.7	-166	-65.1	0	0	0	106.9	L29 S33	L29-N31 PolarHBondContact O-N 2.78Å; N31-S33 VanDerWaalsContact C-N 3.29Å; N31-S33 PolarHBondContact O-N 2.84Å
32	Q	68.3	Low	70	Confident	156 Å²	156	152.4 Å²	152.4	73%	0.729	80%	0.8	S	S	*	*			trans	-78.3	95.6	163.3	-67	-71.3	63.1	0	0	104.4	H30 Q34	H30-Q32 PolarHBondContact O-N 2.89Å; H30-Q32 HydrophobicContact CB-CG 4.33Å; Q32-Q34 PolarHBondContact O-N 2.89Å
33	S	68.8	Low	70.1	Confident	81 Å²	81	148.5 Å²	148.5	57%	0.566	80%	0.799	S	S	*	*			trans	-52.3	85.2	158.7	157	0	0	0	0	107.8	N31 F35	N31-S33 VanDerWaalsContact C-N 3.29Å; N31-S33 PolarHBondContact O-N 2.84Å; S33-F35 PolarHBondContact O-N 2.84Å; S33-F35 WeakPolarHBondContact OG-CD2 3.4Å
34	Q	67.6	Low	70	Confident	180 Å²	180	148.1 Å²	148.1	84%	0.841	80%	0.797	S	S	*	*			trans	-82.9	61.7	173.4	-169	177.6	-0.6	0	0	107.5	Q32 P36	Q32-Q34 PolarHBondContact O-N 2.89Å; Q34-P36 VanDerWaalsContact O-CD 3.23Å; Q34-P36 WeakPolarHBondContact O-CD 3.26Å
35	F	67.8	Low	70	Confident	165 Å²	165	146.9 Å²	146.9	72%	0.724	80%	0.798	S	S	*	*			trans	-86	107.6	156.1	-72.7	-77.4	0	0	0	105.4	S33 L37	S33-F35 PolarHBondContact O-N 2.84Å; S33-F35 WeakPolarHBondContact OG-CD2 3.4Å; F35-L37 PolarHBondContact O-N 3.01Å
36	P	65	Low	69.7	Low	110 Å²	110	143.9 Å²	143.9	71%	0.714	79%	0.792	S	S	*	*			trans	-59.6	114.7	162	25.3	-29	0	0	0	106	Q34 S38	Q34-P36 VanDerWaalsContact O-CD 3.23Å; Q34-P36 WeakPolarHBondContact O-CD 3.26Å; P36-S38 VanDerWaalsContact C-N 3.25Å; P36-S38 PolarHBondContact O-N 3.01Å
37	L	69.3	Low	69.5	Low	160 Å²	160	147.5 Å²	147.5	84%	0.838	80%	0.801	S	S	*	*			trans	-65.5	94.8	169.1	-64	175.4	0	0	0	106.2	F35 S39	F35-L37 PolarHBondContact O-N 3.01Å; L37-S39 PolarHBondContact O-N 3.12Å
38	S	69.1	Low	69.2	Low	117 Å²	117	150.9 Å²	150.9	82%	0.818	81%	0.81	S	S	*	*			trans	-62.1	122.7	170.6	43.7	0	0	0	0	108.4	P36	P36-S38 VanDerWaalsContact C-N 3.25Å; P36-S38 PolarHBondContact O-N 3.01Å
39	S	66.3	Low	68.6	Low	193 Å²	193	146.5 Å²	146.5	100%	1.35	81%	0.805	S	S	*	*			trans	-75.2	0	174.8	-51.1	0	0	0	0	112	L37	L37-S39 PolarHBondContact O-N 3.12Å

Retrieved 39 of 39 residues in 14 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).