A0A096LNM1_HUMAN Loading...

Torsin 1A interacting protein 2

AlphaFold DB , UniProt , Accession A0A096LNM1, Species HUMAN (Homo sapiens, Human), Gene TOR1AIP2, Length 37 aa.

						>A0A096LNM1_HUMAN|A0A096LNM1|TOR1AIP2
MFSDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44	Very low	59.4	Low	241 Å²	241	121.5 Å²	121.5	100%	1.187	66%	0.66	S	S	*	*				0	106.2	0	-79.3	169.6	155.6	106.5	S3	M1-S3 PolarHBondContact O-N 2.95Å
2	F	48.9	Very low	59.8	Low	203 Å²	203	116.4 Å²	116.4	89%	0.89	66%	0.658	S	S	*	*			trans	-71.5	115.5	172.5	-71.5	-87.1	0	106.2	D4	F2-D4 PolarHBondContact O-N 2.92Å
3	S	52.6	Low	60	Low	102 Å²	102	118.2 Å²	118.2	71%	0.713	66%	0.657	S	S	*	*			trans	-68.3	115.3	-179.6	-160.6	0	0	107.8	M1 N5	M1-S3 PolarHBondContact O-N 2.95Å; S3-N5 PolarHBondContact O-N 3.37Å
4	D	59.6	Low	60.6	Low	144 Å²	144	118 Å²	118	77%	0.77	65%	0.649	S	S	*	*			trans	-61.1	71.7	173.7	-76.9	-62.1	0	111.3	F2 S6	F2-D4 PolarHBondContact O-N 2.92Å; D4-S6 PolarHBondContact O-N 3.06Å
5	N	60.1	Low	60.9	Low	135 Å²	135	121.7 Å²	121.7	72%	0.722	65%	0.649	S	S	*	*			trans	-89	63.2	162.3	-76.9	-41.1	0	108.2	S3 H7	S3-N5 PolarHBondContact O-N 3.37Å; N5-H7 PolarHBondContact O-N 3.19Å
6	S	62.3	Low	61.2	Low	34 Å²	34	123 Å²	123	24%	0.238	65%	0.648	C	S	.	*			trans	-76.9	16.8	173.5	56.5	0	0	112.1	D4 Q14 W15	D4-S6 PolarHBondContact O-N 3.06Å; S6-Q14 CarbonylContact O-C 3.41Å; S6-Q14 WeakPolarHBondContact O-CA 3.33Å; S6-W15 PolarHBondContact O-N 3.45Å
7	H	62	Low	61.5	Low	106 Å²	106	119.6 Å²	119.6	49%	0.491	64%	0.635	S	S	.	*	B	Isolated β-bridge	trans	-117	130.6	-177.8	-65.4	113.8	0	111.1	N5 P9	N5-H7 PolarHBondContact O-N 3.19Å; H7-P9 WeakPolarHBondContact O-CD 3.44Å
8	C	62.9	Low	61.8	Low	19 Å²	19	119 Å²	119	13%	0.128	64%	0.642	C	S	.	*			trans	-66.6	115.6	168.9	166.8	0	0	108.7	D10 C11 G12 Q13 W15	C8-D10 PolarHBondContact O-N 2.99Å; C8-C11 HydrophobicContact CB-CB 4.34Å; C8-C11 WeakPolarHBondContact CB-SG 3.32Å; C8-C11 PolarHBondContact O-N 3.47Å; C8-C11 WeakPolarHBondContact SG-CB 2.93Å; C8-C11 PolarHBondContact SG-N 3.46Å; C8-C11 CovalentContact SG-SG 2.06Å; C8-C11 PolarHBondContact SG-SG 3.33Å; C8-G12 PolarHBondContact O-N 3.1Å; C8-Q13 WeakPolarHBondContact CB-O 3.48Å; C8-Q13 PolarHBondContact N-O 2.99Å; C8-W15 VanDerWaalsContact CA-NE1 3.35Å; C8-W15 VanDerWaalsContact N-CD1 3.31Å; C8-W15 VanDerWaalsContact N-NE1 3.2Å
9	P	60.5	Low	61.9	Low	121 Å²	121	118.9 Å²	118.9	79%	0.786	64%	0.64	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.1	-25	-176.4	24.3	-31.8	0	112.9	H7	H7-P9 WeakPolarHBondContact O-CD 3.44Å
10	D	68.1	Low	62.1	Low	158 Å²	158	118.5 Å²	118.5	85%	0.845	63%	0.634	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.1	-22.7	-178	-61.2	-65.6	0	113.9	C8	C8-D10 PolarHBondContact O-N 2.99Å
11	C	72.8	Confident	62.2	Low	73 Å²	73	117 Å²	117	49%	0.493	63%	0.626	S	S	.	*	T	Hydrogen-bonded Turn	trans	-127.9	-7.3	-168.3	61.5	0	0	114.4	C8 Q13	C8-C11 HydrophobicContact CB-CB 4.34Å; C8-C11 WeakPolarHBondContact CB-SG 3.32Å; C8-C11 PolarHBondContact O-N 3.47Å; C8-C11 WeakPolarHBondContact SG-CB 2.93Å; C8-C11 PolarHBondContact SG-N 3.46Å; C8-C11 CovalentContact SG-SG 2.06Å; C8-C11 PolarHBondContact SG-SG 3.33Å; C11-Q13 PolarHBondContact O-N 3.49Å
12	G	63.7	Low	63.4	Low	61 Å²	61	107.3 Å²	107.3	63%	0.629	59%	0.587	S	S	*	*			trans	64.8	1.2	179.4	0	0	0	114.2	C8	C8-G12 PolarHBondContact O-N 3.1Å
13	Q	62.6	Low	64.5	Low	139 Å²	139	103.4 Å²	103.4	65%	0.65	57%	0.571	S	S	*	*			trans	-80.6	139.5	179.6	-69.5	-171.5	-31.2	110.3	C8 C11 W15	C8-Q13 WeakPolarHBondContact CB-O 3.48Å; C8-Q13 PolarHBondContact N-O 2.99Å; C11-Q13 PolarHBondContact O-N 3.49Å; Q13-W15 PolarHBondContact O-N 3.07Å
14	Q	67.9	Low	65.4	Low	116 Å²	116	106 Å²	106	54%	0.542	57%	0.566	S	S	.	*	B	Isolated β-bridge	trans	-69.2	128.2	173.3	-170.8	176.4	-21.3	108.8	S6 F16	S6-Q14 CarbonylContact O-C 3.41Å; S6-Q14 WeakPolarHBondContact O-CA 3.33Å; Q14-F16 PolarHBondContact O-N 3.41Å; Q14-F16 VanDerWaalsContact O-N 3.14Å
15	W	66.2	Low	65.9	Low	173 Å²	173	103.7 Å²	103.7	66%	0.655	55%	0.553	S	S	*	*			trans	-63.4	113.1	166.4	-69.2	66.3	0	106.5	S6 C8 Q13	S6-W15 PolarHBondContact O-N 3.45Å; C8-W15 VanDerWaalsContact CA-NE1 3.35Å; C8-W15 VanDerWaalsContact N-CD1 3.31Å; C8-W15 VanDerWaalsContact N-NE1 3.2Å; Q13-W15 PolarHBondContact O-N 3.07Å
16	F	65.4	Low	66.2	Low	143 Å²	143	104.2 Å²	104.2	63%	0.627	55%	0.546	S	S	*	.			trans	-61.2	131	167.3	-68.2	-83.4	0	107.7	Q14 S18	Q14-F16 PolarHBondContact O-N 3.41Å; Q14-F16 VanDerWaalsContact O-N 3.14Å; F16-S18 PolarHBondContact O-N 2.97Å
17	P	65.9	Low	66.3	Low	66 Å²	66	108.6 Å²	108.6	43%	0.429	56%	0.562	S	S	.	*			trans	-53.1	135.6	171.3	22.1	-31.4	0	108.4	L19 E20 L21	P17-L19 PolarHBondContact O-N 3.05Å; P17-E20 VanDerWaalsContact CD-OE2 3.23Å; P17-E20 WeakPolarHBondContact CD-OE2 3.36Å; P17-E20 HydrophobicContact CG-CB 4.22Å; P17-E20 HydrophobicContact CG-CG 3.82Å; P17-E20 VanDerWaalsContact CG-OE2 3.29Å; P17-E20 WeakPolarHBondContact CG-OE2 3.28Å; P17-E20 PolarHBondContact O-N 3.27Å; P17-L21 PolarHBondContact O-N 3.44Å
18	S	66.9	Low	66.5	Low	108 Å²	108	105.9 Å²	105.9	76%	0.755	55%	0.553	S	S	*	*	H	α-helix	trans	-52.3	-26.3	-172.3	53.6	0	0	113.8	F16 G22	F16-S18 PolarHBondContact O-N 2.97Å; S18-G22 PolarHBondContact O-N 3.26Å
19	L	63.7	Low	66.6	Low	118 Å²	118	111 Å²	111	62%	0.618	58%	0.575	S	S	*	*	H	α-helix	trans	-66.3	-42.3	174.8	-171.9	66.1	0	113.6	P17 G22 H23	P17-L19 PolarHBondContact O-N 3.05Å; L19-G22 PolarHBondContact O-N 2.89Å; L19-H23 PolarHBondContact O-N 3.26Å; L19-H23 PolarHBondContact O-ND1 3.01Å
20	E	65.2	Low	66.7	Low	110 Å²	110	108.8 Å²	108.8	51%	0.514	56%	0.557	S	S	.	*	H	α-helix	trans	-69.6	-38.9	179.3	-71.9	179.7	163.7	111.2	P17 H23 W24	P17-E20 VanDerWaalsContact CD-OE2 3.23Å; P17-E20 WeakPolarHBondContact CD-OE2 3.36Å; P17-E20 HydrophobicContact CG-CB 4.22Å; P17-E20 HydrophobicContact CG-CG 3.82Å; P17-E20 VanDerWaalsContact CG-OE2 3.29Å; P17-E20 WeakPolarHBondContact CG-OE2 3.28Å; P17-E20 PolarHBondContact O-N 3.27Å; E20-H23 PolarHBondContact O-N 3.31Å; E20-W24 WeakPolarHBondContact O-CB 3.25Å; E20-W24 PolarHBondContact O-N 3.45Å
21	L	65.8	Low	66.5	Low	88 Å²	88	105.4 Å²	105.4	46%	0.461	54%	0.542	S	S	.	.	H	α-helix	trans	-64.9	-42.3	174.8	-173.9	65.8	0	111.7	P17 W24 L25	P17-L21 PolarHBondContact O-N 3.44Å; L21-W24 HydrophobicContact CD1-CE3 4.44Å; L21-W24 PolarHBondContact O-N 3.48Å; L21-L25 HydrophobicContact CG-CD1 4.18Å; L21-L25 WeakPolarHBondContact O-CG 3.46Å; L21-L25 PolarHBondContact O-N 2.86Å
22	G	69.5	Low	66	Low	36 Å²	36	106.7 Å²	106.7	37%	0.371	54%	0.54	S	S	.	.	H	α-helix	trans	-61.7	-42.8	176.2	0	0	0	112.9	S18 L19 Y26	S18-G22 PolarHBondContact O-N 3.26Å; L19-G22 PolarHBondContact O-N 2.89Å; G22-Y26 WeakPolarHBondContact O-CB 3.39Å; G22-Y26 PolarHBondContact O-N 3.02Å; G22-Y26 VanDerWaalsContact O-N 3.1Å
23	H	71.2	Confident	65.9	Low	122 Å²	122	108.4 Å²	108.4	57%	0.565	54%	0.535	S	S	*	.	H	α-helix	trans	-65.9	-39.4	175.5	-69	158.6	0	112.8	L19 E20 Q27	L19-H23 PolarHBondContact O-N 3.26Å; L19-H23 PolarHBondContact O-ND1 3.01Å; E20-H23 PolarHBondContact O-N 3.31Å; H23-Q27 WeakPolarHBondContact O-CB 3.37Å; H23-Q27 PolarHBondContact O-N 3.44Å
24	W	71.1	Confident	65.8	Low	157 Å²	157	108.7 Å²	108.7	60%	0.595	54%	0.536	S	S	*	.	H	α-helix	trans	-64.1	-47.4	177.5	-175.5	74.9	0	111.7	E20 L21 Y26 Q27 T28	E20-W24 WeakPolarHBondContact O-CB 3.25Å; E20-W24 PolarHBondContact O-N 3.45Å; L21-W24 HydrophobicContact CD1-CE3 4.44Å; L21-W24 PolarHBondContact O-N 3.48Å; W24-Y26 PolarHBondContact O-N 3.43Å; W24-Q27 PolarHBondContact O-N 3.34Å; W24-T28 PolarHBondContact O-N 2.99Å; W24-T28 PolarHBondContact O-OG1 3.06Å; W24-T28 VanDerWaalsContact O-OG1 3.13Å
25	L	71.2	Confident	65.5	Low	95 Å²	95	108 Å²	108	50%	0.497	54%	0.543	S	S	.	.	H	α-helix	trans	-61.1	-43.9	178	-70.2	171.8	0	112.3	L21 Q27 T28 E29	L21-L25 HydrophobicContact CG-CD1 4.18Å; L21-L25 WeakPolarHBondContact O-CG 3.46Å; L21-L25 PolarHBondContact O-N 2.86Å; L25-Q27 PolarHBondContact O-N 3.42Å; L25-T28 PolarHBondContact O-N 3.06Å; L25-E29 PolarHBondContact O-N 2.9Å
26	Y	66.4	Low	65	Low	145 Å²	145	108.9 Å²	108.9	57%	0.569	55%	0.548	S	S	*	.	H	α-helix	trans	-64	-40.3	177.3	-179	-105.9	0	112.2	G22 W24 E29 L30	G22-Y26 WeakPolarHBondContact O-CB 3.39Å; G22-Y26 PolarHBondContact O-N 3.02Å; G22-Y26 VanDerWaalsContact O-N 3.1Å; W24-Y26 PolarHBondContact O-N 3.43Å; Y26-E29 PolarHBondContact O-N 2.06Å; Y26-L30 HydrophobicContact CD1-CD1 3.85Å; Y26-L30 HydrophobicContact CD1-CG 4.45Å; Y26-L30 HydrophobicContact CE1-CD1 3.33Å; Y26-L30 HydrophobicContact CE1-CG 4.09Å; Y26-L30 HydrophobicContact CE2-CD1 4.49Å; Y26-L30 HydrophobicContact CE2-CG 4.44Å; Y26-L30 WeakPolarHBondContact O-CG 3.39Å; Y26-L30 PolarHBondContact O-N 2.76Å; Y26-L30 VanDerWaalsContact O-N 3.07Å
27	Q	62.6	Low	64.4	Low	126 Å²	126	112.4 Å²	112.4	59%	0.589	57%	0.566	S	S	*	*	H	α-helix	trans	-65.4	-40.7	176.6	-174.2	174.7	57.1	111.7	H23 W24 L25 L30 V31	H23-Q27 WeakPolarHBondContact O-CB 3.37Å; H23-Q27 PolarHBondContact O-N 3.44Å; W24-Q27 PolarHBondContact O-N 3.34Å; L25-Q27 PolarHBondContact O-N 3.42Å; Q27-L30 PolarHBondContact O-N 3.2Å; Q27-V31 VanDerWaalsContact O-CG2 3.28Å; Q27-V31 WeakPolarHBondContact O-CG2 3.37Å; Q27-V31 PolarHBondContact O-N 3.13Å
28	T	67	Low	64.3	Low	49 Å²	49	114.8 Å²	114.8	30%	0.301	57%	0.573	S	S	.	*	H	α-helix	trans	-64.1	-43.7	176	-57.8	0	0	111.7	W24 L25 L30 V31 E32	W24-T28 PolarHBondContact O-N 2.99Å; W24-T28 PolarHBondContact O-OG1 3.06Å; W24-T28 VanDerWaalsContact O-OG1 3.13Å; L25-T28 PolarHBondContact O-N 3.06Å; T28-L30 VanDerWaalsContact C-N 3.34Å; T28-L30 PolarHBondContact O-N 2.71Å; T28-V31 PolarHBondContact O-N 3.14Å; T28-E32 HydrophobicContact CG2-CG 4.34Å; T28-E32 WeakPolarHBondContact O-CB 3.45Å; T28-E32 WeakPolarHBondContact O-CG 3.29Å; T28-E32 PolarHBondContact O-N 3.24Å
29	E	64.8	Low	64.2	Low	127 Å²	127	115.1 Å²	115.1	59%	0.593	56%	0.563	S	S	*	*	H	α-helix	trans	-61	-41.5	177.5	-174.3	179	-179.2	112.2	L25 Y26 N33	L25-E29 PolarHBondContact O-N 2.9Å; Y26-E29 PolarHBondContact O-N 2.06Å; E29-N33 WeakPolarHBondContact O-CB 2.95Å; E29-N33 PolarHBondContact O-N 3.26Å
30	L	63.3	Low	64.2	Low	75 Å²	75	114.9 Å²	114.9	39%	0.393	56%	0.56	S	S	.	*	H	α-helix	trans	-63.1	-46.9	175.4	-72.2	177.6	0	112.2	Y26 Q27 T28 E32 N33 E34	Y26-L30 HydrophobicContact CD1-CD1 3.85Å; Y26-L30 HydrophobicContact CD1-CG 4.45Å; Y26-L30 HydrophobicContact CE1-CD1 3.33Å; Y26-L30 HydrophobicContact CE1-CG 4.09Å; Y26-L30 HydrophobicContact CE2-CD1 4.49Å; Y26-L30 HydrophobicContact CE2-CG 4.44Å; Y26-L30 WeakPolarHBondContact O-CG 3.39Å; Y26-L30 PolarHBondContact O-N 2.76Å; Y26-L30 VanDerWaalsContact O-N 3.07Å; Q27-L30 PolarHBondContact O-N 3.2Å; T28-L30 VanDerWaalsContact C-N 3.34Å; T28-L30 PolarHBondContact O-N 2.71Å; L30-E32 VanDerWaalsContact C-N 3.35Å; L30-E32 PolarHBondContact O-N 3.48Å; L30-N33 PolarHBondContact O-N 3.24Å; L30-E34 WeakPolarHBondContact O-CG 3.25Å; L30-E34 PolarHBondContact O-N 2.96Å
31	V	63	Low	64.2	Low	87 Å²	87	115.2 Å²	115.2	53%	0.527	56%	0.563	S	S	.	*	H	α-helix	trans	-66.1	-38.3	-179.2	171.8	0	0	111.5	Q27 T28 C35	Q27-V31 VanDerWaalsContact O-CG2 3.28Å; Q27-V31 WeakPolarHBondContact O-CG2 3.37Å; Q27-V31 PolarHBondContact O-N 3.13Å; T28-V31 PolarHBondContact O-N 3.14Å; V31-C35 VanDerWaalsContact O-CB 3.25Å; V31-C35 WeakPolarHBondContact O-CB 3.21Å; V31-C35 PolarHBondContact O-N 3.35Å
32	E	62.4	Low	64.1	Low	99 Å²	99	116.9 Å²	116.9	46%	0.463	57%	0.569	S	S	.	*	H	α-helix	trans	-64.2	-47.6	173.3	-72	-174.4	121.3	110.3	T28 L30 E34 C35 Y36	T28-E32 HydrophobicContact CG2-CG 4.34Å; T28-E32 WeakPolarHBondContact O-CB 3.45Å; T28-E32 WeakPolarHBondContact O-CG 3.29Å; T28-E32 PolarHBondContact O-N 3.24Å; L30-E32 VanDerWaalsContact C-N 3.35Å; L30-E32 PolarHBondContact O-N 3.48Å; E32-E34 VanDerWaalsContact C-N 3.34Å; E32-E34 PolarHBondContact O-N 3.19Å; E32-C35 PolarHBondContact O-N 2.9Å; E32-Y36 HydrophobicContact CB-CD2 4.23Å; E32-Y36 HydrophobicContact CB-CE2 4.04Å; E32-Y36 HydrophobicContact CG-CE2 4.4Å; E32-Y36 WeakPolarHBondContact O-CD2 3.23Å; E32-Y36 PolarHBondContact O-N 2.94Å
33	N	62.5	Low	63.7	Low	97 Å²	97	122.3 Å²	122.3	52%	0.519	58%	0.583	S	S	.	*	H	α-helix	trans	-59.8	-42.7	179.4	-157.8	-71.3	0	112.5	E29 L30 Q37	E29-N33 WeakPolarHBondContact O-CB 2.95Å; E29-N33 PolarHBondContact O-N 3.26Å; L30-N33 PolarHBondContact O-N 3.24Å; N33-Q37 PolarHBondContact O-N 3.32Å
34	E	60.6	Low	63.2	Low	146 Å²	146	122.4 Å²	122.4	68%	0.682	58%	0.584	S	S	*	*	H	α-helix	trans	-69.8	-31.6	177.5	-71.3	-176.6	112	113.1	L30 E32	L30-E34 WeakPolarHBondContact O-CG 3.25Å; L30-E34 PolarHBondContact O-N 2.96Å; E32-E34 VanDerWaalsContact C-N 3.34Å; E32-E34 PolarHBondContact O-N 3.19Å
35	C	60.1	Low	62.6	Low	100 Å²	100	119.7 Å²	119.7	68%	0.676	58%	0.583	S	S	*	*	H	α-helix	trans	-80.2	-22.5	179.7	-167.8	0	0	113.3	V31 E32	V31-C35 VanDerWaalsContact O-CB 3.25Å; V31-C35 WeakPolarHBondContact O-CB 3.21Å; V31-C35 PolarHBondContact O-N 3.35Å; E32-C35 PolarHBondContact O-N 2.9Å
36	Y	57.4	Low	61.9	Low	193 Å²	193	121.8 Å²	121.8	76%	0.757	59%	0.59	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.7	5.3	176.8	-65.7	-64.8	0	113.7	E32	E32-Y36 HydrophobicContact CB-CD2 4.23Å; E32-Y36 HydrophobicContact CB-CE2 4.04Å; E32-Y36 HydrophobicContact CG-CE2 4.4Å; E32-Y36 WeakPolarHBondContact O-CD2 3.23Å; E32-Y36 PolarHBondContact O-N 2.94Å
37	Q	52.3	Low	61.4	Low	217 Å²	217	119.6 Å²	119.6	100%	1.014	59%	0.592	S	S	*	*			trans	-95.4	0	169.2	-78.1	-158.2	-22.9	112.6	N33	N33-Q37 PolarHBondContact O-N 3.32Å

Retrieved 37 of 37 residues in 27.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).